1A1AA

C-src (sh2 domain with c188a mutation) complexed with ace-formyl phosphotyr-glu-(n,n-dipentyl amine)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
b'DSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYSLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C-SRC TYROSINE KINASE
publication title Peptide ligands of pp60(c-src) SH2 domains: a thermodynamic and structural study.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (transferase/peptide)
total genus 27
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1a1aA00
1D4WA 1BFIA 3VS4A 1QCFA 3CWGA 2L6KA 1AOTF 1SPRA 2C9WA 4A4CA 1A09A 4EIHA 2CBLA 1AB2A 3VS7A 1LKLA 5KAZA 1JYRA 1O4DA 3S8OA 2SHPA 4LUEA 2YU7A 4E93A 1YVLA 3IMDA 1AD5A 4JE4A 3TKZA 4OHHA 1Y1UA 2CIAA 2JYQA 1FHSA 2ABLA 1A07A 2Y3AB 3VS5A 3CBLA 2BBUA 1M27A 1FMKA 5DF6A 2GSBA 1OPLA 5IBMA 1KSWA 5AXIA 2RMXA 4F59A 1A08A 2DLZA 4U17A 1FYRA 1BKLA 2RSYA 2EL8A 2IZVA 1H9OA 4GWFA 2CI9A 1X0NA 1TZEE 2PLEA 5HKWA 1F1WA 3T04A 3VRRA 1CJ1A 5D0JA 1CSZA 2CS0A 2CI8A 2MRKA 2PTKA 4JGHA 2IUHA 1A1BA 2EKXA 1O43A 5EEQA 1BF5A 5GJIA 1K9AA 4A4BA 5CDWA 1YVHA 3BUMB 2VIFA 5J3XA 1AYAA 5EG3B 2AOAA 2L3TA 2LCTA 2MC1A 4M4ZA 3IN8A 2C0TA 4LUDA 3MXCA 2EO3A 3VS6A 1BLKA 1O48A 2Y1NA 3KFJA 4X6SA 4FL3A 2LQNA 4P9VA 3S8NA 1GHUA 1BHFA 2H8HA 4H1OA 3BKBA 3VS3A 4OHDA 5DC4A 2ETZA 1LCKA 3BUOB 1O4AA 2KK6A 3VRNA 1P13A 1BMBA 3GXWA 2K7AB 1TCEA 3GXXA 2HUWA 1AOUF 1O4NA 1JU5A 1O4CA 1LKKA 2YSXA 1O4HA 1O4MA 1SHAA 1X6CA 1O4GA 3N7YA 1FBVA 2IUIA 3IN7A 4F5BA 3PSJA 4K45A 1BG1A 2MRJA 4TZIA 1BKMA 4GL9E 1M61A 3TL0A 4XZ0A 3OV1A 3HHMB 3EACA 4L1BB 2CRHA 1MW4A 3VGOA 5GJHA 3HIZB 2DM0A 1LUKA 1O4IA 1XA6A 2PLDA 3WA4A 3PLFB 1O4JA 3N84A 1LUMA 3UF4A 1LCJA 1A81A 1IS0A 3PSKA 2LQWA 3GQIB 1I3ZA 2L4KA 1HCSB 1SPSA 1X27A 1FU6A 2PNAA 1HCTB 1Z3KA 1O4RA 3S9KA 2HCKA 3QWYA 5EELA 2EYZA 2MK2A 1AYDA 1JYQA 3VS2A 1O45A 3MXYA 1QG1E 1F2FA 3HCKA 1FU5A 1O4BA 2RVFA 4WWQA 2LNXA 1Y57A 1R1SA 1B47A 4U1PA 2DLYA 2H46E 1LUIA 4F5AA 2MQIA 1R1QA 4QSYA 1NZVA 1OO4A 3N8MA 1SKJA 4NWFA 4EY0A 1PICA 2HDVA 4D8KA 3US4A 4XZ1A 1O4EA 2EYVA 4DGPA 1OPKA 3OP0A 1D1ZA 1BLJA 3VROA 4ROJA 3VRPA 3BUXB 2C0IA 5AULA 2OZOA 3NHNA 3BUWB 3OB1B 2AOBA 1BHHA 3UYOA 4FBNA 4JEGA 4P9ZA 1CWDL 1O4FA 3PS5A 4H34A 3M7FA 2FO0A 1UUSA 2ECDA 5IBSA 4OHLA 2LNWA 2CR4A 1O46A 1D4TA 1AYBA 1O4OA 1NZLA 1CWEA 2K79B 1ZFPE 2Y1MA 1RJAA 1O4KA 3S8LA 2FCIA 1O49A 