5EG3B

Crystal structure of the activated fgf receptor 2 (fgfr2) kinase domain in complex with the csh2 domain of phospholipase c gamma (plcgamma)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
b'MNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibroblast growth factor receptor 2
publication title Two FGF Receptor Kinase Molecules Act in Concert to Recruit and Transphosphorylate Phospholipase C gamma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/hydrolase
total genus 26
structure length 113
sequence length 113
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 5eg3B00
1R1QA 5D0JA 1O4QA 1XA6A 1TZEE 5IBSA 2ETZA 4A4CA 1LUKA 5I6VA 2OZOA 1H9OA 1HCSB 2JYQA 2DCRA 4OHEA 4D8KA 1RQQC 2IZVA 4QSYA 1KA6A 3VS1A 4FBNA 2LQWA 2SRCA 1BLJA 2C0IA 3QWYA 5DC4A 1O4BA 1BHFA 4F5AA 3PLFB 1A81A 1IJRA 1A1BA 2EU0A 1O4RA 1FHSA 2HMHA 2CI8A 3EAZA 3UF4A 3CWGA 3VS6A 1CSYA 4FL2A 3BUWB 4K11A 3N8MA 3BKBA 1Z3KA 3KFJA 2LNWA 5HKYA 2CS0A 2C0TA 3HIZB 5DC9A 1FBVA 1NRVA 1PICA 2SHPA 4LUEA 1BHHA 1BMBA 2EYYA 1O41A 1ZFPE 1CWEA 2IUHA 4OHDA 2EL8A 1CWDL 1KA7A 4P9VA 3QWXX 3VS3A 2ABLA 1FMKA 2L6KA 2AUGA 4E68A 1F1WA 5IBMA 1AYCA 1SKJA 4M4ZA 2HDVA 2AOAA 1M27A 3OVEA 5AULA 3VROA 2RVFA 3OP0A 1OPLA 1O44A 2EO6A 2C0OA 1LUNA 1NZVA 3S8LA 4E93A 1D4WA 1O4KA 4L1BB 1JU5A 1A09A 3EACA 1X6CA 3BUMB 1SPRA 3GXWA 1GRIA 1A1EA 1O4GA 3WA4A 1KSWA 2GSBA 1A08A 3OB1B 5KAZA 1SHAA 1O4EA 2PLDA 3BUOB 1IS0A 1HCTB 2HCKA 1O4MA 3GXXA 1O45A 4X6SA 1A1AA 3PSKA 2L4KA 1O46A 3VS2A 3ZNIA 1A1CA 1I3ZA 4JE4A 1WQUA 2RMXA 2FCIA 3HCKA 1GHUA 2MRKA 2LQNA 3PS5A 4WWQA 2YU7A 2VIFA 2B3OA 3MAZA 4XZ0A 3VRRA 1BG1A 3M7FA 2MRJA 2PTKA 1Y1UA 4F5BA 4JEGA 3VRYA 1O48A 3VS7A 1CJ1A 1O43A 2CR4A 1O4JA 1O4FA 1NZLA 5GJIA 1CSZA 1LCKA 1O4PA 1JYQA 1FU6A 3NHNA 1JYUA 4FL3A 1MILA 2OQ1A 2ECDA 2DLZA 2H46E 2H5KA 2CBLA 5CDWA 5GJHA 4EIHA 1X0NA 2XP1A 2DX0A 1LUIA 3UYOA 1SPSA 5HKWA 2IUGA 1KC2A 4GPLB 4U1PA 2GE9A 3PFVA 2MK2A 3VRQA 3MXYA 4F59A 2DLYA 1SHDA 1R1PA 3BUXB 1YVHA 2QMSA 3CD3A 4P9ZA 1JYRA 1BKMA 1FYRA 3S8NA 3K2MA 1F2FA 2EYZA 2DVJA 1AYDA 3VGOA 1G83A 1BHHB 2CIAA 1D1ZA 3S8OA 4OHLA 2RSYA 3US4A 3GQIB 3IN7A 2Y1MA 3VS0A 4JGHA 4DGPA 5DF6A 1X27A 1FU5A 2MQIA 4K2RA 5DC0B 3N7YA 5EHRA 1Y57A 2K79B 4DGXA 2PNAA 4TZIA 4GWFA 5EELA 1QCFA 4H34A 3VRZA 1O4IA 4XZ1A 3PSJA 3PQZA 4A4BA 2K7AB 4NWFA 4LUDA 1QADA 2KK6A 2Y3AB 2EKXA 1BF5A 2PLEA 3IMJA 4U17A 3VRNA 5HKZA 