5BO4A

Structure of socs2:elongin c:elongin b from dmso-treated crystals
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
168
structure length
153
Chain Sequence
b'MQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIIVKSKLKQFDSVVHLIDYYVQMCKHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Suppressor of cytokine signaling 2
publication title Serendipitous SAD Solution for DMSO-Soaked SOCS2-ElonginC-ElonginB Crystals Using Covalently Incorporated Dimethylarsenic: Insights into Substrate Receptor Conformational Flexibility in Cullin RING Ligases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 40
structure length 153
sequence length 168
chains with identical sequence D, G, J, M, P
ec nomenclature
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF07525 SOCS_box SOCS box
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.20 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 Elongin C; Chain C, domain 1 5bo4A02
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 5bo4A01
2MQIA 1SPRA 1O44A 1OO4A 3BKBA 1AD5A 2MK2A 3S8LA 1O4EA 1JU5A 1BLKA 1CSYA 3PFVA 2EKXA 1X0NA 4E93A 3PLFB 2CI9A 1O4RA 2OZOA 3PSJA 4K11A 4FBNA 2GSBA 1A1CA 1A08A 1AOUF 1D4WA 1OPLA 1KC2A 4DGXA 1AB2A 3PSKA 1JYRA 2RSYA 1A09A 5HKWA 5DF6A 1AYDA 1GRIA 2EYZA 5EG3B 2HUWA 1JYQA 1OPKA 1IJRA 4FL3A 2QMSA 5KAZA 1I3ZA 3TKZA 1A1BA 2AUGA 1SKJA 1SHDA 3HIZB 4QSYA 1JWOA 2YU7A 1Y57A 2EOBA 2EO3A 2BBUA 4H34A 2YSXA 2K79B 4DGPA 2LNWA 1F1WA 1X27A 1ZFPE 3EACA 1BM2A 3HHMB 2EYYA 2EO6A 1A07A 4JEGA 3VS2A 2Y1NA 1CSZA 1Z3KA 1NZLA 1O4AA 1PICA 1BHFA 3BUOB 2B3OA 1R1QA 1O4MA 3QWXX 1SPSA 3VGOA 3C7IA 1TCEA 3HCKA 4OHEA 4EIHA 3ZNGA 3BUMB 4WWQA 1FU5A 1SHBA 3VS7A 1QCFA 2PTKA 3CBLA 4K2RA 3IN8A 1AOTF 5EEQA 2LNXA 2CRHA 2AOBA 4LUEA 4OHDA 2C9WA 2C0TA 4GL9E 3N7YA 1QG1E 1O48A 1BKLA 2Y1MA 1LKKA 1O4CA 3US4A 1LKLA 3T04A 3BUNB 2RVFA 1NRVA 3K2MA 2MC1A 2MRJA 2ABLA 5GJHA 4D8KA 2C0IA 3CXLA 3BUXB 2CR4A 2JYQA 4M4ZA 4K44A 1O4FA 4L1BB 1O4KA 3OB1B 1BHHA 2C0OA 1LUNA 3N84A 4JE4A 3OP0A 3MXYA 1AYAA 4A4CA 1LCKA 1HCTB 1WQUA 2KK6A 3UYOA 3UF4A 4F5AA 1X6CA 1RPYA 1CWDL 3VRNA 2H46E 3IN7A 3IMDA 5EHPA 1FMKA 1O4QA 1O4DA 1M27A 2LCTA 3M7FA 5AXIA 2L6KA 1A1AA 2OQ1A 2MRKA 1FBVA 4U17A 1F2FA 3VS6A 3S9KA 1YVLA 2GE9A 2KNOA 1KA6A 5IBSA 4OHLA 2EU0A 4OHHA 2HDVA 1O4BA 1TZEE 3VS3A 1AYCA 2CS0A 1OO3A 3QWYA 5I6VA 1JYUA 2IUHA 1FHSA 1BHHB 1LUIA 1LCJA 1O49A 3VRZA 1O46A 3KFJA 1A81A 5CDWA 3OVEA 3VRPA 4ROJA 5IBMA 1QADA 1UUSA 2FCIA 2DM0A 2LQWA 3ZKJA 