1FBZA 4K11A 3PFVA 4K2RA 3IMJA 3PJPA 1GRIA 4E68A 1RPYA 1O4LA 2QMSA 2DCRA 2EOBA 2B3OA 2AUGA 2GE9A 2PNBA 1BM2A 4DGXA 2C0OA 1JYUA 3K2MA 1O4QA 3C7IA 1CSYA 1BFJA 1G83A 2EU0A 4NWGA 1SHBA 1KA6A 1UURA 5I6VA 1RQQC 5EHRA 5BO4A 2HDXA 2XP1A 3CD3A 5EHPA 1IJRA 3BUNB 1O42A 2EO6A 5HKZA 4K44A 2H5KA 2IUGA 2HMHA 2EYYA 1NRVA 1R1PA 2KNOA 3QWXX 1O47A 1MILA 1O41A 3CXLA 5DC9A 5HKYA 4OHEA 1SHDA 2SRCA 4OHIA 1KA7A 1O44A 1KC2A 1A1CA 1A1AA 3VS1A 3MAZA 3VS0A 3OVEA 1AYCA 2OQ1A 1LUNA 3ZNIA 3VRZA 3VRQA 1JWOA 1A1EA 5DC0B 2RORA 3PQZA 2DVJA 1QADA 1O4PA 1BHHB 3VRYA 4GPLB 3OB2B 2DX0A 3EAZA 1WQUA 1OO3A 4FL2A
chains in the Genus database with same CATH superfamily
1D4WA 1BFIA 3VS4A 1QCFA 3CWGA 2L6KA 1AOTF 1SPRA 2C9WA 4A4CA 1A09A 4EIHA 2CBLA 1AB2A 3VS7A 1LKLA 5KAZA 1JYRA 1O4DA 3S8OA 2SHPA 4LUEA 2YU7A 4E93A 1YVLA 3IMDA 1AD5A 4JE4A 3TKZA 4OHHA 1Y1UA 2CIAA 2JYQA 1FHSA 2ABLA 1A07A 2Y3AB 3VS5A 3CBLA 2BBUA 1M27A 1FMKA 5DF6A 2GSBA 1OPLA 5IBMA 1KSWA 5AXIA 2RMXA 4F59A 1A08A 2DLZA 4U17A 1FYRA 1BKLA 2RSYA 2EL8A 2IZVA 1H9OA 4GWFA 2CI9A 1X0NA 1TZEE 2PLEA 5HKWA 1F1WA 3T04A 3VRRA 1CJ1A 5D0JA 1CSZA 2CS0A 2CI8A 2MRKA 2PTKA 4JGHA 2IUHA 1A1BA 2EKXA 1O43A 5EEQA 1BF5A 5GJIA 1K9AA 4A4BA 5CDWA 1YVHA 3BUMB 2VIFA 5J3XA 1AYAA 5EG3B 2AOAA 2L3TA 2LCTA 2MC1A 4M4ZA 3IN8A 2C0TA 4LUDA 3MXCA 2EO3A 3VS6A 1BLKA 1O48A 2Y1NA 3KFJA 4X6SA 4FL3A 2LQNA 4P9VA 3S8NA 1GHUA 1BHFA 2H8HA 4H1OA 3BKBA 3VS3A 4OHDA 5DC4A 2ETZA 1LCKA 3BUOB 1O4AA 2KK6A 3VRNA 1P13A 1BMBA 3GXWA 2K7AB 1TCEA 3GXXA 2HUWA 1AOUF 1O4NA 1JU5A 1O4CA 1LKKA 2YSXA 1O4HA 1O4MA 1SHAA 1X6CA 1O4GA 3N7YA 1FBVA 2IUIA 3IN7A 4F5BA 3PSJA 4K45A 1BG1A 2MRJA 4TZIA 1BKMA 4GL9E 1M61A 3TL0A 4XZ0A 3OV1A 3HHMB 3EACA 4L1BB 2CRHA 1MW4A 3VGOA 5GJHA 3HIZB 2LRAA 2DM0A 1LUKA 1O4IA 1XA6A 2PLDA 3WA4A 3PLFB 1O4JA 3N84A 1LUMA 3UF4A 1LCJA 1A81A 1IS0A 3PSKA 2LQWA 3GQIB 1I3ZA 2L4KA 1HCSB 1SPSA 1X27A 1FU6A 2PNAA 1HCTB 1Z3KA 1O4RA 3S9KA 3QWYA 2HCKA 5EELA 2EYZA 2MK2A 1AYDA 1JYQA 3VS2A 1O45A 3MXYA 1QG1E 1F2FA 3HCKA 1FU5A 1O4BA 2RVFA 4WWQA 2LNXA 1Y57A 1R1SA 1B47A 4U1PA 2DLYA 2H46E 1LUIA 4F5AA 2MQIA 1R1QA 4QSYA 1NZVA 1OO4A 3N8MA 1SKJA 4NWFA 4EY0A 1PICA 2HDVA 4D8KA 3US4A 4XZ1A 1O4EA 2EYVA 4DGPA 1OPKA 3OP0A 1D1ZA 1BLJA 3VROA 4ROJA 3VRPA 3BUXB 2C0IA 5AULA 2OZOA 3NHNA 3BUWB 3OB1B 2AOBA 1BHHA 3UYOA 4FBNA 4JEGA 4P9ZA 1CWDL 1O4FA 3PS5A 4H34A 3M7FA 2FO0A 1UUSA 2ECDA 5IBSA 4OHLA 2LNWA 2CR4A 