1O4FA

Crystal structure of sh2 in complex with ru79073.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
104
Chain Sequence
b'SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
publication title Requirements for specific binding of low affinity inhibitor fragments to the SH2 domain of (pp60)Src are identical to those for high affinity binding of full length inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 25
structure length 104
sequence length 105
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1o4fA00
5CDWA 1LKLA 4FBNA 2EKXA 1O43A 3CXLA 4JGHA 1FBVA 2CI8A 1B47A 2DX0A 3OP0A 1JWOA 3BKBA 1BM2A 2DM0A 2SRCA 4M4ZA 1O4IA 1A1BA 1AYAA 2H46E 2XP1A 1O47A 1A07A 1NZLA 1RJAA 3T04A 2Y1MA 2H5KA 2IUIA 2DLZA 3EAZA 1R1QA 4H1OA 4OHEA 1A1CA 1ZFPE 1LUKA 5GJIA 4NWFA 1UUSA 2FCIA 3HIZB 1O4MA 1O4DA 3GQIB 2CS0A 4GL9E 1OPLA 2BBUA 1OO4A 4E68A 2EOBA 3MXYA 4F5AA 1Z3KA 2HDVA 2HDXA 4EY0A 1KSWA 2EYYA 2VIFA 3QWXX 4FL2A 2RORA 5GJHA 3BUMB 4LUDA 1A81A 1RQQC 2L4KA 5D0JA 1XA6A 4XZ0A 1IJRA 1O4EA 2CR4A 4X6SA 1O48A 3US4A 1QG1E 1CWEA 1LUIA 2EO6A 1KA6A 5EG3B 1O4FA 3VRQA 2MQIA 1OPKA 5IBMA 4QSYA 1JYRA 1BFJA 3WA4A 1AB2A 2L6KA 1SPRA 4GPLB 1O4LA 4K11A 2CIAA 3OV1A 1F1WA 1JU5A 2RSYA 3PQZA 5EHRA 1LUNA 3UF4A 3VS7A 1WQUA 1O4HA 1KA7A 2OZOA 3PS5A 4K44A 2ABLA 2EU0A 3GXWA 3VGOA 1SKJA 1A09A 1BG1A 1YVLA 1R1SA 3ZNIA 3S8LA 2IZVA 1O4GA 3VS6A 1D1ZA 1F2FA 1X0NA 5DC9A 3VROA 2LNXA 1BKMA 3HHMB 1YVHA 5AXIA 2DVJA 1UURA 1CSZA 3VS1A 3EACA 2FO0A 4WWQA 1BKLA 2PLDA 2HCKA 2SHPA 1A1EA 1LCKA 4K2RA 1D4TA 2EYVA 1D4WA 2GE9A 2CRHA 1SHAA 4GWFA 1CJ1A 4TZIA 3VS2A 4K45A 1O42A 2AOAA 2HMHA 3BUOB 2MC1A 3CWGA 1TCEA 1I3ZA 4D8KA 5DC0B 1BLKA 4DGXA 3PFVA 5J3XA 1HCTB 4XZ1A 4NWGA 1BF5A 4E93A 3BUNB 1BHHA 2ECDA 1BFIA 3IMDA 4ROJA 1M61A 2JYQA 3VRPA 1O4KA 3VS0A 2C9WA 3CD3A 2MRKA 4F5BA 3M7FA 3MXCA 3S9KA 3S8OA 3VS4A 4U1PA 3PSKA 1O4QA 2LCTA 4F59A 1A08A 3KFJA 1GHUA 1O45A 2K7AB 1BMBA 1O4RA 2GSBA 2IUGA 2K79B 1FU5A 2MRJA 2ETZA 2CBLA 3UYOA 4L1BB 2C0IA 1O4NA 3IN8A 1RPYA 1A1AA 2PLEA 1O49A 1TZEE 3VRRA 1Y1UA 4FL3A 3VRZA 2IUHA 1O4BA 4OHIA 1O44A 2B3OA 1FMKA 1FU6A 1O41A 1CWDL 2L3TA 3IN7A 2LNWA 3QWYA 5HKYA 1AD5A 4OHDA 1Y57A 2KK6A 2HUWA 3TL0A 1O4PA 3VRYA 3PSJA 2CI9A 2Y1NA 1AOUF 3NHNA 2Y3AB 1BHHB 3K2MA 2OQ1A 3BUXB 3VS3A 1JYUA 1P13A 2C0OA 4EIHA 2DLYA 4LUEA 3BUWB 2KNOA 4A4BA 1M27A 3PJPA 1PICA 2LQNA 1H9OA 2H8HA 2QMSA 