4XZ0A 1RJAA 3GXWA 1RQQC 2RMXA 5DC9A 1KA7A 3VRQA 3IMJA 2DVJA 3OV1A 3VS0A 1YVHA 2HCKA 3CD3A 5J3XA 4F5BA 2FO0A 1BLJA 2AOAA 4F59A 4OHIA 4E68A 5BO4A 1O4OA 1FYRA 4P9ZA 4TZIA 3VS1A 1KSWA 2SHPA 1IS0A 2L3TA 5DC0B 1FU6A 2HDXA 1LUMA 2DCRA 3VRRA 4FL2A 1O4HA 4EY0A 2VIFA 1O4IA 3MAZA 4NWGA 1O4PA 1HCSB 1O42A 4NWFA 2CI8A 1M61A 1LUKA 3VROA 3CWGA 1NZVA 1O4LA 2LQNA 4K45A 3TL0A 5GJIA 2IUGA 1BMBA 3VS4A 2DX0A 3GQIB 3EAZA 1G83A 2PLEA 2Y3AB 5EELA 1O43A 4P9VA 2PLDA 3VS5A 1D4TA 1O4NA 4LUDA 1CWEA 1O41A 5HKZA 1Y1UA 1UURA 3S8OA 2CBLA 4X6SA 3NHNA 3S8NA 1B47A 4H1OA 1O4JA 5HKYA 1AYBA 3PJPA 1BFJA 3ZNIA 1XA6A 2DLZA 5AULA 3VRYA 2ETZA 3OB2B 1H9OA 2CIAA 1D1ZA 3BUWB 1MW4A 2XP1A 1P13A 1SHAA 1O4GA 4U1PA 2H5KA 4GPLB 3PQZA 1O45A 3N8MA 1BG1A 4GWFA 2HMHA 1BKMA 4A4BA 5EHRA 1FBZA 1BF5A 2IZVA 2SRCA 2ECDA 1K9AA 2H8HA 2PNAA 2L4KA 4XZ1A 1A1EA 1R1SA 2EL8A 1O47A 1R1PA 1BFIA 2PNBA 4JGHA 1CJ1A 2RORA 2EYVA 1GHUA 3GXXA 2DLYA 3WA4A 3MXCA 3PS5A 5DC4A 2K7AB 5D0JA 1MILA 2IUIA
chains in the Genus database with same CATH superfamily
2MQIA 1SPRA 1O44A 1OO4A 4W9LC 3BKBA 1AD5A 2MK2A 3S8LA 4AJYV 1O4EA 1JU5A 1BLKA 1CSYA 3PFVA 2EKXA 1X0NA 3ZTDC 4E93A 3PLFB 2CI9A 1O4RA 2OZOA 3PSJA 4K11A 4FBNA 1LQBC 2GSBA 1A1CA 1A08A 1AOUF 1D4WA 1OPLA 1KC2A 4DGXA 3ZUNC 1AB2A 3PSKA 1JYRA 2RSYA 1A09A 5HKWA 5DF6A 1AYDA 1GRIA 2EYZA 5EG3B 2HUWA 1JYQA 1OPKA 1IJRA 4FL3A 2QMSA 5KAZA 1I3ZA 3TKZA 1A1BA 2AUGA 1SKJA 4W9EC 1SHDA 3HIZB 4QSYA 1JWOA 2YU7A 1Y57A 2EOBA 2EO3A 2BBUA 4H34A 2YSXA 2K79B 4DGPA 2LNWA 1F1WA 1X27A 1ZFPE 3ZTCC 3EACA 1BM2A 3HHMB 2EYYA 2EO6A 1A07A 4JEGA 3VS2A 2Y1NA 1CSZA 1Z3KA 3K2TA 1NZLA 1O4AA 1PICA 1BHFA 3BUOB 2B3OA 1R1QA 1O4MA 3QWXX 1SPSA 3VGOA 3C7IA 1TCEA 3HCKA 4OHEA 4EIHA 3ZNGA 3BUMB 4WWQA 1FU5A 1SHBA 3VS7A 1QCFA 2PTKA 3CBLA 4K2RA 3IN8A 1AOTF 5EEQA 2LNXA 2CRHA 2AOBA 4LUEA 4OHDA 2C9WA 2C0TA 2KGYA 4GL9E 3N7YA 1QG1E 1O48A 1BKLA 2Y1MA 4W9HC 4B95C 1LKKA 1O4CA 3US4A 1LKLA 3T04A 3BUNB 2RVFA 1NRVA 3K2MA 2MC1A 2MRJA 2ABLA 5GJHA 4D8KA 2C0IA 3CXLA 3BUXB 2CR4A 2JYQA 4M4ZA 4K44A 1O4FA 4L1BB 1O4KA 3OB1B 1BHHA 2C0OA 1LUNA 3N84A 4JE4A 3OP0A 3MXYA 1AYAA 4A4CA 1LCKA 1HCTB 1WQUA 2KK6A 3UYOA 3UF4A 4F5AA 1X6CA 1RPYA 1CWDL 3VRNA 2H46E 3IN7A 3IMDA 5EHPA 1FMKA 1O4QA 1O4DA 1M27A 2LCTA 3M7FA 5AXIA 2L6KA 1A1AA 2OQ1A 2MRKA 1FBVA 4U17A 1F2FA 4W9CC 3VS6A 3ZRFC 3S9KA 1YVLA 2GE9A 2KNOA 1KA6A 5IBSA 4OHLA 2EU0A 4OHHA 2HDVA 1O4BA 1TZEE 3VS3A 1AYCA 2CS0A 1OO3A 3QWYA 5I6VA 1JYUA 2IUHA 1FHSA 1BHHB 1LUIA 1LCJA 1O49A 3VRZA 1O46A 3KFJA 1A81A 4BKSC 5CDWA 