1O46A 1D4TA 1AYBA 1O4OA 1NZLA 1CWEA 2K79B 1ZFPE 2Y1MA 1RJAA 1O4KA 3S8LA 2FCIA 1O49A 1FBZA 4K11A 3PFVA 4K2RA 3IMJA 3PJPA 1GRIA 3LYVA 4E68A 1RPYA 1O4LA 2QMSA 2DCRA 2EOBA 2B3OA 2AUGA 2GE9A 2PNBA 1BM2A 4DGXA 2C0OA 1JYUA 3K2MA 1O4QA 3C7IA 1CSYA 2KGYA 1BFJA 1G83A 2EU0A 4NWGA 1SHBA 1KA6A 1UURA 5I6VA 1RQQC 5EHRA 5BO4A 2HDXA 2XP1A 3CD3A 5EHPA 1IJRA 3BUNB 1O42A 2EO6A 5HKZA 4K44A 2H5KA 2IUGA 2HMHA 2EYYA 1NRVA 1R1PA 2KNOA 3QWXX 1O47A 1MILA 1O41A 3CXLA 5DC9A 5HKYA 4OHEA 1SHDA 2SRCA 4OHIA 1KA7A 1O44A 1KC2A 1A1CA 1A1AA 3VS1A 3MAZA 3VS0A 3OVEA 1AYCA 2OQ1A 1LUNA 3ZNIA 3VRZA 3VRQA 1JWOA 1A1EA 5DC0B 2RORA 3PQZA 2DVJA 1QADA 1O4PA 1BHHB 3VRYA 4GPLB 3K2TA 3OB2B 2DX0A 3EAZA 1WQUA 1OO3A 4FL2A
chains in the Genus database with same CATH topology
1D4WA 1BFIA 3VS4A 1QCFA 3CWGA 2L6KA 1AOTF 1SPRA 2C9WA 4A4CA 1A09A 4EIHA 2CBLA 1AB2A 3VS7A 1LKLA 5KAZA 1JYRA 1O4DA 3S8OA 2SHPA 4LUEA 2YU7A 4E93A 1YVLA 3IMDA 1AD5A 4JE4A 3TKZA 4OHHA 1Y1UA 2CIAA 2JYQA 1FHSA 2ABLA 1A07A 2Y3AB 3VS5A 3CBLA 2BBUA 1M27A 1FMKA 5DF6A 2GSBA 1OPLA 5IBMA 1KSWA 5AXIA 2RMXA 4F59A 1A08A 2DLZA 4U17A 1FYRA 1BKLA 2RSYA 2EL8A 2IZVA 1H9OA 4GWFA 2CI9A 1X0NA 1TZEE 2PLEA 5HKWA 1F1WA 3T04A 3VRRA 1CJ1A 5D0JA 1CSZA 2CS0A 2CI8A 2MRKA 2PTKA 4JGHA 2IUHA 1A1BA 2EKXA 1O43A 5EEQA 1BF5A 5GJIA 1K9AA 4A4BA 5CDWA 1YVHA 3BUMB 2VIFA 5J3XA 1AYAA 5EG3B 2AOAA 2L3TA 2LCTA 2MC1A 4M4ZA 3IN8A 2C0TA 4LUDA 3MXCA 2EO3A 3VS6A 1BLKA 1O48A 2Y1NA 3KFJA 4X6SA 4FL3A 2LQNA 4P9VA 3S8NA 1GHUA 1BHFA 2H8HA 4H1OA 3BKBA 3VS3A 4OHDA 5DC4A 2ETZA 1LCKA 3BUOB 1O4AA 2KK6A 3VRNA 1P13A 1BMBA 3GXWA 2K7AB 1TCEA 3GXXA 2HUWA 1AOUF 1O4NA 1JU5A 1O4CA 1LKKA 2YSXA 1O4HA 1O4MA 1SHAA 1X6CA 1O4GA 3N7YA 1FBVA 2IUIA 3IN7A 4F5BA 3PSJA 4K45A 1BG1A 2MRJA 4TZIA 1BKMA 4GL9E 1M61A 3TL0A 4XZ0A 3OV1A 3HHMB 3EACA 4L1BB 2CRHA 1MW4A 3VGOA 5GJHA 3HIZB 2DM0A 1LUKA 1O4IA 1XA6A 2PLDA 3WA4A 3PLFB 1O4JA 3N84A 1LUMA 3UF4A 1LCJA 1A81A 1IS0A 3PSKA 2LQWA 3GQIB 1I3ZA 2L4KA 1HCSB 1SPSA 1X27A 1FU6A 2PNAA 1HCTB 1Z3KA 1O4RA 3S9KA 2HCKA 3QWYA 5EELA 2EYZA 2MK2A 1AYDA 1JYQA 3VS2A 1O45A 3MXYA 1QG1E 1F2FA 3HCKA 1FU5A 1O4BA 2RVFA 4WWQA 2LNXA 1Y57A 1R1SA 1B47A 4U1PA 2DLYA 2H46E 1LUIA 4F5AA 2MQIA 1R1QA 4QSYA 1NZVA 1OO4A 3N8MA 1SKJA 4NWFA 4EY0A 1PICA 2HDVA 4D8KA 3US4A 4XZ1A 1O4EA 2EYVA 4DGPA 1OPKA 3OP0A 1D1ZA 1BLJA 3VROA 4ROJA 3VRPA 3BUXB 2C0IA 5AULA 2OZOA 3NHNA 3BUWB 3OB1B 2AOBA 