5HKZA 5BO4A 1BHFA 1LKKA 2PNBA 1AOTF 1O46A 3VS5A 1AYBA 1NZVA 2PTKA 1O4AA 1MW4A 1GRIA 2C0TA 4OHLA 1QADA 3PLFB 2EYZA 3S8NA 1OO3A 5AULA 1K9AA 5EELA 2PNAA 1BLJA 2DCRA 5EHPA 3N8MA 2MK2A 1MILA 4JE4A 4P9ZA 1JYQA 2YSXA 1SPSA 2LQWA 4OHHA 1SHBA 1FBZA 1O4JA 5HKWA 5I6VA 4U17A 5DF6A 1LUMA 2AUGA 3C7IA 1SHDA 4A4CA 3N84A 1QCFA 5KAZA 3IMJA 2RVFA 5DC4A 1G83A 4JEGA 3OVEA 3TKZA 1CSYA 1HCSB 1IS0A 2EO3A 1O4OA 3GXXA 3VRNA 1NRVA 4P9VA 1AYCA 2RMXA 1FYRA 2EL8A 4DGPA 1KC2A 5EEQA 2YU7A 5IBSA 1X27A 3CBLA 3HCKA 4H34A 2AOBA 3OB1B 1R1PA 1AYDA 1O4CA 3N7YA 1FHSA 1LCJA 3MAZA 1X6CA 3OB2B
chains in the Genus database with same CATH superfamily
5CDWA 1LKLA 4FBNA 2EKXA 1O43A 3CXLA 4JGHA 1FBVA 2CI8A 1B47A 2DX0A 3OP0A 1JWOA 3BKBA 1BM2A 2DM0A 2SRCA 4M4ZA 1O4IA 1A1BA 1AYAA 2H46E 2XP1A 1O47A 1A07A 1NZLA 1RJAA 3T04A 2Y1MA 2H5KA 2IUIA 2DLZA 3EAZA 1R1QA 4H1OA 4OHEA 1A1CA 1ZFPE 1LUKA 5GJIA 4NWFA 1UUSA 2FCIA 3HIZB 1O4MA 1O4DA 3GQIB 2CS0A 4GL9E 1OPLA 2BBUA 1OO4A 4E68A 2EOBA 3MXYA 4F5AA 1Z3KA 2HDVA 2HDXA 4EY0A 1KSWA 2EYYA 2VIFA 3QWXX 4FL2A 2RORA 5GJHA 3BUMB 4LUDA 1A81A 1RQQC 2L4KA 5D0JA 1XA6A 4XZ0A 1IJRA 1O4EA 2CR4A 4X6SA 1O48A 3US4A 1QG1E 1CWEA 1LUIA 2EO6A 1KA6A 5EG3B 1O4FA 3VRQA 2MQIA 1OPKA 5IBMA 4QSYA 1JYRA 1BFJA 3WA4A 1AB2A 2L6KA 1SPRA 4GPLB 1O4LA 4K11A 2CIAA 3OV1A 1F1WA 1JU5A 2RSYA 3PQZA 5EHRA 1LUNA 3UF4A 3VS7A 1WQUA 1O4HA 1KA7A 2OZOA 3PS5A 4K44A 2ABLA 2EU0A 3GXWA 3VGOA 1SKJA 1A09A 1BG1A 1YVLA 1R1SA 3ZNIA 3S8LA 2IZVA 1O4GA 3VS6A 1D1ZA 1F2FA 1X0NA 5DC9A 3VROA 2LNXA 1BKMA 3HHMB 1YVHA 5AXIA 2DVJA 1UURA 1CSZA 3VS1A 3EACA 2FO0A 4WWQA 1BKLA 2PLDA 2HCKA 2SHPA 1A1EA 1LCKA 4K2RA 1D4TA 2EYVA 1D4WA 2GE9A 2CRHA 1SHAA 4GWFA 1CJ1A 4TZIA 3VS2A 4K45A 1O42A 2AOAA 2HMHA 3BUOB 2MC1A 3CWGA 1TCEA 1I3ZA 4D8KA 5DC0B 1BLKA 4DGXA 3PFVA 5J3XA 1HCTB 4XZ1A 4NWGA 1BF5A 4E93A 3BUNB 1BHHA 2ECDA 1BFIA 3IMDA 4ROJA 1M61A 2JYQA 3VRPA 1O4KA 3VS0A 2C9WA 3CD3A 2MRKA 4F5BA 3M7FA 3MXCA 3S9KA 3S8OA 3VS4A 4U1PA 3PSKA 1O4QA 2LCTA 4F59A 1A08A 3KFJA 1GHUA 1O45A 2K7AB 1BMBA 1O4RA 2GSBA 2IUGA 2K79B 1FU5A 2MRJA 2ETZA 2CBLA 3UYOA 4L1BB 2C0IA 1O4NA 3IN8A 1RPYA 1A1AA 2LRAA 2PLEA 1O49A 1TZEE 3VRRA 1Y1UA 4FL3A 3VRZA 2IUHA 1O4BA 4OHIA 1O44A 2B3OA 1FMKA 1FU6A 1O41A 1CWDL 2L3TA 3IN7A 2LNWA 3QWYA 5HKYA 1AD5A 3K2TA 4OHDA 1Y57A 2KK6A 2HUWA 3TL0A 1O4PA 3VRYA 3PSJA 2CI9A 2Y1NA 1AOUF 3NHNA 2Y3AB 1BHHB 3K2MA 2OQ1A 3BUXB 3VS3A 