3OVEA 3VRPA 4ROJA 4WQOA 5IBMA 1QADA 1UUSA 2FCIA 2DM0A 2LQWA 3ZKJA 4XZ0A 1RJAA 3GXWA 1RQQC 4W9IC 2RMXA 5DC9A 5LLIC 1KA7A 3VRQA 3IMJA 2DVJA 3OV1A 3VS0A 4W9KC 1YVHA 2HCKA 3CD3A 5J3XA 4F5BA 2FO0A 1BLJA 2AOAA 4F59A 4OHIA 4E68A 5BO4A 1O4OA 1VCBC 2LRAA 1FYRA 4P9ZA 4TZIA 3VS1A 1KSWA 2SHPA 1IS0A 4W9GC 2L3TA 5DC0B 1FU6A 2HDXA 1LUMA 2DCRA 3VRRA 4FL2A 1O4HA 4EY0A 2VIFA 1O4IA 4B9KC 4W9FC 4W9JC 3MAZA 4NWGA 1O4PA 1HCSB 1O42A 4NWFA 2CI8A 1M61A 1LUKA 3VROA 3CWGA 1NZVA 1O4LA 2LQNA 1LM8V 4K45A 3TL0A 5GJIA 2IUGA 1BMBA 3VS4A 2DX0A 3GQIB 3EAZA 1G83A 2PLEA 2Y3AB 5EELA 1O43A 4P9VA 2PLDA 3VS5A 1D4TA 1O4NA 4LUDA 1CWEA 3LYVA 1O41A 5HKZA 1Y1UA 1UURA 3S8OA 2CBLA 4X6SA 3NHNA 3S8NA 1B47A 4H1OA 1O4JA 4W9DC 5HKYA 1AYBA 3PJPA 1BFJA 3ZNIA 1XA6A 2DLZA 5AULA 4BKTC 3ZRCC 4AWJC 3VRYA 2ETZA 3OB2B 1H9OA 2CIAA 1D1ZA 3BUWB 1MW4A 2XP1A 1P13A 1SHAA 1O4GA 4U1PA 2H5KA 4GPLB 3PQZA 1O45A 3N8MA 1BG1A 4GWFA 2HMHA 1BKMA 4A4BA 5EHRA 1FBZA 1BF5A 2IZVA 2SRCA 2ECDA 1K9AA 2H8HA 2PNAA 2L4KA 4XZ1A 1A1EA 1R1SA 2EL8A 1O47A 1R1PA 1BFIA 2PNBA 4JGHA 1CJ1A 2RORA 2EYVA 1GHUA 3GXXA 2DLYA 3WA4A 3MXCA 3PS5A 5DC4A 2K7AB 5D0JA 1MILA 2IUIA
chains in the Genus database with same CATH topology
2MQIA 1SPRA 1O44A 1OO4A 3BKBA 1AD5A 2MK2A 3S8LA 1O4EA 1JU5A 1BLKA 1CSYA 3PFVA 2EKXA 1X0NA 4E93A 3PLFB 2CI9A 1O4RA 2OZOA 3PSJA 4K11A 4FBNA 2GSBA 1A1CA 1A08A 1AOUF 1D4WA 1OPLA 1KC2A 4DGXA 1AB2A 3PSKA 1JYRA 2RSYA 1A09A 5HKWA 5DF6A 1AYDA 1GRIA 2EYZA 5EG3B 2HUWA 1JYQA 1OPKA 1IJRA 4FL3A 2QMSA 5KAZA 1I3ZA 3TKZA 1A1BA 2AUGA 1SKJA 1SHDA 3HIZB 4QSYA 1JWOA 2YU7A 1Y57A 2EOBA 2EO3A 2BBUA 4H34A 2YSXA 2K79B 4DGPA 2LNWA 1F1WA 1X27A 1ZFPE 3EACA 1BM2A 3HHMB 2EYYA 2EO6A 1A07A 4JEGA 3VS2A 2Y1NA 1CSZA 1Z3KA 1NZLA 1O4AA 1PICA 1BHFA 3BUOB 2B3OA 1R1QA 1O4MA 3QWXX 1SPSA 3VGOA 3C7IA 1TCEA 3HCKA 4OHEA 4EIHA 3ZNGA 3BUMB 4WWQA 1FU5A 1SHBA 3VS7A 1QCFA 2PTKA 3CBLA 4K2RA 3IN8A 1AOTF 5EEQA 2LNXA 2CRHA 2AOBA 4LUEA 4OHDA 2C9WA 2C0TA 4GL9E 3N7YA 1QG1E 1O48A 1BKLA 2Y1MA 1LKKA 1O4CA 3US4A 1LKLA 3T04A 3BUNB 2RVFA 1NRVA 3K2MA 2MC1A 2MRJA 2ABLA 5GJHA 4D8KA 2C0IA 3CXLA 3BUXB 2CR4A 2JYQA 4M4ZA 4K44A 1O4FA 4L1BB 1O4KA 3OB1B 1BHHA 2C0OA 1LUNA 3N84A 4JE4A 3OP0A 3MXYA 1AYAA 4A4CA 1LCKA 1HCTB 1WQUA 2KK6A 3UYOA 3UF4A 4F5AA 1X6CA 1RPYA 1CWDL 3VRNA 2H46E 3IN7A 3IMDA 5EHPA 1FMKA 1O4QA 1O4DA 1M27A 2LCTA 3M7FA 5AXIA 2L6KA 1A1AA 2OQ1A 2MRKA 1FBVA 4U17A 1F2FA 3VS6A 3S9KA 1YVLA 2GE9A 2KNOA 1KA6A 5IBSA 4OHLA 2EU0A 4OHHA 2HDVA 1O4BA 1TZEE 3VS3A 1AYCA 2CS0A 1OO3A 3QWYA 5I6VA 