1P13A 1K9AA 1SHBA 3OV1A 1AYAA 3CXLA 1QG1E 1O42A 1UURA 3OB2B 4EY0A 1D4TA 3C7IA 4K45A 3BUNB 2Y1NA 1B47A 1MW4A 4NWGA 1LCJA 1O49A 1OO4A 1AB2A 2RORA 3IMDA 3VRPA 2HUWA 2CRHA 4ROJA 1TCEA 2MC1A 3TKZA 1O4LA 2L3TA 1LKLA 4H1OA 1O4DA 4OHIA 2H8HA 2C9WA 4GL9E 2BBUA 5EHPA 1O4AA 1AOUF 1OPKA 1BKLA 2EOBA 4K44A 1LUMA 3TL0A 1A07A 1O47A 2EO3A 2EYVA 2LCTA 2FO0A 1O4HA 3IN8A 3HHMB 1BFIA 1O4NA 1FBZA 3N84A 2HDXA 5BO4A 2DM0A 2PNBA 1OO3A 2LNXA 1LKKA 5EEQA 3S9KA 4OHHA 3T04A 1UUSA 2AOBA 1YVLA 1AYBA 1AD5A 3VS5A 1AOTF 3PJPA 1BM2A 3CBLA 1RPYA 1RJAA 1JWOA 5J3XA 5EG3B 1BFJA 2CI9A 3VS4A 1BLKA 1O4OA 3MXCA 2YSXA 1R1SA 1M61A 2IUIA 5AXIA 1O4CA 2KNOA
chains in the Genus database with same CATH superfamily
1R1QA 5D0JA 1O4QA 1XA6A 1TZEE 5IBSA 2ETZA 4A4CA 1LUKA 5I6VA 2OZOA 1H9OA 1HCSB 2JYQA 2DCRA 4OHEA 4D8KA 1RQQC 2IZVA 4QSYA 1KA6A 3VS1A 4FBNA 2LQWA 2SRCA 1BLJA 2C0IA 3QWYA 5DC4A 1O4BA 1BHFA 4F5AA 3PLFB 1A81A 1IJRA 1A1BA 2EU0A 1O4RA 1FHSA 2HMHA 2CI8A 3EAZA 3UF4A 3CWGA 3VS6A 1CSYA 4FL2A 3BUWB 4K11A 3N8MA 3BKBA 1Z3KA 3KFJA 2LNWA 5HKYA 2CS0A 2C0TA 3HIZB 5DC9A 1FBVA 1NRVA 1PICA 2SHPA 4LUEA 1BHHA 1BMBA 2EYYA 1O41A 1ZFPE 1CWEA 2IUHA 4OHDA 2EL8A 1CWDL 1KA7A 4P9VA 3QWXX 3VS3A 2ABLA 1FMKA 2L6KA 2AUGA 4E68A 1F1WA 5IBMA 1AYCA 1SKJA 4M4ZA 2HDVA 2AOAA 1M27A 3OVEA 5AULA 3VROA 2RVFA 3OP0A 1OPLA 1O44A 2EO6A 2C0OA 1LUNA 1NZVA 3S8LA 4E93A 1D4WA 1O4KA 4L1BB 1JU5A 1A09A 3EACA 1X6CA 3BUMB 1SPRA 3GXWA 1GRIA 1A1EA 1O4GA 3WA4A 1KSWA 2GSBA 1A08A 2LRAA 3OB1B 5KAZA 1SHAA 1O4EA 2PLDA 3BUOB 1IS0A 1HCTB 2HCKA 1O4MA 3GXXA 1O45A 4X6SA 1A1AA 3PSKA 2L4KA 1O46A 3VS2A 3K2TA 3ZNIA 1A1CA 1I3ZA 4JE4A 1WQUA 2RMXA 2FCIA 3HCKA 1GHUA 2MRKA 2LQNA 3PS5A 4WWQA 2YU7A 2VIFA 2B3OA 3MAZA 4XZ0A 3VRRA 1BG1A 3M7FA 2MRJA 2PTKA 1Y1UA 4F5BA 4JEGA 3VRYA 1O48A 3VS7A 1CJ1A 1O43A 2CR4A 1O4JA 1O4FA 1NZLA 5GJIA 1CSZA 1LCKA 1O4PA 1JYQA 1FU6A 3NHNA 1JYUA 4FL3A 1MILA 2OQ1A 2ECDA 2DLZA 2H46E 2H5KA 2CBLA 5CDWA 5GJHA 4EIHA 1X0NA 2XP1A 2DX0A 1LUIA 3UYOA 1SPSA 5HKWA 2IUGA 1KC2A 4GPLB 4U1PA 2GE9A 3PFVA 2MK2A 3VRQA 3MXYA 4F59A 2DLYA 1SHDA 1R1PA 3BUXB 1YVHA 2QMSA 3CD3A 4P9ZA 1JYRA 1BKMA 1FYRA 3S8NA 3K2MA 1F2FA 2EYZA 2DVJA 1AYDA 3VGOA 1G83A 1BHHB 2CIAA 1D1ZA 3S8OA 4OHLA 2RSYA 3US4A 3GQIB 3IN7A 2Y1MA 3VS0A 4JGHA 4DGPA 5DF6A 1X27A 1FU5A 2MQIA 4K2RA 5DC0B 3N7YA 5EHRA 1Y57A 2K79B 4DGXA 2PNAA 4TZIA 4GWFA 5EELA 1QCFA 4H34A 3VRZA 1O4IA 4XZ1A 3PSJA 