1JYUA 1P13A 2C0OA 4EIHA 2DLYA 4LUEA 2KGYA 3BUWB 2KNOA 4A4BA 1M27A 3PJPA 1PICA 2LQNA 1H9OA 2H8HA 2QMSA 5HKZA 5BO4A 1BHFA 1LKKA 2PNBA 1AOTF 1O46A 3VS5A 1AYBA 1NZVA 2PTKA 1O4AA 1MW4A 1GRIA 2C0TA 4OHLA 1QADA 3PLFB 2EYZA 3S8NA 1OO3A 5AULA 1K9AA 5EELA 2PNAA 1BLJA 2DCRA 5EHPA 3N8MA 2MK2A 1MILA 4JE4A 4P9ZA 1JYQA 2YSXA 1SPSA 2LQWA 4OHHA 1SHBA 1FBZA 1O4JA 5HKWA 5I6VA 4U17A 5DF6A 1LUMA 2AUGA 3C7IA 1SHDA 4A4CA 3N84A 1QCFA 5KAZA 3IMJA 2RVFA 5DC4A 1G83A 4JEGA 3LYVA 3OVEA 3TKZA 1CSYA 1HCSB 1IS0A 2EO3A 1O4OA 3GXXA 3VRNA 1NRVA 4P9VA 1AYCA 2RMXA 1FYRA 2EL8A 4DGPA 1KC2A 5EEQA 2YU7A 5IBSA 1X27A 3CBLA 3HCKA 4H34A 2AOBA 3OB1B 1R1PA 1AYDA 1O4CA 3N7YA 1FHSA 1LCJA 3MAZA 1X6CA 3OB2B
chains in the Genus database with same CATH topology
5CDWA 1LKLA 4FBNA 2EKXA 1O43A 3CXLA 4JGHA 1FBVA 2CI8A 1B47A 2DX0A 3OP0A 1JWOA 3BKBA 1BM2A 2DM0A 2SRCA 4M4ZA 1O4IA 1A1BA 1AYAA 2H46E 2XP1A 1O47A 1A07A 1NZLA 1RJAA 3T04A 2Y1MA 2H5KA 2IUIA 2DLZA 3EAZA 1R1QA 4H1OA 4OHEA 1A1CA 1ZFPE 1LUKA 5GJIA 4NWFA 1UUSA 2FCIA 3HIZB 1O4MA 1O4DA 3GQIB 2CS0A 4GL9E 1OPLA 2BBUA 1OO4A 4E68A 2EOBA 3MXYA 4F5AA 1Z3KA 2HDVA 2HDXA 4EY0A 1KSWA 2EYYA 2VIFA 3QWXX 4FL2A 2RORA 5GJHA 3BUMB 4LUDA 1A81A 1RQQC 2L4KA 5D0JA 1XA6A 4XZ0A 1IJRA 1O4EA 2CR4A 4X6SA 1O48A 3US4A 1QG1E 1CWEA 1LUIA 2EO6A 1KA6A 5EG3B 1O4FA 3VRQA 2MQIA 1OPKA 5IBMA 4QSYA 1JYRA 1BFJA 3WA4A 1AB2A 2L6KA 1SPRA 4GPLB 1O4LA 4K11A 2CIAA 3OV1A 1F1WA 1JU5A 2RSYA 3PQZA 5EHRA 1LUNA 3UF4A 3VS7A 1WQUA 1O4HA 1KA7A 2OZOA 3PS5A 4K44A 2ABLA 2EU0A 3GXWA 3VGOA 1SKJA 1A09A 1BG1A 1YVLA 1R1SA 3ZNIA 3S8LA 2IZVA 1O4GA 3VS6A 1D1ZA 1F2FA 1X0NA 5DC9A 3VROA 2LNXA 1BKMA 3HHMB 1YVHA 5AXIA 2DVJA 1UURA 1CSZA 3VS1A 3EACA 2FO0A 4WWQA 1BKLA 2PLDA 2HCKA 2SHPA 1A1EA 1LCKA 4K2RA 1D4TA 2EYVA 1D4WA 2GE9A 2CRHA 1SHAA 4GWFA 1CJ1A 4TZIA 3VS2A 4K45A 1O42A 2AOAA 2HMHA 3BUOB 2MC1A 3CWGA 1TCEA 1I3ZA 4D8KA 5DC0B 1BLKA 4DGXA 3PFVA 5J3XA 1HCTB 4XZ1A 4NWGA 1BF5A 4E93A 3BUNB 1BHHA 2ECDA 1BFIA 3IMDA 4ROJA 1M61A 2JYQA 3VRPA 1O4KA 3VS0A 2C9WA 3CD3A 2MRKA 4F5BA 3M7FA 3MXCA 3S9KA 3S8OA 3VS4A 4U1PA 3PSKA 1O4QA 2LCTA 4F59A 1A08A 3KFJA 1GHUA 1O45A 2K7AB 1BMBA 1O4RA 2GSBA 2IUGA 2K79B 1FU5A 2MRJA 2ETZA 2CBLA 3UYOA 4L1BB 2C0IA 1O4NA 3IN8A 1RPYA 1A1AA 2PLEA 1O49A 1TZEE 3VRRA 1Y1UA 4FL3A 3VRZA 2IUHA 1O4BA 4OHIA 1O44A 2B3OA 1FMKA 1FU6A 1O41A 1CWDL 2L3TA 3IN7A 2LNWA 3QWYA 5HKYA 1AD5A 4OHDA 1Y57A 