1JYUA 2IUHA 1FHSA 1BHHB 1LUIA 1LCJA 1O49A 3VRZA 1O46A 3KFJA 1A81A 5CDWA 3OVEA 3VRPA 4ROJA 5IBMA 1QADA 1UUSA 2FCIA 2DM0A 2LQWA 3ZKJA 4XZ0A 1RJAA 3GXWA 1RQQC 2RMXA 5DC9A 1KA7A 3VRQA 3IMJA 2DVJA 3OV1A 3VS0A 1YVHA 2HCKA 3CD3A 5J3XA 4F5BA 2FO0A 1BLJA 2AOAA 4F59A 4OHIA 4E68A 5BO4A 1O4OA 1FYRA 4P9ZA 4TZIA 3VS1A 1KSWA 2SHPA 1IS0A 2L3TA 5DC0B 1FU6A 2HDXA 1LUMA 2DCRA 3VRRA 4FL2A 1O4HA 4EY0A 2VIFA 1O4IA 3MAZA 4NWGA 1O4PA 1HCSB 1O42A 4NWFA 2CI8A 1M61A 1LUKA 3VROA 3CWGA 1NZVA 1O4LA 2LQNA 4K45A 3TL0A 5GJIA 2IUGA 1BMBA 3VS4A 2DX0A 3GQIB 3EAZA 1G83A 2PLEA 2Y3AB 5EELA 1O43A 4P9VA 2PLDA 3VS5A 1D4TA 1O4NA 4LUDA 1CWEA 1O41A 5HKZA 1Y1UA 1UURA 3S8OA 2CBLA 4X6SA 3NHNA 3S8NA 1B47A 4H1OA 1O4JA 5HKYA 1AYBA 3PJPA 1BFJA 3ZNIA 1XA6A 2DLZA 5AULA 3VRYA 2ETZA 3OB2B 1H9OA 2CIAA 1D1ZA 3BUWB 1MW4A 2XP1A 1P13A 1SHAA 1O4GA 4U1PA 2H5KA 4GPLB 3PQZA 1O45A 3N8MA 1BG1A 4GWFA 2HMHA 1BKMA 4A4BA 5EHRA 1FBZA 1BF5A 2IZVA 2SRCA 2ECDA 1K9AA 2H8HA 2PNAA 2L4KA 4XZ1A 1A1EA 1R1SA 2EL8A 1O47A 1R1PA 1BFIA 2PNBA 4JGHA 1CJ1A 2RORA 2EYVA 1GHUA 3GXXA 2DLYA 3WA4A 3MXCA 3PS5A 5DC4A 2K7AB 5D0JA 1MILA 2IUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MQI A;  1SPR A;  1O44 A;  1OO4 A;  3BKB A;  1AD5 A;  2MK2 A;  3S8L A;  1O4E A;  1JU5 A;  1BLK A;  1CSY A;  3PFV A;  2EKX A;  1X0N A;  4E93 A;  3PLF B;  2CI9 A;  1O4R A;  2OZO A;  3PSJ A;  4K11 A;  4FBN A;  2GSB A;  1A1C A;  1A08 A;  1AOU F;  1D4W A;  1OPL A;  1KC2 A;  4DGX A;  1AB2 A;  3PSK A;  1JYR A;  2RSY A;  1A09 A;  5HKW A;  5DF6 A;  1AYD A;  1GRI A;  2EYZ A;  5EG3 B;  2HUW A;  1JYQ A;  1OPK A;  1IJR A;  4FL3 A;  2QMS A;  5KAZ A;  1I3Z A;  3TKZ A;  1A1B A;  2AUG A;  1SKJ A;  1SHD A;  3HIZ B;  4QSY A;  1JWO A;  2YU7 A;  1Y57 A;  2EOB A;  2EO3 A;  2BBU A;  4H34 A;  2YSX A;  2K79 B;  4DGP A;  2LNW A;  1F1W A;  1X27 A;  1ZFP E;  3EAC A;  1BM2 A;  3HHM B;  2EYY A;  2EO6 A;  1A07 A;  4JEG A;  3VS2 A;  2Y1N A;  1CSZ A;  1Z3K A;  1NZL A;  1O4A A;  1PIC A;  1BHF A;  3BUO B;  2B3O A;  1R1Q A;  1O4M A;  3QWX X;  1SPS A;  3VGO A;  3C7I A;  1TCE A;  3HCK A;  4OHE A;  4EIH A;  3ZNG A;  3BUM B;  4WWQ A;  1FU5 A;  1SHB A;  3VS7 A;  1QCF A;  2PTK A;  3CBL A;  4K2R A;  3IN8 A;  1AOT F;  5EEQ A;  2LNX A;  2CRH A;  2AOB A;  4LUE A;  4OHD A;  2C9W A;  2C0T A;  4GL9 E;  3N7Y A;  1QG1 E;  1O48 A;  1BKL A;  2Y1M A;  1LKK A;  1O4C A;  3US4 A;  1LKL A;  3T04 A;  3BUN B;  2RVF A;  1NRV A;  3K2M A;  2MC1 A;  2MRJ A;  2ABL A;  5GJH A;  4D8K A;  2C0I A;  3CXL A;  3BUX