3PQZA 4A4BA 2K7AB 4NWFA 4LUDA 1QADA 2KK6A 2Y3AB 2EKXA 1BF5A 2PLEA 3IMJA 4U17A 3VRNA 5HKZA 1P13A 1K9AA 1SHBA 3OV1A 1AYAA 3CXLA 1QG1E 1O42A 1UURA 3OB2B 4EY0A 1D4TA 3C7IA 4K45A 3BUNB 2Y1NA 1B47A 1MW4A 4NWGA 1LCJA 1O49A 1OO4A 1AB2A 2RORA 3IMDA 3VRPA 2HUWA 2CRHA 4ROJA 1TCEA 2MC1A 3TKZA 1O4LA 2L3TA 1LKLA 4H1OA 1O4DA 4OHIA 2H8HA 2C9WA 4GL9E 2BBUA 3LYVA 5EHPA 1O4AA 1AOUF 1OPKA 1BKLA 2EOBA 4K44A 1LUMA 3TL0A 1A07A 1O47A 2EO3A 2EYVA 2LCTA 2FO0A 1O4HA 3IN8A 3HHMB 1BFIA 1O4NA 1FBZA 3N84A 2HDXA 5BO4A 2DM0A 2PNBA 1OO3A 2LNXA 1LKKA 5EEQA 3S9KA 4OHHA 3T04A 2KGYA 1UUSA 2AOBA 1YVLA 1AYBA 1AD5A 3VS5A 1AOTF 3PJPA 1BM2A 3CBLA 1RPYA 1RJAA 1JWOA 5J3XA 5EG3B 1BFJA 2CI9A 3VS4A 1BLKA 1O4OA 3MXCA 2YSXA 1R1SA 1M61A 2IUIA 5AXIA 1O4CA 2KNOA
chains in the Genus database with same CATH topology
1R1QA 5D0JA 1O4QA 1XA6A 1TZEE 5IBSA 2ETZA 4A4CA 1LUKA 5I6VA 2OZOA 1H9OA 1HCSB 2JYQA 2DCRA 4OHEA 4D8KA 1RQQC 2IZVA 4QSYA 1KA6A 3VS1A 4FBNA 2LQWA 2SRCA 1BLJA 2C0IA 3QWYA 5DC4A 1O4BA 1BHFA 4F5AA 3PLFB 1A81A 1IJRA 1A1BA 2EU0A 1O4RA 1FHSA 2HMHA 2CI8A 3EAZA 3UF4A 3CWGA 3VS6A 1CSYA 4FL2A 3BUWB 4K11A 3N8MA 3BKBA 1Z3KA 3KFJA 2LNWA 5HKYA 2CS0A 2C0TA 3HIZB 5DC9A 1FBVA 1NRVA 1PICA 2SHPA 4LUEA 1BHHA 1BMBA 2EYYA 1O41A 1ZFPE 1CWEA 2IUHA 4OHDA 2EL8A 1CWDL 1KA7A 4P9VA 3QWXX 3VS3A 2ABLA 1FMKA 2L6KA 2AUGA 4E68A 1F1WA 5IBMA 1AYCA 1SKJA 4M4ZA 2HDVA 2AOAA 1M27A 3OVEA 5AULA 3VROA 2RVFA 3OP0A 1OPLA 1O44A 2EO6A 2C0OA 1LUNA 1NZVA 3S8LA 4E93A 1D4WA 1O4KA 4L1BB 1JU5A 1A09A 3EACA 1X6CA 3BUMB 1SPRA 3GXWA 1GRIA 1A1EA 1O4GA 3WA4A 1KSWA 2GSBA 1A08A 3OB1B 5KAZA 1SHAA 1O4EA 2PLDA 3BUOB 1IS0A 1HCTB 2HCKA 1O4MA 3GXXA 1O45A 4X6SA 1A1AA 3PSKA 2L4KA 1O46A 3VS2A 3ZNIA 1A1CA 1I3ZA 4JE4A 1WQUA 2RMXA 2FCIA 3HCKA 1GHUA 2MRKA 2LQNA 3PS5A 4WWQA 2YU7A 2VIFA 2B3OA 3MAZA 4XZ0A 3VRRA 1BG1A 3M7FA 2MRJA 2PTKA 1Y1UA 4F5BA 4JEGA 3VRYA 1O48A 3VS7A 1CJ1A 1O43A 2CR4A 1O4JA 1O4FA 1NZLA 5GJIA 1CSZA 1LCKA 1O4PA 1JYQA 1FU6A 3NHNA 1JYUA 4FL3A 1MILA 2OQ1A 2ECDA 2DLZA 2H46E 2H5KA 2CBLA 5CDWA 5GJHA 4EIHA 1X0NA 2XP1A 2DX0A 1LUIA 3UYOA 1SPSA 5HKWA 2IUGA 1KC2A 4GPLB 4U1PA 2GE9A 3PFVA 2MK2A 3VRQA 3MXYA 4F59A 2DLYA 1SHDA 1R1PA 3BUXB 1YVHA 2QMSA 3CD3A 4P9ZA 1JYRA 1BKMA 1FYRA 3S8NA 3K2MA 1F2FA 2EYZA 2DVJA 1AYDA 3VGOA 1G83A 1BHHB 2CIAA 1D1ZA 3S8OA 4OHLA 2RSYA 3US4A 3GQIB 3IN7A 2Y1MA 3VS0A 4JGHA 4DGPA 5DF6A 1X27A 1FU5A 2MQIA 4K2RA 5DC0B 3N7YA 