2KK6A 2HUWA 3TL0A 1O4PA 3VRYA 3PSJA 2CI9A 2Y1NA 1AOUF 3NHNA 2Y3AB 1BHHB 3K2MA 2OQ1A 3BUXB 3VS3A 1JYUA 1P13A 2C0OA 4EIHA 2DLYA 4LUEA 3BUWB 2KNOA 4A4BA 1M27A 3PJPA 1PICA 2LQNA 1H9OA 2H8HA 2QMSA 5HKZA 5BO4A 1BHFA 1LKKA 2PNBA 1AOTF 1O46A 3VS5A 1AYBA 1NZVA 2PTKA 1O4AA 1MW4A 1GRIA 2C0TA 4OHLA 1QADA 3PLFB 2EYZA 3S8NA 1OO3A 5AULA 1K9AA 5EELA 2PNAA 1BLJA 2DCRA 5EHPA 3N8MA 2MK2A 1MILA 4JE4A 4P9ZA 1JYQA 2YSXA 1SPSA 2LQWA 4OHHA 1SHBA 1FBZA 1O4JA 5HKWA 5I6VA 4U17A 5DF6A 1LUMA 2AUGA 3C7IA 1SHDA 4A4CA 3N84A 1QCFA 5KAZA 3IMJA 2RVFA 5DC4A 1G83A 4JEGA 3OVEA 3TKZA 1CSYA 1HCSB 1IS0A 2EO3A 1O4OA 3GXXA 3VRNA 1NRVA 4P9VA 1AYCA 2RMXA 1FYRA 2EL8A 4DGPA 1KC2A 5EEQA 2YU7A 5IBSA 1X27A 3CBLA 3HCKA 4H34A 2AOBA 3OB1B 1R1PA 1AYDA 1O4CA 3N7YA 1FHSA 1LCJA 3MAZA 1X6CA 3OB2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CDW A;  1LKL A;  4FBN A;  2EKX A;  1O43 A;  3CXL A;  4JGH A;  1FBV A;  2CI8 A;  1B47 A;  2DX0 A;  3OP0 A;  1JWO A;  3BKB A;  1BM2 A;  2DM0 A;  2SRC A;  4M4Z A;  1O4I A;  1A1B A;  1AYA A;  2H46 E;  2XP1 A;  1O47 A;  1A07 A;  1NZL A;  1RJA A;  3T04 A;  2Y1M A;  2H5K A;  2IUI A;  2DLZ A;  3EAZ A;  1R1Q A;  4H1O A;  4OHE A;  1A1C A;  1ZFP E;  1LUK A;  5GJI A;  4NWF A;  1UUS A;  2FCI A;  3HIZ B;  1O4M A;  1O4D A;  3GQI B;  2CS0 A;  4GL9 E;  1OPL A;  2BBU A;  1OO4 A;  4E68 A;  2EOB A;  3MXY A;  4F5A A;  1Z3K A;  2HDV A;  2HDX A;  4EY0 A;  1KSW A;  2EYY A;  2VIF A;  3QWX X;  4FL2 A;  2ROR A;  5GJH A;  3BUM B;  4LUD A;  1A81 A;  1RQQ C;  2L4K A;  5D0J A;  1XA6 A;  4XZ0 A;  1IJR A;  1O4E A;  2CR4 A;  4X6S A;  1O48 A;  3US4 A;  1QG1 E;  1CWE A;  1LUI A;  2EO6 A;  1KA6 A;  5EG3 B;  1O4F A;  3VRQ A;  2MQI A;  1OPK A;  5IBM A;  4QSY A;  1JYR A;  1BFJ A;  3WA4 A;  1AB2 A;  2L6K A;  1SPR A;  4GPL B;  1O4L A;  4K11 A;  2CIA A;  3OV1 A;  1F1W A;  1JU5 A;  2RSY A;  3PQZ A;  5EHR A;  1LUN A;  3UF4 A;  3VS7 A;  1WQU A;  1O4H A;  1KA7 A;  2OZO A;  3PS5 A;  4K44 A;  2ABL A;  2EU0 A;  3GXW A;  3VGO A;  1SKJ A;  1A09 A;  1BG1 A;  1YVL A;  1R1S A;  3ZNI A;  3S8L A;  2IZV A;  1O4G A;  3VS6 A;  1D1Z A;  1F2F A;  1X0N A;  5DC9 A;  3VRO A;  2LNX A;  1BKM A;  3HHM B;  1YVH A;  5AXI A;  2DVJ A;  1UUR A;  1CSZ A;  3VS1 A;  3EAC A;  2FO0 A;  4WWQ A;  1BKL A;  2PLD A;  2HCK A;  2SHP A;  1A1E A;  1LCK A;  4K2R A;  1D4T A;  2EYV A;  1D4W A;  2GE9 A;  2CRH A;  1SHA A;  