B;  2CR4 A;  2JYQ A;  4M4Z A;  4K44 A;  1O4F A;  4L1B B;  1O4K A;  3OB1 B;  1BHH A;  2C0O A;  1LUN A;  3N84 A;  4JE4 A;  3OP0 A;  3MXY A;  1AYA A;  4A4C A;  1LCK A;  1HCT B;  1WQU A;  2KK6 A;  3UYO A;  3UF4 A;  4F5A A;  1X6C A;  1RPY A;  1CWD L;  3VRN A;  2H46 E;  3IN7 A;  3IMD A;  5EHP A;  1FMK A;  1O4Q A;  1O4D A;  1M27 A;  2LCT A;  3M7F A;  5AXI A;  2L6K A;  1A1A A;  2OQ1 A;  2MRK A;  1FBV A;  4U17 A;  1F2F A;  3VS6 A;  3S9K A;  1YVL A;  2GE9 A;  2KNO A;  1KA6 A;  5IBS A;  4OHL A;  2EU0 A;  4OHH A;  2HDV A;  1O4B A;  1TZE E;  3VS3 A;  1AYC A;  2CS0 A;  1OO3 A;  3QWY A;  5I6V A;  1JYU A;  2IUH A;  1FHS A;  1BHH B;  1LUI A;  1LCJ A;  1O49 A;  3VRZ A;  1O46 A;  3KFJ A;  1A81 A;  5CDW A;  3OVE A;  3VRP A;  4ROJ A;  5IBM A;  1QAD A;  1UUS A;  2FCI A;  2DM0 A;  2LQW A;  3ZKJ A;  4XZ0 A;  1RJA A;  3GXW A;  1RQQ C;  2RMX A;  5DC9 A;  1KA7 A;  3VRQ A;  3IMJ A;  2DVJ A;  3OV1 A;  3VS0 A;  1YVH A;  2HCK A;  3CD3 A;  5J3X A;  4F5B A;  2FO0 A;  1BLJ A;  2AOA A;  4F59 A;  4OHI A;  4E68 A;  5BO4 A;  1O4O A;  1FYR A;  4P9Z A;  4TZI A;  3VS1 A;  1KSW A;  2SHP A;  1IS0 A;  2L3T A;  5DC0 B;  1FU6 A;  2HDX A;  1LUM A;  2DCR A;  3VRR A;  4FL2 A;  1O4H A;  4EY0 A;  2VIF A;  1O4I A;  3MAZ A;  4NWG A;  1O4P A;  1HCS B;  1O42 A;  4NWF A;  2CI8 A;  1M61 A;  1LUK A;  3VRO A;  3CWG A;  1NZV A;  1O4L A;  2LQN A;  4K45 A;  3TL0 A;  5GJI A;  2IUG A;  1BMB A;  3VS4 A;  2DX0 A;  3GQI B;  3EAZ A;  1G83 A;  2PLE A;  2Y3A B;  5EEL A;  1O43 A;  4P9V A;  2PLD A;  3VS5 A;  1D4T A;  1O4N A;  4LUD A;  1CWE A;  1O41 A;  5HKZ A;  1Y1U A;  1UUR A;  3S8O A;  2CBL A;  4X6S A;  3NHN A;  3S8N A;  1B47 A;  4H1O A;  1O4J A;  5HKY A;  1AYB A;  3PJP A;  1BFJ A;  3ZNI A;  1XA6 A;  2DLZ A;  5AUL A;  3VRY A;  2ETZ A;  3OB2 B;  1H9O A;  2CIA A;  1D1Z A;  3BUW B;  1MW4 A;  2XP1 A;  1P13 A;  1SHA A;  1O4G A;  4U1P A;  2H5K A;  4GPL B;  3PQZ A;  1O45 A;  3N8M A;  1BG1 A;  4GWF A;  2HMH A;  1BKM A;  4A4B A;  5EHR A;  1FBZ A;  1BF5 A;  2IZV A;  2SRC A;  2ECD A;  1K9A A;  2H8H A;  2PNA A;  2L4K A;  4XZ1 A;  1A1E A;  1R1S A;  2EL8 A;  1O47 A;  1R1P A;  1BFI A;  2PNB A;  4JGH A;  1CJ1 A;  2ROR A;  2EYV A;  1GHU A;  3GXX A;  2DLY A;  3WA4 A;  3MXC A;  3PS5 A;  5DC4 A;  2K7A B;  5D0J A;  1MIL A;  2IUI A; 
#chains in the Genus database with same CATH topology