5EHRA 1Y57A 2K79B 4DGXA 2PNAA 4TZIA 4GWFA 5EELA 1QCFA 4H34A 3VRZA 1O4IA 4XZ1A 3PSJA 3PQZA 4A4BA 2K7AB 4NWFA 4LUDA 1QADA 2KK6A 2Y3AB 2EKXA 1BF5A 2PLEA 3IMJA 4U17A 3VRNA 5HKZA 1P13A 1K9AA 1SHBA 3OV1A 1AYAA 3CXLA 1QG1E 1O42A 1UURA 3OB2B 4EY0A 1D4TA 3C7IA 4K45A 3BUNB 2Y1NA 1B47A 1MW4A 4NWGA 1LCJA 1O49A 1OO4A 1AB2A 2RORA 3IMDA 3VRPA 2HUWA 2CRHA 4ROJA 1TCEA 2MC1A 3TKZA 1O4LA 2L3TA 1LKLA 4H1OA 1O4DA 4OHIA 2H8HA 2C9WA 4GL9E 2BBUA 5EHPA 1O4AA 1AOUF 1OPKA 1BKLA 2EOBA 4K44A 1LUMA 3TL0A 1A07A 1O47A 2EO3A 2EYVA 2LCTA 2FO0A 1O4HA 3IN8A 3HHMB 1BFIA 1O4NA 1FBZA 3N84A 2HDXA 5BO4A 2DM0A 2PNBA 1OO3A 2LNXA 1LKKA 5EEQA 3S9KA 4OHHA 3T04A 1UUSA 2AOBA 1YVLA 1AYBA 1AD5A 3VS5A 1AOTF 3PJPA 1BM2A 3CBLA 1RPYA 1RJAA 1JWOA 5J3XA 5EG3B 1BFJA 2CI9A 3VS4A 1BLKA 1O4OA 3MXCA 2YSXA 1R1SA 1M61A 2IUIA 5AXIA 1O4CA 2KNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R1Q A;  5D0J A;  1O4Q A;  1XA6 A;  1TZE E;  5IBS A;  2ETZ A;  4A4C A;  1LUK A;  5I6V A;  2OZO A;  1H9O A;  1HCS B;  2JYQ A;  2DCR A;  4OHE A;  4D8K A;  1RQQ C;  2IZV A;  4QSY A;  1KA6 A;  3VS1 A;  4FBN A;  2LQW A;  2SRC A;  1BLJ A;  2C0I A;  3QWY A;  5DC4 A;  1O4B A;  1BHF A;  4F5A A;  3PLF B;  1A81 A;  1IJR A;  1A1B A;  2EU0 A;  1O4R A;  1FHS A;  2HMH A;  2CI8 A;  3EAZ A;  3UF4 A;  3CWG A;  3VS6 A;  1CSY A;  4FL2 A;  3BUW B;  4K11 A;  3N8M A;  3BKB A;  1Z3K A;  3KFJ A;  2LNW A;  5HKY A;  2CS0 A;  2C0T A;  3HIZ B;  5DC9 A;  1FBV A;  1NRV A;  1PIC A;  2SHP A;  4LUE A;  1BHH A;  1BMB A;  2EYY A;  1O41 A;  1ZFP E;  1CWE A;  2IUH A;  4OHD A;  2EL8 A;  1CWD L;  1KA7 A;  4P9V A;  3QWX X;  3VS3 A;  2ABL A;  1FMK A;  2L6K A;  2AUG A;  4E68 A;  1F1W A;  5IBM A;  1AYC A;  1SKJ A;  4M4Z A;  2HDV A;  2AOA A;  1M27 A;  3OVE A;  5AUL A;  3VRO A;  2RVF A;  3OP0 A;  1OPL A;  1O44 A;  2EO6 A;  2C0O A;  1LUN A;  1NZV A;  3S8L A;  4E93 A;  1D4W A;  1O4K A;  4L1B B;  1JU5 A;  1A09 A;  3EAC A;  1X6C A;  3BUM B;  1SPR A;  3GXW A;  1GRI A;  1A1E A;  1O4G A;  3WA4 A;  1KSW A;  2GSB A;  1A08 A;  3OB1 B;  5KAZ A;  1SHA A;  1O4E A;  2PLD A;  3BUO B;  1IS0 A;  1HCT B;  2HCK A;  1O4M A;  3GXX A;  1O45 A;  4X6S A;  1A1A A;  3PSK A;  2L4K A;  1O46 A;  3VS2 A;  3ZNI A;  1A1C A;  1I3Z A;  4JE4 A;  1WQU A;  2RMX A;  2FCI A;  3HCK A;  1GHU A;  2MRK A;  2LQN A;  3PS5 A;  4WWQ A;  2YU7 A;  2VIF A;  2B3O A;  3MAZ A;  4XZ0 A;  3VRR A;  