4U1PA

Human fyn-sh2 domain in complex with a synthetic high-affinity phospho-peptide
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
105
Chain Sequence
HHSSMEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human Fyn-SH2 domain in complex with a synthetic high-affinity phospho-peptide
rcsb
molecule keywords Tyrosine-protein kinase Fyn
molecule tags Transferase
source organism Homo sapiens
total genus 26
structure length 105
sequence length 113
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4u1pA00
1BHHA 3VRNA 1LUMA 1BLKA 1SPRA 2EYZA 3UYOA 4EIHA 4XZ0A 3MXCA 3BKBA 1R1PA 1LUKA 1SHDA 1X27A 1GHUA 3EACA 4TZIA 4F5AA 1XA6A 1Y1UA 2AUGA 2FO0A 3K2MA 2CI8A 2LQWA 2IUIA 1BKLA 1A1BA 3TKZA 4P9ZA 2MRKA 2DLYA 4E68A 4H1OA 3N7YA 4D8KA 1G83A 3IN8A 1BHFA 1KSWA 1QADA 1AOUF 3QWXX 1RPYA 2H46E 3HCKA 4F5BA 1KA6A 1D4TA 1A1EA 3KFJA 5HKZA 1SKJA 1LKLA 1LCKA 3BUMB 3GQIB 2ABLA 5CDWA 3S8OA 1A08A 1FMKA 1O42A 5HKYA 2JYQA 1JYQA 1O4KA 2SRCA 3S8NA 3MXYA 1O4NA 1SHBA 2L6KA 5GJIA 1O48A 2PLDA 1KC2A 4U1PA 1D4WA 2EU0A 3OV1A 1AD5A 1TZEE 4DGPA 1O4BA 1O4QA 4X6SA 1UURA 1O4OA 1R1SA 1GRIA 1R1QA 2EYYA 3ZNIA 4FBNA 1RQQC 2GE9A 2VIFA 1FU6A 4OHEA 1K9AA 1QCFA 3GXXA 2EO6A 1HCTB 2EL8A 3IMDA 1LUNA 4JEGA 1O4MA 2Y3AB 5EELA 1NZLA 3VS3A 3CXLA 2C0OA 3OB2B 1O46A 1A81A 3OB1B 5KAZA 3HIZB 3VS0A 4E93A 1CSYA 4K11A 1FYRA 1O4DA 5DC9A 3US4A 1PICA 4A4CA 4ROJA 5AULA 2PNBA 1M27A 1O44A 5J3XA 2DVJA 1BFIA 2AOBA 1O4JA 1WQUA 4K2RA 3VRQA 2Y1NA 3VROA 4K45A 1O4IA 2IZVA 2LNWA 1O49A 3VRZA 1JWOA 1JYRA 4LUEA 1YVLA 2B3OA 4OHHA 3PFVA 1D1ZA 2EKXA 3VRYA 1O4RA 3N8MA 3N84A 5IBSA 1O4HA 3WA4A 1BG1A 5GJHA 2FCIA 3VS4A 3PJPA 1Y57A 2MC1A 1HCSB 4NWFA 5AXIA 2YSXA 4FL3A 3NHNA 1LKKA 5BO4A 1O4CA 3CD3A 3VS5A 1CWEA 3BUNB 1MW4A 2BBUA 2PLEA 1AYDA 2CIAA 4WWQA 2HMHA 3HHMB 4A4BA 3C7IA 2SHPA 1FBZA 2L3TA 1O43A 2RMXA 3UF4A 1SHAA 2LQNA 1O4FA 3OVEA 4LUDA 5EEQA 1OPLA 2CRHA 3EAZA 2RORA 1O4GA 1F2FA 2C9WA 1QG1E 2LNXA 1JYUA 1LCJA 5EG3B 3BUXB 3OP0A 4GWFA 4OHIA 2PTKA 3MAZA 3PQZA 1FBVA 2YU7A 4JGHA 2HUWA 4JE4A 1TCEA 2IUGA 1AYBA 3IMJA 2C0IA 1BLJA 2MRJA 1ZFPE 2HCKA 3IN7A 2EO3A 2EYVA 2MQIA 4U17A 4EY0A 2H8HA 1NRVA 4K44A 4DGXA 4H34A 2CI9A 2GSBA 1BF5A 4L1BB 1IJRA 2XP1A 1BMBA 2DCRA 1AOTF 3PS5A 5DC4A 1A1AA 4OHLA 3S8LA 2IUHA 3M7FA 1A09A 2RVFA 1I3ZA 1H9OA 1F1WA 1OO3A 1SPSA 2RSYA 3GXWA 