1BHHA 3UYOA 4FBNA 4JEGA 4P9ZA 1CWDL 1O4FA 3PS5A 4H34A 3M7FA 2FO0A 1UUSA 2ECDA 5IBSA 4OHLA 2LNWA 2CR4A 1O46A 1D4TA 1AYBA 1O4OA 1NZLA 1CWEA 2K79B 1ZFPE 2Y1MA 1RJAA 1O4KA 3S8LA 2FCIA 1O49A 1FBZA 4K11A 3PFVA 4K2RA 3IMJA 3PJPA 1GRIA 4E68A 1RPYA 1O4LA 2QMSA 2DCRA 2EOBA 2B3OA 2AUGA 2GE9A 2PNBA 1BM2A 4DGXA 2C0OA 1JYUA 3K2MA 1O4QA 3C7IA 1CSYA 1BFJA 1G83A 2EU0A 4NWGA 1SHBA 1KA6A 1UURA 5I6VA 1RQQC 5EHRA 5BO4A 2HDXA 2XP1A 3CD3A 5EHPA 1IJRA 3BUNB 1O42A 2EO6A 5HKZA 4K44A 2H5KA 2IUGA 2HMHA 2EYYA 1NRVA 1R1PA 2KNOA 3QWXX 1O47A 1MILA 1O41A 3CXLA 5DC9A 5HKYA 4OHEA 1SHDA 2SRCA 4OHIA 1KA7A 1O44A 1KC2A 1A1CA 1A1AA 3VS1A 3MAZA 3VS0A 3OVEA 1AYCA 2OQ1A 1LUNA 3ZNIA 3VRZA 3VRQA 1JWOA 1A1EA 5DC0B 2RORA 3PQZA 2DVJA 1QADA 1O4PA 1BHHB 3VRYA 4GPLB 3OB2B 2DX0A 3EAZA 1WQUA 1OO3A 4FL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D4W A;  1BFI A;  3VS4 A;  1QCF A;  3CWG A;  2L6K A;  1AOT F;  1SPR A;  2C9W A;  4A4C A;  1A09 A;  4EIH A;  2CBL A;  1AB2 A;  3VS7 A;  1LKL A;  5KAZ A;  1JYR A;  1O4D A;  3S8O A;  2SHP A;  4LUE A;  2YU7 A;  4E93 A;  1YVL A;  3IMD A;  1AD5 A;  4JE4 A;  3TKZ A;  4OHH A;  1Y1U A;  2CIA A;  2JYQ A;  1FHS A;  2ABL A;  1A07 A;  2Y3A B;  3VS5 A;  3CBL A;  2BBU A;  1M27 A;  1FMK A;  5DF6 A;  2GSB A;  1OPL A;  5IBM A;  1KSW A;  5AXI A;  2RMX A;  4F59 A;  1A08 A;  2DLZ A;  4U17 A;  1FYR A;  1BKL A;  2RSY A;  2EL8 A;  2IZV A;  1H9O A;  4GWF A;  2CI9 A;  1X0N A;  1TZE E;  2PLE A;  5HKW A;  1F1W A;  3T04 A;  3VRR A;  1CJ1 A;  5D0J A;  1CSZ A;  2CS0 A;  2CI8 A;  2MRK A;  2PTK A;  4JGH A;  2IUH A;  1A1B A;  2EKX A;  1O43 A;  5EEQ A;  1BF5 A;  5GJI A;  1K9A A;  4A4B A;  5CDW A;  1YVH A;  3BUM B;  2VIF A;  5J3X A;  1AYA A;  5EG3 B;  2AOA A;  2L3T A;  2LCT A;  2MC1 A;  4M4Z A;  3IN8 A;  2C0T A;  4LUD A;  3MXC A;  2EO3 A;  3VS6 A;  1BLK A;  1O48 A;  2Y1N A;  3KFJ A;  4X6S A;  4FL3 A;  2LQN A;  4P9V A;  3S8N A;  1GHU A;  1BHF A;  2H8H A;  4H1O A;  3BKB A;  3VS3 A;  4OHD A;  5DC4 A;  2ETZ A;  1LCK A;  3BUO B;  1O4A A;  2KK6 A;  3VRN A;  1P13 A;  1BMB A;  3GXW A;  2K7A B;  1TCE A;  3GXX A;  2HUW A;  1AOU F;  1O4N A;  1JU5 A;  1O4C A;  1LKK A;  2YSX A;  1O4H A;  1O4M A;  1SHA A;  1X6C A;  1O4G A;  3N7Y A;  1FBV A;  2IUI A;  3IN7 A;  4F5B A;  3PSJ A;  4K45 A;  1BG1 A;  2MRJ A;  4TZI A;  1BKM A;  4GL9 E;  1M61 A;  3TL0 A;  4XZ0 A;  3OV1 A;  3HHM B;  