1BG1 A;  3M7F A;  2MRJ A;  2PTK A;  1Y1U A;  4F5B A;  4JEG A;  3VRY A;  1O48 A;  3VS7 A;  1CJ1 A;  1O43 A;  2CR4 A;  1O4J A;  1O4F A;  1NZL A;  5GJI A;  1CSZ A;  1LCK A;  1O4P A;  1JYQ A;  1FU6 A;  3NHN A;  1JYU A;  4FL3 A;  1MIL A;  2OQ1 A;  2ECD A;  2DLZ A;  2H46 E;  2H5K A;  2CBL A;  5CDW A;  5GJH A;  4EIH A;  1X0N A;  2XP1 A;  2DX0 A;  1LUI A;  3UYO A;  1SPS A;  5HKW A;  2IUG A;  1KC2 A;  4GPL B;  4U1P A;  2GE9 A;  3PFV A;  2MK2 A;  3VRQ A;  3MXY A;  4F59 A;  2DLY A;  1SHD A;  1R1P A;  3BUX B;  1YVH A;  2QMS A;  3CD3 A;  4P9Z A;  1JYR A;  1BKM A;  1FYR A;  3S8N A;  3K2M A;  1F2F A;  2EYZ A;  2DVJ A;  1AYD A;  3VGO A;  1G83 A;  1BHH B;  2CIA A;  1D1Z A;  3S8O A;  4OHL A;  2RSY A;  3US4 A;  3GQI B;  3IN7 A;  2Y1M A;  3VS0 A;  4JGH A;  4DGP A;  5DF6 A;  1X27 A;  1FU5 A;  2MQI A;  4K2R A;  5DC0 B;  3N7Y A;  5EHR A;  1Y57 A;  2K79 B;  4DGX A;  2PNA A;  4TZI A;  4GWF A;  5EEL A;  1QCF A;  4H34 A;  3VRZ A;  1O4I A;  4XZ1 A;  3PSJ A;  3PQZ A;  4A4B A;  2K7A B;  4NWF A;  4LUD A;  1QAD A;  2KK6 A;  2Y3A B;  2EKX A;  1BF5 A;  2PLE A;  3IMJ A;  4U17 A;  3VRN A;  5HKZ A;  1P13 A;  1K9A A;  1SHB A;  3OV1 A;  1AYA A;  3CXL A;  1QG1 E;  1O42 A;  1UUR A;  3OB2 B;  4EY0 A;  1D4T A;  3C7I A;  4K45 A;  3BUN B;  2Y1N A;  1B47 A;  1MW4 A;  4NWG A;  1LCJ A;  1O49 A;  1OO4 A;  1AB2 A;  2ROR A;  3IMD A;  3VRP A;  2HUW A;  2CRH A;  4ROJ A;  1TCE A;  2MC1 A;  3TKZ A;  1O4L A;  2L3T A;  1LKL A;  4H1O A;  1O4D A;  4OHI A;  2H8H A;  2C9W A;  4GL9 E;  2BBU A;  5EHP A;  1O4A A;  1AOU F;  1OPK A;  1BKL A;  2EOB A;  4K44 A;  1LUM A;  3TL0 A;  1A07 A;  1O47 A;  2EO3 A;  2EYV A;  2LCT A;  2FO0 A;  1O4H A;  3IN8 A;  3HHM B;  1BFI A;  1O4N A;  1FBZ A;  3N84 A;  2HDX A;  5BO4 A;  2DM0 A;  2PNB A;  1OO3 A;  2LNX A;  1LKK A;  5EEQ A;  3S9K A;  4OHH A;  3T04 A;  1UUS A;  2AOB A;  1YVL A;  1AYB A;  1AD5 A;  3VS5 A;  1AOT F;  3PJP A;  1BM2 A;  3CBL A;  1RPY A;  1RJA A;  1JWO A;  5J3X A;  5EG3 B;  1BFJ A;  2CI9 A;  3VS4 A;  1BLK A;  1O4O A;  3MXC A;  2YSX A;  1R1S A;  1M61 A;  2IUI A;  5AXI A;  1O4C A;  2KNO A; 
#chains in the Genus database with same CATH topology