5IBMA 1AYAA 1RJAA 3CWGA 2EOBA 1O41A 1LUIA 1O47A 5EHRA 3QWYA 3VS1A 1A07A 5D0JA 2K7AB 2LCTA 2QMSA 1AYCA 2OQ1A 3BUOB 1UUSA 2PNAA 5HKWA 3PSKA 5DC0B 4M4ZA 1O4LA 3PLFB 1FHSA 3VS2A 5I6VA 4FL2A 1AB2A 1KA7A 1B47A 1IS0A 4GL9E 5DF6A 1OPKA 3PSJA 3S9KA 3CBLA 2OZOA 1FU5A 1X6CA 2Y1MA 1BM2A 1A1CA 1P13A 2L4KA 4P9VA 1M61A 2AOAA 1OO4A 3VRRA 2H5KA 3BUWB 2DX0A 1MILA 1BKMA 4OHDA 3T04A 1BFJA 2ECDA 2CBLA 3VS7A 2KNOA 1O4PA 4NWGA 3VGOA 3VS6A 2K79B 2C0TA 1X0NA 3TL0A 5EHPA 2CR4A 2DLZA 3VRPA 2ETZA 2HDXA 1Z3KA 2HDVA 1NZVA 1BHHB 1CWDL 1CJ1A 2CS0A 2KK6A 1O4EA 1O45A 1YVHA 4XZ1A 1JU5A 4GPLB 4QSYA 4F59A 1O4AA 1CSZA 2MK2A 2DM0A
chains in the Genus database with same CATH superfamily
1BHHA 3VRNA 1LUMA 1BLKA 1SPRA 2EYZA 3UYOA 4EIHA 4XZ0A 3MXCA 3BKBA 1R1PA 1LUKA 1SHDA 1X27A 1GHUA 3EACA 4TZIA 4F5AA 1XA6A 1Y1UA 2AUGA 2FO0A 3K2MA 2CI8A 2LQWA 2IUIA 1BKLA 1A1BA 3TKZA 4P9ZA 2MRKA 2DLYA 4E68A 4H1OA 3N7YA 4D8KA 1G83A 3IN8A 1BHFA 1KSWA 1QADA 1AOUF 3QWXX 1RPYA 2H46E 3HCKA 4F5BA 1KA6A 1D4TA 1A1EA 3KFJA 5HKZA 1SKJA 1LKLA 1LCKA 3BUMB 3GQIB 2ABLA 5CDWA 3S8OA 1A08A 1FMKA 1O42A 5HKYA 2JYQA 1JYQA 1O4KA 2SRCA 3S8NA 3MXYA 1O4NA 1SHBA 2L6KA 5GJIA 1O48A 2PLDA 1KC2A 4U1PA 1D4WA 2EU0A 3OV1A 1AD5A 1TZEE 4DGPA 1O4BA 1O4QA 4X6SA 1UURA 1O4OA 1R1SA 1GRIA 1R1QA 2EYYA 3ZNIA 4FBNA 1RQQC 2GE9A 2VIFA 1FU6A 4OHEA 1K9AA 1QCFA 3GXXA 2EO6A 1HCTB 2EL8A 3IMDA 1LUNA 4JEGA 1O4MA 2Y3AB 5EELA 1NZLA 3VS3A 3CXLA 2C0OA 3OB2B 1O46A 1A81A 3OB1B 5KAZA 3HIZB 3VS0A 4E93A 1CSYA 4K11A 1FYRA 1O4DA 5DC9A 3US4A 1PICA 4A4CA 4ROJA 5AULA 2PNBA 1M27A 1O44A 5J3XA 2DVJA 1BFIA 2AOBA 1O4JA 1WQUA 4K2RA 3VRQA 2Y1NA 3VROA 4K45A 1O4IA 2IZVA 2LNWA 1O49A 3VRZA 1JWOA 1JYRA 4LUEA 1YVLA 2B3OA 4OHHA 3PFVA 1D1ZA 2EKXA 3VRYA 1O4RA 3N8MA 3N84A 5IBSA 1O4HA 3WA4A 1BG1A 5GJHA 2FCIA 3VS4A 3PJPA 1Y57A 2MC1A 1HCSB 4NWFA 5AXIA 2YSXA 4FL3A 3NHNA 1LKKA 5BO4A 1O4CA 3CD3A 3VS5A 1CWEA 3BUNB 1MW4A 2BBUA 2PLEA 1AYDA 2CIAA 4WWQA 2HMHA 3HHMB 4A4BA 3C7IA 2SHPA 1FBZA 2L3TA 1O43A 2RMXA 2LRAA 3UF4A 1SHAA 2LQNA 1O4FA 3OVEA 4LUDA 5EEQA 1OPLA 2CRHA 3EAZA 2RORA 1O4GA 1F2FA 2C9WA 1QG1E 2LNXA 1JYUA 1LCJA 5EG3B 3BUXB 3OP0A 4GWFA 4OHIA 2PTKA 3MAZA 3PQZA 1FBVA 2YU7A 4JGHA 2HUWA 4JE4A 1TCEA 2IUGA 3K2TA 1AYBA 3IMJA 2C0IA 1BLJA 2MRJA 1ZFPE 2HCKA 3IN7A 2EO3A 2EYVA 2MQIA 4U17A 4EY0A 2H8HA 1NRVA 4K44A 4DGXA 4H34A 2CI9A 