3EAC A;  4L1B B;  2CRH A;  1MW4 A;  3VGO A;  5GJH A;  3HIZ B;  2DM0 A;  1LUK A;  1O4I A;  1XA6 A;  2PLD A;  3WA4 A;  3PLF B;  1O4J A;  3N84 A;  1LUM A;  3UF4 A;  1LCJ A;  1A81 A;  1IS0 A;  3PSK A;  2LQW A;  3GQI B;  1I3Z A;  2L4K A;  1HCS B;  1SPS A;  1X27 A;  1FU6 A;  2PNA A;  1HCT B;  1Z3K A;  1O4R A;  3S9K A;  2HCK A;  3QWY A;  5EEL A;  2EYZ A;  2MK2 A;  1AYD A;  1JYQ A;  3VS2 A;  1O45 A;  3MXY A;  1QG1 E;  1F2F A;  3HCK A;  1FU5 A;  1O4B A;  2RVF A;  4WWQ A;  2LNX A;  1Y57 A;  1R1S A;  1B47 A;  4U1P A;  2DLY A;  2H46 E;  1LUI A;  4F5A A;  2MQI A;  1R1Q A;  4QSY A;  1NZV A;  1OO4 A;  3N8M A;  1SKJ A;  4NWF A;  4EY0 A;  1PIC A;  2HDV A;  4D8K A;  3US4 A;  4XZ1 A;  1O4E A;  2EYV A;  4DGP A;  1OPK A;  3OP0 A;  1D1Z A;  1BLJ A;  3VRO A;  4ROJ A;  3VRP A;  3BUX B;  2C0I A;  5AUL A;  2OZO A;  3NHN A;  3BUW B;  3OB1 B;  2AOB A;  1BHH A;  3UYO A;  4FBN A;  4JEG A;  4P9Z A;  1CWD L;  1O4F A;  3PS5 A;  4H34 A;  3M7F A;  2FO0 A;  1UUS A;  2ECD A;  5IBS A;  4OHL A;  2LNW A;  2CR4 A;  1O46 A;  1D4T A;  1AYB A;  1O4O A;  1NZL A;  1CWE A;  2K79 B;  1ZFP E;  2Y1M A;  1RJA A;  1O4K A;  3S8L A;  2FCI A;  1O49 A;  1FBZ A;  4K11 A;  3PFV A;  4K2R A;  3IMJ A;  3PJP A;  1GRI A;  4E68 A;  1RPY A;  1O4L A;  2QMS A;  2DCR A;  2EOB A;  2B3O A;  2AUG A;  2GE9 A;  2PNB A;  1BM2 A;  4DGX A;  2C0O A;  1JYU A;  3K2M A;  1O4Q A;  3C7I A;  1CSY A;  1BFJ A;  1G83 A;  2EU0 A;  4NWG A;  1SHB A;  1KA6 A;  1UUR A;  5I6V A;  1RQQ C;  5EHR A;  5BO4 A;  2HDX A;  2XP1 A;  3CD3 A;  5EHP A;  1IJR A;  3BUN B;  1O42 A;  2EO6 A;  5HKZ A;  4K44 A;  2H5K A;  2IUG A;  2HMH A;  2EYY A;  1NRV A;  1R1P A;  2KNO A;  3QWX X;  1O47 A;  1MIL A;  1O41 A;  3CXL A;  5DC9 A;  5HKY A;  4OHE A;  1SHD A;  2SRC A;  4OHI A;  1KA7 A;  1O44 A;  1KC2 A;  1A1C A;  1A1A A;  3VS1 A;  3MAZ A;  3VS0 A;  3OVE A;  1AYC A;  2OQ1 A;  1LUN A;  3ZNI A;  3VRZ A;  3VRQ A;  1JWO A;  1A1E A;  5DC0 B;  2ROR A;  3PQZ A;  2DVJ A;  1QAD A;  1O4P A;  1BHH B;  3VRY A;  4GPL B;  3OB2 B;  2DX0 A;  3EAZ A;  1WQU A;  1OO3 A;  4FL2 A; 
#chains in the Genus database with same CATH topology