 1R1Q A;  5D0J A;  1O4Q A;  1XA6 A;  1TZE E;  5IBS A;  2ETZ A;  4A4C A;  1LUK A;  5I6V A;  2OZO A;  1H9O A;  1HCS B;  2JYQ A;  2DCR A;  4OHE A;  4D8K A;  1RQQ C;  2IZV A;  4QSY A;  1KA6 A;  3VS1 A;  4FBN A;  2LQW A;  2SRC A;  1BLJ A;  2C0I A;  3QWY A;  5DC4 A;  1O4B A;  1BHF A;  4F5A A;  3PLF B;  1A81 A;  1IJR A;  1A1B A;  2EU0 A;  1O4R A;  1FHS A;  2HMH A;  2CI8 A;  3EAZ A;  3UF4 A;  3CWG A;  3VS6 A;  1CSY A;  4FL2 A;  3BUW B;  4K11 A;  3N8M A;  3BKB A;  1Z3K A;  3KFJ A;  2LNW A;  5HKY A;  2CS0 A;  2C0T A;  3HIZ B;  5DC9 A;  1FBV A;  1NRV A;  1PIC A;  2SHP A;  4LUE A;  1BHH A;  1BMB A;  2EYY A;  1O41 A;  1ZFP E;  1CWE A;  2IUH A;  4OHD A;  2EL8 A;  1CWD L;  1KA7 A;  4P9V A;  3QWX X;  3VS3 A;  2ABL A;  1FMK A;  2L6K A;  2AUG A;  4E68 A;  1F1W A;  5IBM A;  1AYC A;  1SKJ A;  4M4Z A;  2HDV A;  2AOA A;  1M27 A;  3OVE A;  5AUL A;  3VRO A;  2RVF A;  3OP0 A;  1OPL A;  1O44 A;  2EO6 A;  2C0O A;  1LUN A;  1NZV A;  3S8L A;  4E93 A;  1D4W A;  1O4K A;  4L1B B;  1JU5 A;  1A09 A;  3EAC A;  1X6C A;  3BUM B;  1SPR A;  3GXW A;  1GRI A;  1A1E A;  1O4G A;  3WA4 A;  1KSW A;  2GSB A;  1A08 A;  2LRA A;  3OB1 B;  5KAZ A;  1SHA A;  1O4E A;  2PLD A;  3BUO B;  1IS0 A;  1HCT B;  2HCK A;  1O4M A;  3GXX A;  1O45 A;  4X6S A;  1A1A A;  3PSK A;  2L4K A;  1O46 A;  3VS2 A;  3K2T A;  3ZNI A;  1A1C A;  1I3Z A;  4JE4 A;  1WQU A;  2RMX A;  2FCI A;  3HCK A;  1GHU A;  2MRK A;  2LQN A;  3PS5 A;  4WWQ A;  2YU7 A;  2VIF A;  2B3O A;  3MAZ A;  4XZ0 A;  3VRR A;  1BG1 A;  3M7F A;  2MRJ A;  2PTK A;  1Y1U A;  4F5B A;  4JEG A;  3VRY A;  1O48 A;  3VS7 A;  1CJ1 A;  1O43 A;  2CR4 A;  1O4J A;  1O4F A;  1NZL A;  5GJI A;  1CSZ A;  1LCK A;  1O4P A;  1JYQ A;  1FU6 A;  3NHN A;  1JYU A;  4FL3 A;  1MIL A;  2OQ1 A;  2ECD A;  2DLZ A;  2H46 E;  2H5K A;  2CBL A;  5CDW A;  5GJH A;  4EIH A;  1X0N A;  2XP1 A;  2DX0 A;  1LUI A;  3UYO A;  1SPS A;  5HKW A;  2IUG A;  1KC2 A;  4GPL B;  4U1P A;  2GE9 A;  3PFV A;  2MK2 A;  3VRQ A;  3MXY A;  4F59 A;  2DLY A;  1SHD A;  1R1P A;  3BUX B;  1YVH A;  2QMS A;  3CD3 A;  4P9Z A;  1JYR A;  1BKM A;  1FYR A;  3S8N A;  3K2M A;  1F2F A;  2EYZ A;  2DVJ A;  1AYD A;  3VGO A;  1G83 A;  1BHH B;  2CIA A;  1D1Z A;  3S8O A;  4OHL A;  2RSY A;  3US4 A;  3GQI B;  3IN7 A;  2Y1M A;  3VS0 A;  4JGH A;  4DGP A;  5DF6 A;  1X27 A;  1FU5 A;  2MQI A;  4K2R A;  5DC0 B;  3N7Y A;  5EHR A;  1Y57 A;  2K79 B;  4DGX A;  2PNA A;  4TZI A;  4GWF A;  5EEL A;  1QCF A;  4H34 A;  3VRZ A;  1O4I A;  4XZ1 A;  3PSJ A;  3PQZ A;  4A4B A;  2K7A B;  4NWF A;  4LUD A;  1QAD A;  2KK6 A;  2Y3A B;  2EKX A;  1BF5 