4GWF A;  1CJ1 A;  4TZI A;  3VS2 A;  4K45 A;  1O42 A;  2AOA A;  2HMH A;  3BUO B;  2MC1 A;  3CWG A;  1TCE A;  1I3Z A;  4D8K A;  5DC0 B;  1BLK A;  4DGX A;  3PFV A;  5J3X A;  1HCT B;  4XZ1 A;  4NWG A;  1BF5 A;  4E93 A;  3BUN B;  1BHH A;  2ECD A;  1BFI A;  3IMD A;  4ROJ A;  1M61 A;  2JYQ A;  3VRP A;  1O4K A;  3VS0 A;  2C9W A;  3CD3 A;  2MRK A;  4F5B A;  3M7F A;  3MXC A;  3S9K A;  3S8O A;  3VS4 A;  4U1P A;  3PSK A;  1O4Q A;  2LCT A;  4F59 A;  1A08 A;  3KFJ A;  1GHU A;  1O45 A;  2K7A B;  1BMB A;  1O4R A;  2GSB A;  2IUG A;  2K79 B;  1FU5 A;  2MRJ A;  2ETZ A;  2CBL A;  3UYO A;  4L1B B;  2C0I A;  1O4N A;  3IN8 A;  1RPY A;  1A1A A;  2PLE A;  1O49 A;  1TZE E;  3VRR A;  1Y1U A;  4FL3 A;  3VRZ A;  2IUH A;  1O4B A;  4OHI A;  1O44 A;  2B3O A;  1FMK A;  1FU6 A;  1O41 A;  1CWD L;  2L3T A;  3IN7 A;  2LNW A;  3QWY A;  5HKY A;  1AD5 A;  4OHD A;  1Y57 A;  2KK6 A;  2HUW A;  3TL0 A;  1O4P A;  3VRY A;  3PSJ A;  2CI9 A;  2Y1N A;  1AOU F;  3NHN A;  2Y3A B;  1BHH B;  3K2M A;  2OQ1 A;  3BUX B;  3VS3 A;  1JYU A;  1P13 A;  2C0O A;  4EIH A;  2DLY A;  4LUE A;  3BUW B;  2KNO A;  4A4B A;  1M27 A;  3PJP A;  1PIC A;  2LQN A;  1H9O A;  2H8H A;  2QMS A;  5HKZ A;  5BO4 A;  1BHF A;  1LKK A;  2PNB A;  1AOT F;  1O46 A;  3VS5 A;  1AYB A;  1NZV A;  2PTK A;  1O4A A;  1MW4 A;  1GRI A;  2C0T A;  4OHL A;  1QAD A;  3PLF B;  2EYZ A;  3S8N A;  1OO3 A;  5AUL A;  1K9A A;  5EEL A;  2PNA A;  1BLJ A;  2DCR A;  5EHP A;  3N8M A;  2MK2 A;  1MIL A;  4JE4 A;  4P9Z A;  1JYQ A;  2YSX A;  1SPS A;  2LQW A;  4OHH A;  1SHB A;  1FBZ A;  1O4J A;  5HKW A;  5I6V A;  4U17 A;  5DF6 A;  1LUM A;  2AUG A;  3C7I A;  1SHD A;  4A4C A;  3N84 A;  1QCF A;  5KAZ A;  3IMJ A;  2RVF A;  5DC4 A;  1G83 A;  4JEG A;  3OVE A;  3TKZ A;  1CSY A;  1HCS B;  1IS0 A;  2EO3 A;  1O4O A;  3GXX A;  3VRN A;  1NRV A;  4P9V A;  1AYC A;  2RMX A;  1FYR A;  2EL8 A;  4DGP A;  1KC2 A;  5EEQ A;  2YU7 A;  5IBS A;  1X27 A;  3CBL A;  3HCK A;  4H34 A;  2AOB A;  3OB1 B;  1R1P A;  1AYD A;  1O4C A;  3N7Y A;  1FHS A;  1LCJ A;  3MAZ A;  1X6C A;  3OB2 B; 
#chains in the Genus database with same CATH topology