 1D4W A;  1BFI A;  3VS4 A;  1QCF A;  3CWG A;  2L6K A;  1AOT F;  1SPR A;  2C9W A;  4A4C A;  1A09 A;  4EIH A;  2CBL A;  1AB2 A;  3VS7 A;  1LKL A;  5KAZ A;  1JYR A;  1O4D A;  3S8O A;  2SHP A;  4LUE A;  2YU7 A;  4E93 A;  1YVL A;  3IMD A;  1AD5 A;  4JE4 A;  3TKZ A;  4OHH A;  1Y1U A;  2CIA A;  2JYQ A;  1FHS A;  2ABL A;  1A07 A;  2Y3A B;  3VS5 A;  3CBL A;  2BBU A;  1M27 A;  1FMK A;  5DF6 A;  2GSB A;  1OPL A;  5IBM A;  1KSW A;  5AXI A;  2RMX A;  4F59 A;  1A08 A;  2DLZ A;  4U17 A;  1FYR A;  1BKL A;  2RSY A;  2EL8 A;  2IZV A;  1H9O A;  4GWF A;  2CI9 A;  1X0N A;  1TZE E;  2PLE A;  5HKW A;  1F1W A;  3T04 A;  3VRR A;  1CJ1 A;  5D0J A;  1CSZ A;  2CS0 A;  2CI8 A;  2MRK A;  2PTK A;  4JGH A;  2IUH A;  1A1B A;  2EKX A;  1O43 A;  5EEQ A;  1BF5 A;  5GJI A;  1K9A A;  4A4B A;  5CDW A;  1YVH A;  3BUM B;  2VIF A;  5J3X A;  1AYA A;  5EG3 B;  2AOA A;  2L3T A;  2LCT A;  2MC1 A;  4M4Z A;  3IN8 A;  2C0T A;  4LUD A;  3MXC A;  2EO3 A;  3VS6 A;  1BLK A;  1O48 A;  2Y1N A;  3KFJ A;  4X6S A;  4FL3 A;  2LQN A;  4P9V A;  3S8N A;  1GHU A;  1BHF A;  2H8H A;  4H1O A;  3BKB A;  3VS3 A;  4OHD A;  5DC4 A;  2ETZ A;  1LCK A;  3BUO B;  1O4A A;  2KK6 A;  3VRN A;  1P13 A;  1BMB A;  3GXW A;  2K7A B;  1TCE A;  3GXX A;  2HUW A;  1AOU F;  1O4N A;  1JU5 A;  1O4C A;  1LKK A;  2YSX A;  1O4H A;  1O4M A;  1SHA A;  1X6C A;  1O4G A;  3N7Y A;  1FBV A;  2IUI A;  3IN7 A;  4F5B A;  3PSJ A;  4K45 A;  1BG1 A;  2MRJ A;  4TZI A;  1BKM A;  4GL9 E;  1M61 A;  3TL0 A;  4XZ0 A;  3OV1 A;  3HHM B;  3EAC A;  4L1B B;  2CRH A;  1MW4 A;  3VGO A;  5GJH A;  3HIZ B;  2LRA A;  2DM0 A;  1LUK A;  1O4I A;  1XA6 A;  2PLD A;  3WA4 A;  3PLF B;  1O4J A;  3N84 A;  1LUM A;  3UF4 A;  1LCJ A;  1A81 A;  1IS0 A;  3PSK A;  2LQW A;  3GQI B;  1I3Z A;  2L4K A;  1HCS B;  1SPS A;  1X27 A;  1FU6 A;  2PNA A;  1HCT B;  1Z3K A;  1O4R A;  3S9K A;  3QWY A;  2HCK A;  5EEL A;  2EYZ A;  2MK2 A;  1AYD A;  1JYQ A;  3VS2 A;  1O45 A;  3MXY A;  1QG1 E;  1F2F A;  3HCK A;  1FU5 A;  1O4B A;  2RVF A;  4WWQ A;  2LNX A;  1Y57 A;  1R1S A;  1B47 A;  4U1P A;  2DLY A;  2H46 E;  1LUI A;  4F5A A;  2MQI A;  1R1Q A;  4QSY A;  1NZV A;  1OO4 A;  3N8M A;  1SKJ A;  4NWF A;  4EY0 A;  1PIC A;  2HDV A;  4D8K A;  3US4 A;  4XZ1 A;  1O4E A;  2EYV A;  4DGP A;  1OPK A;  3OP0 A;  1D1Z A;  1BLJ A;  3VRO A;  4ROJ A;  3VRP A;  3BUX B;  2C0I A;  5AUL A;  2OZO A;  3NHN A;  3BUW B;  3OB1 B;  2AOB A;  1BHH A;  3UYO A;  4FBN A;  4JEG A;  4P9Z A;  1CWD L;  1O4F A;  3PS5 A;  4H34 A;  3M7F A;  2FO0 A;  1UUS A;  2ECD A;  5IBS A;  4OHL A;  2LNW A;  2CR4 A;  1O46 A;  1D4T A;  1AYB A;  1O4O