 2MQI A;  1SPR A;  1O44 A;  1OO4 A;  4W9L C;  3BKB A;  1AD5 A;  2MK2 A;  3S8L A;  4AJY V;  1O4E A;  1JU5 A;  1BLK A;  1CSY A;  3PFV A;  2EKX A;  1X0N A;  3ZTD C;  4E93 A;  3PLF B;  2CI9 A;  1O4R A;  2OZO A;  3PSJ A;  4K11 A;  4FBN A;  1LQB C;  2GSB A;  1A1C A;  1A08 A;  1AOU F;  1D4W A;  1OPL A;  1KC2 A;  4DGX A;  3ZUN C;  1AB2 A;  3PSK A;  1JYR A;  2RSY A;  1A09 A;  5HKW A;  5DF6 A;  1AYD A;  1GRI A;  2EYZ A;  5EG3 B;  2HUW A;  1JYQ A;  1OPK A;  1IJR A;  4FL3 A;  2QMS A;  5KAZ A;  1I3Z A;  3TKZ A;  1A1B A;  2AUG A;  1SKJ A;  4W9E C;  1SHD A;  3HIZ B;  4QSY A;  1JWO A;  2YU7 A;  1Y57 A;  2EOB A;  2EO3 A;  2BBU A;  4H34 A;  2YSX A;  2K79 B;  4DGP A;  2LNW A;  1F1W A;  1X27 A;  1ZFP E;  3ZTC C;  3EAC A;  1BM2 A;  3HHM B;  2EYY A;  2EO6 A;  1A07 A;  4JEG A;  3VS2 A;  2Y1N A;  1CSZ A;  1Z3K A;  3K2T A;  1NZL A;  1O4A A;  1PIC A;  1BHF A;  3BUO B;  2B3O A;  1R1Q A;  1O4M A;  3QWX X;  1SPS A;  3VGO A;  3C7I A;  1TCE A;  3HCK A;  4OHE A;  4EIH A;  3ZNG A;  3BUM B;  4WWQ A;  1FU5 A;  1SHB A;  3VS7 A;  1QCF A;  2PTK A;  3CBL A;  4K2R A;  3IN8 A;  1AOT F;  5EEQ A;  2LNX A;  2CRH A;  2AOB A;  4LUE A;  4OHD A;  2C9W A;  2C0T A;  2KGY A;  4GL9 E;  3N7Y A;  1QG1 E;  1O48 A;  1BKL A;  2Y1M A;  4W9H C;  4B95 C;  1LKK A;  1O4C A;  3US4 A;  1LKL A;  3T04 A;  3BUN B;  2RVF A;  1NRV A;  3K2M A;  2MC1 A;  2MRJ A;  2ABL A;  5GJH A;  4D8K A;  2C0I A;  3CXL A;  3BUX B;  2CR4 A;  2JYQ A;  4M4Z A;  4K44 A;  1O4F A;  4L1B B;  1O4K A;  3OB1 B;  1BHH A;  2C0O A;  1LUN A;  3N84 A;  4JE4 A;  3OP0 A;  3MXY A;  1AYA A;  4A4C A;  1LCK A;  1HCT B;  1WQU A;  2KK6 A;  3UYO A;  3UF4 A;  4F5A A;  1X6C A;  1RPY A;  1CWD L;  3VRN A;  2H46 E;  3IN7 A;  3IMD A;  5EHP A;  1FMK A;  1O4Q A;  1O4D A;  1M27 A;  2LCT A;  3M7F A;  5AXI A;  2L6K A;  1A1A A;  2OQ1 A;  2MRK A;  1FBV A;  4U17 A;  1F2F A;  4W9C C;  3VS6 A;  3ZRF C;  3S9K A;  1YVL A;  2GE9 A;  2KNO A;  1KA6 A;  5IBS A;  4OHL A;  2EU0 A;  4OHH A;  2HDV A;  1O4B A;  1TZE E;  3VS3 A;  1AYC A;  2CS0 A;  1OO3 A;  3QWY A;  5I6V A;  1JYU A;  2IUH A;  1FHS A;  1BHH B;  1LUI A;  1LCJ A;  1O49 A;  3VRZ A;  1O46 A;  3KFJ A;  1A81 A;  4BKS C;  5CDW A;  3OVE A;  3VRP A;  4ROJ A;  4WQO A;  5IBM A;  1QAD A;  1UUS A;  2FCI A;  2DM0 A;  2LQW A;  3ZKJ A;  4XZ0 A;  1RJA A;  3GXW A;  1RQQ C;  4W9I C;  2RMX A;  5DC9 A;  5LLI C;  1KA7 A;  3VRQ A;  3IMJ A;  2DVJ A;  3OV1 A;  3VS0 A;  4W9K C;  1YVH A;  2HCK A;  3CD3 A;  5J3X A;  4F5B A;  2FO0 A;  1BLJ A;  2AOA A;  4F59 A;  4OHI A;  4E68 A;  5BO4 A;  1O4O A;  1VCB C;  2LRA A;  1FYR A;  4P9Z A;  4TZI A;  3VS1 A;  1KSW A;  2SHP A;  1IS0 