A;  2PLE A;  3IMJ A;  4U17 A;  3VRN A;  5HKZ A;  1P13 A;  1K9A A;  1SHB A;  3OV1 A;  1AYA A;  3CXL A;  1QG1 E;  1O42 A;  1UUR A;  3OB2 B;  4EY0 A;  1D4T A;  3C7I A;  4K45 A;  3BUN B;  2Y1N A;  1B47 A;  1MW4 A;  4NWG A;  1LCJ A;  1O49 A;  1OO4 A;  1AB2 A;  2ROR A;  3IMD A;  3VRP A;  2HUW A;  2CRH A;  4ROJ A;  1TCE A;  2MC1 A;  3TKZ A;  1O4L A;  2L3T A;  1LKL A;  4H1O A;  1O4D A;  4OHI A;  2H8H A;  2C9W A;  4GL9 E;  2BBU A;  3LYV A;  5EHP A;  1O4A A;  1AOU F;  1OPK A;  1BKL A;  2EOB A;  4K44 A;  1LUM A;  3TL0 A;  1A07 A;  1O47 A;  2EO3 A;  2EYV A;  2LCT A;  2FO0 A;  1O4H A;  3IN8 A;  3HHM B;  1BFI A;  1O4N A;  1FBZ A;  3N84 A;  2HDX A;  5BO4 A;  2DM0 A;  2PNB A;  1OO3 A;  2LNX A;  1LKK A;  5EEQ A;  3S9K A;  4OHH A;  3T04 A;  2KGY A;  1UUS A;  2AOB A;  1YVL A;  1AYB A;  1AD5 A;  3VS5 A;  1AOT F;  3PJP A;  1BM2 A;  3CBL A;  1RPY A;  1RJA A;  1JWO A;  5J3X A;  5EG3 B;  1BFJ A;  2CI9 A;  3VS4 A;  1BLK A;  1O4O A;  3MXC A;  2YSX A;  1R1S A;  1M61 A;  2IUI A;  5AXI A;  1O4C A;  2KNO A; 
#chains in the Genus database with same CATH homology
 1R1Q A;  5D0J A;  1O4Q A;  1XA6 A;  1TZE E;  5IBS A;  2ETZ A;  4A4C A;  1LUK A;  5I6V A;  2OZO A;  1H9O A;  1HCS B;  2JYQ A;  2DCR A;  4OHE A;  4D8K A;  1RQQ C;  2IZV A;  4QSY A;  1KA6 A;  3VS1 A;  4FBN A;  2LQW A;  2SRC A;  1BLJ A;  2C0I A;  3QWY A;  5DC4 A;  1O4B A;  1BHF A;  4F5A A;  3PLF B;  1A81 A;  1IJR A;  1A1B A;  2EU0 A;  1O4R A;  1FHS A;  2HMH A;  2CI8 A;  3EAZ A;  3UF4 A;  3CWG A;  3VS6 A;  1CSY A;  4FL2 A;  3BUW B;  4K11 A;  3N8M A;  3BKB A;  1Z3K A;  3KFJ A;  2LNW A;  5HKY A;  2CS0 A;  2C0T A;  3HIZ B;  5DC9 A;  1FBV A;  1NRV A;  1PIC A;  2SHP A;  4LUE A;  1BHH A;  1BMB A;  2EYY A;  1O41 A;  1ZFP E;  1CWE A;  2IUH A;  4OHD A;  2EL8 A;  1CWD L;  1KA7 A;  4P9V A;  3QWX X;  3VS3 A;  2ABL A;  1FMK A;  2L6K A;  2AUG A;  4E68 A;  1F1W A;  5IBM A;  1AYC A;  1SKJ A;  4M4Z A;  2HDV A;  2AOA A;  1M27 A;  3OVE A;  5AUL A;  3VRO A;  2RVF A;  3OP0 A;  1OPL A;  1O44 A;  2EO6 A;  2C0O A;  1LUN A;  1NZV A;  3S8L A;  4E93 A;  1D4W A;  1O4K A;  4L1B B;  1JU5 A;  1A09 A;  3EAC A;  1X6C A;  3BUM B;  1SPR A;  3GXW A;  1GRI A;  1A1E A;  1O4G A;  3WA4 A;  1KSW A;  2GSB A;  1A08 A;  3OB1 B;  5KAZ A;  1SHA A;  1O4E A;  2PLD A;  3BUO B;  1IS0 A;  1HCT B;  2HCK A;  1O4M A;  3GXX A;  1O45 A;  4X6S A;  1A1A A;  