 5CDW A;  1LKL A;  4FBN A;  2EKX A;  1O43 A;  3CXL A;  4JGH A;  1FBV A;  2CI8 A;  1B47 A;  2DX0 A;  3OP0 A;  1JWO A;  3BKB A;  1BM2 A;  2DM0 A;  2SRC A;  4M4Z A;  1O4I A;  1A1B A;  1AYA A;  2H46 E;  2XP1 A;  1O47 A;  1A07 A;  1NZL A;  1RJA A;  3T04 A;  2Y1M A;  2H5K A;  2IUI A;  2DLZ A;  3EAZ A;  1R1Q A;  4H1O A;  4OHE A;  1A1C A;  1ZFP E;  1LUK A;  5GJI A;  4NWF A;  1UUS A;  2FCI A;  3HIZ B;  1O4M A;  1O4D A;  3GQI B;  2CS0 A;  4GL9 E;  1OPL A;  2BBU A;  1OO4 A;  4E68 A;  2EOB A;  3MXY A;  4F5A A;  1Z3K A;  2HDV A;  2HDX A;  4EY0 A;  1KSW A;  2EYY A;  2VIF A;  3QWX X;  4FL2 A;  2ROR A;  5GJH A;  3BUM B;  4LUD A;  1A81 A;  1RQQ C;  2L4K A;  5D0J A;  1XA6 A;  4XZ0 A;  1IJR A;  1O4E A;  2CR4 A;  4X6S A;  1O48 A;  3US4 A;  1QG1 E;  1CWE A;  1LUI A;  2EO6 A;  1KA6 A;  5EG3 B;  1O4F A;  3VRQ A;  2MQI A;  1OPK A;  5IBM A;  4QSY A;  1JYR A;  1BFJ A;  3WA4 A;  1AB2 A;  2L6K A;  1SPR A;  4GPL B;  1O4L A;  4K11 A;  2CIA A;  3OV1 A;  1F1W A;  1JU5 A;  2RSY A;  3PQZ A;  5EHR A;  1LUN A;  3UF4 A;  3VS7 A;  1WQU A;  1O4H A;  1KA7 A;  2OZO A;  3PS5 A;  4K44 A;  2ABL A;  2EU0 A;  3GXW A;  3VGO A;  1SKJ A;  1A09 A;  1BG1 A;  1YVL A;  1R1S A;  3ZNI A;  3S8L A;  2IZV A;  1O4G A;  3VS6 A;  1D1Z A;  1F2F A;  1X0N A;  5DC9 A;  3VRO A;  2LNX A;  1BKM A;  3HHM B;  1YVH A;  5AXI A;  2DVJ A;  1UUR A;  1CSZ A;  3VS1 A;  3EAC A;  2FO0 A;  4WWQ A;  1BKL A;  2PLD A;  2HCK A;  2SHP A;  1A1E A;  1LCK A;  4K2R A;  1D4T A;  2EYV A;  1D4W A;  2GE9 A;  2CRH A;  1SHA A;  4GWF A;  1CJ1 A;  4TZI A;  3VS2 A;  4K45 A;  1O42 A;  2AOA A;  2HMH A;  3BUO B;  2MC1 A;  3CWG A;  1TCE A;  1I3Z A;  4D8K A;  5DC0 B;  1BLK A;  4DGX A;  3PFV A;  5J3X A;  1HCT B;  4XZ1 A;  4NWG A;  1BF5 A;  4E93 A;  3BUN B;  1BHH A;  2ECD A;  1BFI A;  3IMD A;  4ROJ A;  1M61 A;  2JYQ A;  3VRP A;  1O4K A;  3VS0 A;  2C9W A;  3CD3 A;  2MRK A;  4F5B A;  3M7F A;  3MXC A;  3S9K A;  3S8O A;  3VS4 A;  4U1P A;  3PSK A;  1O4Q A;  2LCT A;  4F59 A;  1A08 A;  3KFJ A;  1GHU A;  1O45 A;  2K7A B;  1BMB A;  1O4R A;  2GSB A;  2IUG A;  2K79 B;  1FU5 A;  2MRJ A;  2ETZ A;  2CBL A;  3UYO A;  4L1B B;  2C0I A;  1O4N A;  3IN8 A;  1RPY A;  1A1A A;  2LRA A;  2PLE A;  1O49 A;  1TZE E;  3VRR A;  1Y1U A;  4FL3 A;  3VRZ A;  2IUH A;  1O4B A;  4OHI A;  1O44 A;  2B3O A;  1FMK A;  1FU6 A;  1O41 A;  1CWD L;  2L3T A;  3IN7 A;  2LNW A;  3QWY A;  5HKY A;  1AD5 A;  3K2T A;  4OHD A;  1Y57 A;  2KK6 A;  2HUW A;  3TL0 A;  1O4P A;  3VRY A;  3PSJ A;  2CI9 A;  2Y1N A;  1AOU F;  3NHN A;  2Y3A B;  1BHH B;  3K2M A;  2OQ1 A;  3BUX B;  3VS3 A;  1JYU A;  1P13 A;  