A;  4W9G C;  2L3T A;  5DC0 B;  1FU6 A;  2HDX A;  1LUM A;  2DCR A;  3VRR A;  4FL2 A;  1O4H A;  4EY0 A;  2VIF A;  1O4I A;  4B9K C;  4W9F C;  4W9J C;  3MAZ A;  4NWG A;  1O4P A;  1HCS B;  1O42 A;  4NWF A;  2CI8 A;  1M61 A;  1LUK A;  3VRO A;  3CWG A;  1NZV A;  1O4L A;  2LQN A;  1LM8 V;  4K45 A;  3TL0 A;  5GJI A;  2IUG A;  1BMB A;  3VS4 A;  2DX0 A;  3GQI B;  3EAZ A;  1G83 A;  2PLE A;  2Y3A B;  5EEL A;  1O43 A;  4P9V A;  2PLD A;  3VS5 A;  1D4T A;  1O4N A;  4LUD A;  1CWE A;  3LYV A;  1O41 A;  5HKZ A;  1Y1U A;  1UUR A;  3S8O A;  2CBL A;  4X6S A;  3NHN A;  3S8N A;  1B47 A;  4H1O A;  1O4J A;  4W9D C;  5HKY A;  1AYB A;  3PJP A;  1BFJ A;  3ZNI A;  1XA6 A;  2DLZ A;  5AUL A;  4BKT C;  3ZRC C;  4AWJ C;  3VRY A;  2ETZ A;  3OB2 B;  1H9O A;  2CIA A;  1D1Z A;  3BUW B;  1MW4 A;  2XP1 A;  1P13 A;  1SHA A;  1O4G A;  4U1P A;  2H5K A;  4GPL B;  3PQZ A;  1O45 A;  3N8M A;  1BG1 A;  4GWF A;  2HMH A;  1BKM A;  4A4B A;  5EHR A;  1FBZ A;  1BF5 A;  2IZV A;  2SRC A;  2ECD A;  1K9A A;  2H8H A;  2PNA A;  2L4K A;  4XZ1 A;  1A1E A;  1R1S A;  2EL8 A;  1O47 A;  1R1P A;  1BFI A;  2PNB A;  4JGH A;  1CJ1 A;  2ROR A;  2EYV A;  1GHU A;  3GXX A;  2DLY A;  3WA4 A;  3MXC A;  3PS5 A;  5DC4 A;  2K7A B;  5D0J A;  1MIL A;  2IUI A; 
#chains in the Genus database with same CATH homology
 2MQI A;  1SPR A;  1O44 A;  1OO4 A;  3BKB A;  1AD5 A;  2MK2 A;  3S8L A;  1O4E A;  1JU5 A;  1BLK A;  1CSY A;  3PFV A;  2EKX A;  1X0N A;  4E93 A;  3PLF B;  2CI9 A;  1O4R A;  2OZO A;  3PSJ A;  4K11 A;  4FBN A;  2GSB A;  1A1C A;  1A08 A;  1AOU F;  1D4W A;  1OPL A;  1KC2 A;  4DGX A;  1AB2 A;  3PSK A;  1JYR A;  2RSY A;  1A09 A;  5HKW A;  5DF6 A;  1AYD A;  1GRI A;  2EYZ A;  5EG3 B;  2HUW A;  1JYQ A;  1OPK A;  1IJR A;  4FL3 A;  2QMS A;  5KAZ A;  1I3Z A;  3TKZ A;  1A1B A;  2AUG A;  1SKJ A;  1SHD A;  3HIZ B;  4QSY A;  1JWO A;  2YU7 A;  1Y57 A;  2EOB A;  2EO3 A;  2BBU A;  4H34 A;  2YSX A;  2K79 B;  4DGP A;  2LNW A;  1F1W A;  1X27 A;  1ZFP E;  3EAC A;  1BM2 A;  3HHM B;  2EYY A;  2EO6 A;  1A07 A;  4JEG A;  3VS2 A;  2Y1N A;  1CSZ A;  1Z3K A;  1NZL A;  1O4A A;  1PIC A;  1BHF A;  3BUO B;  2B3O A;  1R1Q A;  1O4M A;  3QWX X;  1SPS A;  3VGO A;  3C7I A;  1TCE A;  3HCK A;  4OHE A;  4EIH A;  3ZNG A;  3BUM B;  4WWQ A;  1FU5 A;  1SHB A;  3VS7 A;  1QCF A;  2PTK A;  3CBL A;  4K2R A;  3IN8 A;  1AOT F;  5EEQ A;  2LNX A;  2CRH A;  2AOB A;  4LUE A;  4OHD A;  2C9W A;  2C0T A;  4GL9 E;  3N7Y A;  1QG1 E;  1O48 A;  1BKL A;  2Y1M A;  1LKK