3PSK A;  2L4K A;  1O46 A;  3VS2 A;  3ZNI A;  1A1C A;  1I3Z A;  4JE4 A;  1WQU A;  2RMX A;  2FCI A;  3HCK A;  1GHU A;  2MRK A;  2LQN A;  3PS5 A;  4WWQ A;  2YU7 A;  2VIF A;  2B3O A;  3MAZ A;  4XZ0 A;  3VRR A;  1BG1 A;  3M7F A;  2MRJ A;  2PTK A;  1Y1U A;  4F5B A;  4JEG A;  3VRY A;  1O48 A;  3VS7 A;  1CJ1 A;  1O43 A;  2CR4 A;  1O4J A;  1O4F A;  1NZL A;  5GJI A;  1CSZ A;  1LCK A;  1O4P A;  1JYQ A;  1FU6 A;  3NHN A;  1JYU A;  4FL3 A;  1MIL A;  2OQ1 A;  2ECD A;  2DLZ A;  2H46 E;  2H5K A;  2CBL A;  5CDW A;  5GJH A;  4EIH A;  1X0N A;  2XP1 A;  2DX0 A;  1LUI A;  3UYO A;  1SPS A;  5HKW A;  2IUG A;  1KC2 A;  4GPL B;  4U1P A;  2GE9 A;  3PFV A;  2MK2 A;  3VRQ A;  3MXY A;  4F59 A;  2DLY A;  1SHD A;  1R1P A;  3BUX B;  1YVH A;  2QMS A;  3CD3 A;  4P9Z A;  1JYR A;  1BKM A;  1FYR A;  3S8N A;  3K2M A;  1F2F A;  2EYZ A;  2DVJ A;  1AYD A;  3VGO A;  1G83 A;  1BHH B;  2CIA A;  1D1Z A;  3S8O A;  4OHL A;  2RSY A;  3US4 A;  3GQI B;  3IN7 A;  2Y1M A;  3VS0 A;  4JGH A;  4DGP A;  5DF6 A;  1X27 A;  1FU5 A;  2MQI A;  4K2R A;  5DC0 B;  3N7Y A;  5EHR A;  1Y57 A;  2K79 B;  4DGX A;  2PNA A;  4TZI A;  4GWF A;  5EEL A;  1QCF A;  4H34 A;  3VRZ A;  1O4I A;  4XZ1 A;  3PSJ A;  3PQZ A;  4A4B A;  2K7A B;  4NWF A;  4LUD A;  1QAD A;  2KK6 A;  2Y3A B;  2EKX A;  1BF5 A;  2PLE A;  3IMJ A;  4U17 A;  3VRN A;  5HKZ A;  1P13 A;  1K9A A;  1SHB A;  3OV1 A;  1AYA A;  3CXL A;  1QG1 E;  1O42 A;  1UUR A;  3OB2 B;  4EY0 A;  1D4T A;  3C7I A;  4K45 A;  3BUN B;  2Y1N A;  1B47 A;  1MW4 A;  4NWG A;  1LCJ A;  1O49 A;  1OO4 A;  1AB2 A;  2ROR A;  3IMD A;  3VRP A;  2HUW A;  2CRH A;  4ROJ A;  1TCE A;  2MC1 A;  3TKZ A;  1O4L A;  2L3T A;  1LKL A;  4H1O A;  1O4D A;  4OHI A;  2H8H A;  2C9W A;  4GL9 E;  2BBU A;  5EHP A;  1O4A A;  1AOU F;  1OPK A;  1BKL A;  2EOB A;  4K44 A;  1LUM A;  3TL0 A;  1A07 A;  1O47 A;  2EO3 A;  2EYV A;  2LCT A;  2FO0 A;  1O4H A;  3IN8 A;  3HHM B;  1BFI A;  1O4N A;  1FBZ A;  3N84 A;  2HDX A;  5BO4 A;  2DM0 A;  2PNB A;  1OO3 A;  2LNX A;  1LKK A;  5EEQ A;  3S9K A;  4OHH A;  3T04 A;  1UUS A;  2AOB A;  1YVL A;  1AYB A;  1AD5 A;  3VS5 A;  1AOT F;  3PJP A;  1BM2 A;  3CBL A;  1RPY A;  1RJA A;  1JWO A;  5J3X A;  5EG3 B;  1BFJ A;  2CI9 A;  3VS4 A;  1BLK A;  1O4O A;  3MXC A;  2YSX A;  1R1S A;  1M61 A;  2IUI A;  5AXI A;  1O4C A;  2KNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...