2C0O A;  4EIH A;  2DLY A;  4LUE A;  2KGY A;  3BUW B;  2KNO A;  4A4B A;  1M27 A;  3PJP A;  1PIC A;  2LQN A;  1H9O A;  2H8H A;  2QMS A;  5HKZ A;  5BO4 A;  1BHF A;  1LKK A;  2PNB A;  1AOT F;  1O46 A;  3VS5 A;  1AYB A;  1NZV A;  2PTK A;  1O4A A;  1MW4 A;  1GRI A;  2C0T A;  4OHL A;  1QAD A;  3PLF B;  2EYZ A;  3S8N A;  1OO3 A;  5AUL A;  1K9A A;  5EEL A;  2PNA A;  1BLJ A;  2DCR A;  5EHP A;  3N8M A;  2MK2 A;  1MIL A;  4JE4 A;  4P9Z A;  1JYQ A;  2YSX A;  1SPS A;  2LQW A;  4OHH A;  1SHB A;  1FBZ A;  1O4J A;  5HKW A;  5I6V A;  4U17 A;  5DF6 A;  1LUM A;  2AUG A;  3C7I A;  1SHD A;  4A4C A;  3N84 A;  1QCF A;  5KAZ A;  3IMJ A;  2RVF A;  5DC4 A;  1G83 A;  4JEG A;  3LYV A;  3OVE A;  3TKZ A;  1CSY A;  1HCS B;  1IS0 A;  2EO3 A;  1O4O A;  3GXX A;  3VRN A;  1NRV A;  4P9V A;  1AYC A;  2RMX A;  1FYR A;  2EL8 A;  4DGP A;  1KC2 A;  5EEQ A;  2YU7 A;  5IBS A;  1X27 A;  3CBL A;  3HCK A;  4H34 A;  2AOB A;  3OB1 B;  1R1P A;  1AYD A;  1O4C A;  3N7Y A;  1FHS A;  1LCJ A;  3MAZ A;  1X6C A;  3OB2 B; 
#chains in the Genus database with same CATH homology
 5CDW A;  1LKL A;  4FBN A;  2EKX A;  1O43 A;  3CXL A;  4JGH A;  1FBV A;  2CI8 A;  1B47 A;  2DX0 A;  3OP0 A;  1JWO A;  3BKB A;  1BM2 A;  2DM0 A;  2SRC A;  4M4Z A;  1O4I A;  1A1B A;  1AYA A;  2H46 E;  2XP1 A;  1O47 A;  1A07 A;  1NZL A;  1RJA A;  3T04 A;  2Y1M A;  2H5K A;  2IUI A;  2DLZ A;  3EAZ A;  1R1Q A;  4H1O A;  4OHE A;  1A1C A;  1ZFP E;  1LUK A;  5GJI A;  4NWF A;  1UUS A;  2FCI A;  3HIZ B;  1O4M A;  1O4D A;  3GQI B;  2CS0 A;  4GL9 E;  1OPL A;  2BBU A;  1OO4 A;  4E68 A;  2EOB A;  3MXY A;  4F5A A;  1Z3K A;  2HDV A;  2HDX A;  4EY0 A;  1KSW A;  2EYY A;  2VIF A;  3QWX X;  4FL2 A;  2ROR A;  5GJH A;  3BUM B;  4LUD A;  1A81 A;  1RQQ C;  2L4K A;  5D0J A;  1XA6 A;  4XZ0 A;  1IJR A;  1O4E A;  2CR4 A;  4X6S A;  1O48 A;  3US4 A;  1QG1 E;  1CWE A;  1LUI A;  2EO6 A;  1KA6 A;  5EG3 B;  1O4F A;  3VRQ A;  2MQI A;  1OPK A;  5IBM A;  4QSY A;  1JYR A;  1BFJ A;  3WA4 A;  1AB2 A;  2L6K A;  1SPR A;  4GPL B;  1O4L A;  4K11 A;  2CIA A;  3OV1 A;  1F1W A;  1JU5 A;  2RSY A;  3PQZ A;  5EHR A;  1LUN A;  3UF4 A;  3VS7 A;  1WQU A;  1O4H A;  1KA7 A;  2OZO A;  3PS5 A;  4K44 A;  2ABL A;  2EU0 A;  3GXW A;  3VGO A;  1SKJ A;  1A09 A;  1BG1 A;  1YVL A;  1R1S A;  3ZNI A;  3S8L A;  2IZV A;  1O4G A;  3VS6 A;  1D1Z A;  1F2F A;  1X0N A;  5DC9 A;  