A;  1O4C A;  3US4 A;  1LKL A;  3T04 A;  3BUN B;  2RVF A;  1NRV A;  3K2M A;  2MC1 A;  2MRJ A;  2ABL A;  5GJH A;  4D8K A;  2C0I A;  3CXL A;  3BUX B;  2CR4 A;  2JYQ A;  4M4Z A;  4K44 A;  1O4F A;  4L1B B;  1O4K A;  3OB1 B;  1BHH A;  2C0O A;  1LUN A;  3N84 A;  4JE4 A;  3OP0 A;  3MXY A;  1AYA A;  4A4C A;  1LCK A;  1HCT B;  1WQU A;  2KK6 A;  3UYO A;  3UF4 A;  4F5A A;  1X6C A;  1RPY A;  1CWD L;  3VRN A;  2H46 E;  3IN7 A;  3IMD A;  5EHP A;  1FMK A;  1O4Q A;  1O4D A;  1M27 A;  2LCT A;  3M7F A;  5AXI A;  2L6K A;  1A1A A;  2OQ1 A;  2MRK A;  1FBV A;  4U17 A;  1F2F A;  3VS6 A;  3S9K A;  1YVL A;  2GE9 A;  2KNO A;  1KA6 A;  5IBS A;  4OHL A;  2EU0 A;  4OHH A;  2HDV A;  1O4B A;  1TZE E;  3VS3 A;  1AYC A;  2CS0 A;  1OO3 A;  3QWY A;  5I6V A;  1JYU A;  2IUH A;  1FHS A;  1BHH B;  1LUI A;  1LCJ A;  1O49 A;  3VRZ A;  1O46 A;  3KFJ A;  1A81 A;  5CDW A;  3OVE A;  3VRP A;  4ROJ A;  5IBM A;  1QAD A;  1UUS A;  2FCI A;  2DM0 A;  2LQW A;  3ZKJ A;  4XZ0 A;  1RJA A;  3GXW A;  1RQQ C;  2RMX A;  5DC9 A;  1KA7 A;  3VRQ A;  3IMJ A;  2DVJ A;  3OV1 A;  3VS0 A;  1YVH A;  2HCK A;  3CD3 A;  5J3X A;  4F5B A;  2FO0 A;  1BLJ A;  2AOA A;  4F59 A;  4OHI A;  4E68 A;  5BO4 A;  1O4O A;  1FYR A;  4P9Z A;  4TZI A;  3VS1 A;  1KSW A;  2SHP A;  1IS0 A;  2L3T A;  5DC0 B;  1FU6 A;  2HDX A;  1LUM A;  2DCR A;  3VRR A;  4FL2 A;  1O4H A;  4EY0 A;  2VIF A;  1O4I A;  3MAZ A;  4NWG A;  1O4P A;  1HCS B;  1O42 A;  4NWF A;  2CI8 A;  1M61 A;  1LUK A;  3VRO A;  3CWG A;  1NZV A;  1O4L A;  2LQN A;  4K45 A;  3TL0 A;  5GJI A;  2IUG A;  1BMB A;  3VS4 A;  2DX0 A;  3GQI B;  3EAZ A;  1G83 A;  2PLE A;  2Y3A B;  5EEL A;  1O43 A;  4P9V A;  2PLD A;  3VS5 A;  1D4T A;  1O4N A;  4LUD A;  1CWE A;  1O41 A;  5HKZ A;  1Y1U A;  1UUR A;  3S8O A;  2CBL A;  4X6S A;  3NHN A;  3S8N A;  1B47 A;  4H1O A;  1O4J A;  5HKY A;  1AYB A;  3PJP A;  1BFJ A;  3ZNI A;  1XA6 A;  2DLZ A;  5AUL A;  3VRY A;  2ETZ A;  3OB2 B;  1H9O A;  2CIA A;  1D1Z A;  3BUW B;  1MW4 A;  2XP1 A;  1P13 A;  1SHA A;  1O4G A;  4U1P A;  2H5K A;  4GPL B;  3PQZ A;  1O45 A;  3N8M A;  1BG1 A;  4GWF A;  2HMH A;  1BKM A;  4A4B A;  5EHR A;  1FBZ A;  1BF5 A;  2IZV A;  2SRC A;  2ECD A;  1K9A A;  2H8H A;  2PNA A;  2L4K A;  4XZ1 A;  1A1E A;  1R1S A;  2EL8 A;  1O47 A;  1R1P A;  1BFI A;  2PNB A;  4JGH A;  1CJ1 A;  2ROR A;  2EYV A;  1GHU A;  3GXX A;  2DLY A;  3WA4 A;  3MXC A;  3PS5 A;  5DC4 A;  2K7A B;  5D0J A;  1MIL A;  2IUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...