A;  1NZL A;  1CWE A;  2K79 B;  1ZFP E;  2Y1M A;  1RJA A;  1O4K A;  3S8L A;  2FCI A;  1O49 A;  1FBZ A;  4K11 A;  3PFV A;  4K2R A;  3IMJ A;  3PJP A;  1GRI A;  3LYV A;  4E68 A;  1RPY A;  1O4L A;  2QMS A;  2DCR A;  2EOB A;  2B3O A;  2AUG A;  2GE9 A;  2PNB A;  1BM2 A;  4DGX A;  2C0O A;  1JYU A;  3K2M A;  1O4Q A;  3C7I A;  1CSY A;  2KGY A;  1BFJ A;  1G83 A;  2EU0 A;  4NWG A;  1SHB A;  1KA6 A;  1UUR A;  5I6V A;  1RQQ C;  5EHR A;  5BO4 A;  2HDX A;  2XP1 A;  3CD3 A;  5EHP A;  1IJR A;  3BUN B;  1O42 A;  2EO6 A;  5HKZ A;  4K44 A;  2H5K A;  2IUG A;  2HMH A;  2EYY A;  1NRV A;  1R1P A;  2KNO A;  3QWX X;  1O47 A;  1MIL A;  1O41 A;  3CXL A;  5DC9 A;  5HKY A;  4OHE A;  1SHD A;  2SRC A;  4OHI A;  1KA7 A;  1O44 A;  1KC2 A;  1A1C A;  1A1A A;  3VS1 A;  3MAZ A;  3VS0 A;  3OVE A;  1AYC A;  2OQ1 A;  1LUN A;  3ZNI A;  3VRZ A;  3VRQ A;  1JWO A;  1A1E A;  5DC0 B;  2ROR A;  3PQZ A;  2DVJ A;  1QAD A;  1O4P A;  1BHH B;  3VRY A;  4GPL B;  3K2T A;  3OB2 B;  2DX0 A;  3EAZ A;  1WQU A;  1OO3 A;  4FL2 A; 
#chains in the Genus database with same CATH homology
 1D4W A;  1BFI A;  3VS4 A;  1QCF A;  3CWG A;  2L6K A;  1AOT F;  1SPR A;  2C9W A;  4A4C A;  1A09 A;  4EIH A;  2CBL A;  1AB2 A;  3VS7 A;  1LKL A;  5KAZ A;  1JYR A;  1O4D A;  3S8O A;  2SHP A;  4LUE A;  2YU7 A;  4E93 A;  1YVL A;  3IMD A;  1AD5 A;  4JE4 A;  3TKZ A;  4OHH A;  1Y1U A;  2CIA A;  2JYQ A;  1FHS A;  2ABL A;  1A07 A;  2Y3A B;  3VS5 A;  3CBL A;  2BBU A;  1M27 A;  1FMK A;  5DF6 A;  2GSB A;  1OPL A;  5IBM A;  1KSW A;  5AXI A;  2RMX A;  4F59 A;  1A08 A;  2DLZ A;  4U17 A;  1FYR A;  1BKL A;  2RSY A;  2EL8 A;  2IZV A;  1H9O A;  4GWF A;  2CI9 A;  1X0N A;  1TZE E;  2PLE A;  5HKW A;  1F1W A;  3T04 A;  3VRR A;  1CJ1 A;  5D0J A;  1CSZ A;  2CS0 A;  2CI8 A;  2MRK A;  2PTK A;  4JGH A;  2IUH A;  1A1B A;  2EKX A;  1O43 A;  5EEQ A;  1BF5 A;  5GJI A;  1K9A A;  4A4B A;  5CDW A;  1YVH A;  3BUM B;  2VIF A;  5J3X A;  1AYA A;  5EG3 B;  2AOA A;  2L3T A;  2LCT A;  2MC1 A;  4M4Z A;  3IN8 A;  2C0T A;  4LUD A;  3MXC A;  2EO3 A;  3VS6 A;  1BLK A;  1O48 A;  2Y1N A;  3KFJ A;  4X6S A;  4FL3 A;  2LQN A;  4P9V A;  3S8N A;  1GHU A;  1BHF A;  2H8H A;  4H1O A;  3BKB A;  3VS3 A;  4OHD A;  5DC4 A;  2ETZ A;  1LCK A;  3BUO B;  1O4A A;  2KK6 A;  3VRN A;  1P13 A;  1BMB A;  3GXW A;  2K7A B;  1TCE A;  3GXX A;  2HUW A;  1AOU F;  1O4N A;  1JU5 