3VRO A;  2LNX A;  1BKM A;  3HHM B;  1YVH A;  5AXI A;  2DVJ A;  1UUR A;  1CSZ A;  3VS1 A;  3EAC A;  2FO0 A;  4WWQ A;  1BKL A;  2PLD A;  2HCK A;  2SHP A;  1A1E A;  1LCK A;  4K2R A;  1D4T A;  2EYV A;  1D4W A;  2GE9 A;  2CRH A;  1SHA A;  4GWF A;  1CJ1 A;  4TZI A;  3VS2 A;  4K45 A;  1O42 A;  2AOA A;  2HMH A;  3BUO B;  2MC1 A;  3CWG A;  1TCE A;  1I3Z A;  4D8K A;  5DC0 B;  1BLK A;  4DGX A;  3PFV A;  5J3X A;  1HCT B;  4XZ1 A;  4NWG A;  1BF5 A;  4E93 A;  3BUN B;  1BHH A;  2ECD A;  1BFI A;  3IMD A;  4ROJ A;  1M61 A;  2JYQ A;  3VRP A;  1O4K A;  3VS0 A;  2C9W A;  3CD3 A;  2MRK A;  4F5B A;  3M7F A;  3MXC A;  3S9K A;  3S8O A;  3VS4 A;  4U1P A;  3PSK A;  1O4Q A;  2LCT A;  4F59 A;  1A08 A;  3KFJ A;  1GHU A;  1O45 A;  2K7A B;  1BMB A;  1O4R A;  2GSB A;  2IUG A;  2K79 B;  1FU5 A;  2MRJ A;  2ETZ A;  2CBL A;  3UYO A;  4L1B B;  2C0I A;  1O4N A;  3IN8 A;  1RPY A;  1A1A A;  2PLE A;  1O49 A;  1TZE E;  3VRR A;  1Y1U A;  4FL3 A;  3VRZ A;  2IUH A;  1O4B A;  4OHI A;  1O44 A;  2B3O A;  1FMK A;  1FU6 A;  1O41 A;  1CWD L;  2L3T A;  3IN7 A;  2LNW A;  3QWY A;  5HKY A;  1AD5 A;  4OHD A;  1Y57 A;  2KK6 A;  2HUW A;  3TL0 A;  1O4P A;  3VRY A;  3PSJ A;  2CI9 A;  2Y1N A;  1AOU F;  3NHN A;  2Y3A B;  1BHH B;  3K2M A;  2OQ1 A;  3BUX B;  3VS3 A;  1JYU A;  1P13 A;  2C0O A;  4EIH A;  2DLY A;  4LUE A;  3BUW B;  2KNO A;  4A4B A;  1M27 A;  3PJP A;  1PIC A;  2LQN A;  1H9O A;  2H8H A;  2QMS A;  5HKZ A;  5BO4 A;  1BHF A;  1LKK A;  2PNB A;  1AOT F;  1O46 A;  3VS5 A;  1AYB A;  1NZV A;  2PTK A;  1O4A A;  1MW4 A;  1GRI A;  2C0T A;  4OHL A;  1QAD A;  3PLF B;  2EYZ A;  3S8N A;  1OO3 A;  5AUL A;  1K9A A;  5EEL A;  2PNA A;  1BLJ A;  2DCR A;  5EHP A;  3N8M A;  2MK2 A;  1MIL A;  4JE4 A;  4P9Z A;  1JYQ A;  2YSX A;  1SPS A;  2LQW A;  4OHH A;  1SHB A;  1FBZ A;  1O4J A;  5HKW A;  5I6V A;  4U17 A;  5DF6 A;  1LUM A;  2AUG A;  3C7I A;  1SHD A;  4A4C A;  3N84 A;  1QCF A;  5KAZ A;  3IMJ A;  2RVF A;  5DC4 A;  1G83 A;  4JEG A;  3OVE A;  3TKZ A;  1CSY A;  1HCS B;  1IS0 A;  2EO3 A;  1O4O A;  3GXX A;  3VRN A;  1NRV A;  4P9V A;  1AYC A;  2RMX A;  1FYR A;  2EL8 A;  4DGP A;  1KC2 A;  5EEQ A;  2YU7 A;  5IBS A;  1X27 A;  3CBL A;  3HCK A;  4H34 A;  2AOB A;  3OB1 B;  1R1P A;  1AYD A;  1O4C A;  3N7Y A;  1FHS A;  1LCJ A;  3MAZ A;  1X6C A;  3OB2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...