A;  1O4C A;  1LKK A;  2YSX A;  1O4H A;  1O4M A;  1SHA A;  1X6C A;  1O4G A;  3N7Y A;  1FBV A;  2IUI A;  3IN7 A;  4F5B A;  3PSJ A;  4K45 A;  1BG1 A;  2MRJ A;  4TZI A;  1BKM A;  4GL9 E;  1M61 A;  3TL0 A;  4XZ0 A;  3OV1 A;  3HHM B;  3EAC A;  4L1B B;  2CRH A;  1MW4 A;  3VGO A;  5GJH A;  3HIZ B;  2DM0 A;  1LUK A;  1O4I A;  1XA6 A;  2PLD A;  3WA4 A;  3PLF B;  1O4J A;  3N84 A;  1LUM A;  3UF4 A;  1LCJ A;  1A81 A;  1IS0 A;  3PSK A;  2LQW A;  3GQI B;  1I3Z A;  2L4K A;  1HCS B;  1SPS A;  1X27 A;  1FU6 A;  2PNA A;  1HCT B;  1Z3K A;  1O4R A;  3S9K A;  2HCK A;  3QWY A;  5EEL A;  2EYZ A;  2MK2 A;  1AYD A;  1JYQ A;  3VS2 A;  1O45 A;  3MXY A;  1QG1 E;  1F2F A;  3HCK A;  1FU5 A;  1O4B A;  2RVF A;  4WWQ A;  2LNX A;  1Y57 A;  1R1S A;  1B47 A;  4U1P A;  2DLY A;  2H46 E;  1LUI A;  4F5A A;  2MQI A;  1R1Q A;  4QSY A;  1NZV A;  1OO4 A;  3N8M A;  1SKJ A;  4NWF A;  4EY0 A;  1PIC A;  2HDV A;  4D8K A;  3US4 A;  4XZ1 A;  1O4E A;  2EYV A;  4DGP A;  1OPK A;  3OP0 A;  1D1Z A;  1BLJ A;  3VRO A;  4ROJ A;  3VRP A;  3BUX B;  2C0I A;  5AUL A;  2OZO A;  3NHN A;  3BUW B;  3OB1 B;  2AOB A;  1BHH A;  3UYO A;  4FBN A;  4JEG A;  4P9Z A;  1CWD L;  1O4F A;  3PS5 A;  4H34 A;  3M7F A;  2FO0 A;  1UUS A;  2ECD A;  5IBS A;  4OHL A;  2LNW A;  2CR4 A;  1O46 A;  1D4T A;  1AYB A;  1O4O A;  1NZL A;  1CWE A;  2K79 B;  1ZFP E;  2Y1M A;  1RJA A;  1O4K A;  3S8L A;  2FCI A;  1O49 A;  1FBZ A;  4K11 A;  3PFV A;  4K2R A;  3IMJ A;  3PJP A;  1GRI A;  4E68 A;  1RPY A;  1O4L A;  2QMS A;  2DCR A;  2EOB A;  2B3O A;  2AUG A;  2GE9 A;  2PNB A;  1BM2 A;  4DGX A;  2C0O A;  1JYU A;  3K2M A;  1O4Q A;  3C7I A;  1CSY A;  1BFJ A;  1G83 A;  2EU0 A;  4NWG A;  1SHB A;  1KA6 A;  1UUR A;  5I6V A;  1RQQ C;  5EHR A;  5BO4 A;  2HDX A;  2XP1 A;  3CD3 A;  5EHP A;  1IJR A;  3BUN B;  1O42 A;  2EO6 A;  5HKZ A;  4K44 A;  2H5K A;  2IUG A;  2HMH A;  2EYY A;  1NRV A;  1R1P A;  2KNO A;  3QWX X;  1O47 A;  1MIL A;  1O41 A;  3CXL A;  5DC9 A;  5HKY A;  4OHE A;  1SHD A;  2SRC A;  4OHI A;  1KA7 A;  1O44 A;  1KC2 A;  1A1C A;  1A1A A;  3VS1 A;  3MAZ A;  3VS0 A;  3OVE A;  1AYC A;  2OQ1 A;  1LUN A;  3ZNI A;  3VRZ A;  3VRQ A;  1JWO A;  1A1E A;  5DC0 B;  2ROR A;  3PQZ A;  2DVJ A;  1QAD A;  1O4P A;  1BHH B;  3VRY A;  4GPL B;  3OB2 B;  2DX0 A;  3EAZ A;  1WQU A;  1OO3 A;  4FL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...