2GSBA 1BF5A 4L1BB 1IJRA 2XP1A 1BMBA 2DCRA 1AOTF 3PS5A 5DC4A 1A1AA 4OHLA 3S8LA 2IUHA 3M7FA 1A09A 2RVFA 1I3ZA 1H9OA 1F1WA 1OO3A 1SPSA 2RSYA 3GXWA 5IBMA 1AYAA 1RJAA 3CWGA 2EOBA 1O41A 1LUIA 1O47A 5EHRA 3LYVA 3QWYA 3VS1A 1A07A 5D0JA 2K7AB 2LCTA 2QMSA 1AYCA 2OQ1A 3BUOB 1UUSA 2PNAA 5HKWA 3PSKA 5DC0B 4M4ZA 1O4LA 3PLFB 1FHSA 3VS2A 5I6VA 4FL2A 1AB2A 1KA7A 1B47A 1IS0A 4GL9E 5DF6A 1OPKA 3PSJA 3S9KA 3CBLA 2OZOA 1FU5A 1X6CA 2Y1MA 1BM2A 1A1CA 1P13A 2L4KA 4P9VA 1M61A 2AOAA 1OO4A 3VRRA 2H5KA 3BUWB 2DX0A 1MILA 1BKMA 4OHDA 3T04A 1BFJA 2ECDA 2CBLA 3VS7A 2KNOA 1O4PA 4NWGA 3VGOA 3VS6A 2KGYA 2K79B 2C0TA 1X0NA 3TL0A 5EHPA 2CR4A 2DLZA 3VRPA 2ETZA 2HDXA 1Z3KA 2HDVA 1NZVA 1BHHB 1CWDL 1CJ1A 2CS0A 2KK6A 1O4EA 1O45A 1YVHA 4XZ1A 1JU5A 4GPLB 4QSYA 4F59A 1O4AA 1CSZA 2MK2A 2DM0A
chains in the Genus database with same CATH topology
1BHHA 3VRNA 1LUMA 1BLKA 1SPRA 2EYZA 3UYOA 4EIHA 4XZ0A 3MXCA 3BKBA 1R1PA 1LUKA 1SHDA 1X27A 1GHUA 3EACA 4TZIA 4F5AA 1XA6A 1Y1UA 2AUGA 2FO0A 3K2MA 2CI8A 2LQWA 2IUIA 1BKLA 1A1BA 3TKZA 4P9ZA 2MRKA 2DLYA 4E68A 4H1OA 3N7YA 4D8KA 1G83A 3IN8A 1BHFA 1KSWA 1QADA 1AOUF 3QWXX 1RPYA 2H46E 3HCKA 4F5BA 1KA6A 1D4TA 1A1EA 3KFJA 5HKZA 1SKJA 1LKLA 1LCKA 3BUMB 3GQIB 2ABLA 5CDWA 3S8OA 1A08A 1FMKA 1O42A 5HKYA 2JYQA 1JYQA 1O4KA 2SRCA 3S8NA 3MXYA 1O4NA 1SHBA 2L6KA 5GJIA 1O48A 2PLDA 1KC2A 4U1PA 1D4WA 2EU0A 3OV1A 1AD5A 1TZEE 4DGPA 1O4BA 1O4QA 4X6SA 1UURA 1O4OA 1R1SA 1GRIA 1R1QA 2EYYA 3ZNIA 4FBNA 1RQQC 2GE9A 2VIFA 1FU6A 4OHEA 1K9AA 1QCFA 3GXXA 2EO6A 1HCTB 2EL8A 3IMDA 1LUNA 4JEGA 1O4MA 2Y3AB 5EELA 1NZLA 3VS3A 3CXLA 2C0OA 3OB2B 1O46A 1A81A 3OB1B 5KAZA 3HIZB 3VS0A 4E93A 1CSYA 4K11A 1FYRA 1O4DA 5DC9A 3US4A 1PICA 4A4CA 4ROJA 5AULA 2PNBA 1M27A 1O44A 5J3XA 2DVJA 1BFIA 2AOBA 1O4JA 1WQUA 4K2RA 3VRQA 2Y1NA 3VROA 4K45A 1O4IA 2IZVA 2LNWA 1O49A 3VRZA 1JWOA 1JYRA 4LUEA 1YVLA 2B3OA 4OHHA 3PFVA 1D1ZA 2EKXA 3VRYA 1O4RA 3N8MA 3N84A 5IBSA 1O4HA 3WA4A 1BG1A 5GJHA 2FCIA 3VS4A 3PJPA 1Y57A 2MC1A 1HCSB 4NWFA 5AXIA 2YSXA 4FL3A 3NHNA 1LKKA 5BO4A 1O4CA 3CD3A 3VS5A 1CWEA 3BUNB 1MW4A 2BBUA 2PLEA 1AYDA 2CIAA 4WWQA 2HMHA 3HHMB 4A4BA 3C7IA 2SHPA 1FBZA 2L3TA 1O43A 2RMXA 3UF4A 1SHAA 2LQNA 1O4FA 3OVEA 4LUDA 5EEQA 1OPLA 2CRHA 3EAZA 2RORA 1O4GA 1F2FA 2C9WA 1QG1E 2LNXA 1JYUA 1LCJA 5EG3B 3BUXB 3OP0A 4GWFA 4OHIA 2PTKA 3MAZA 3PQZA 1FBVA 2YU7A 4JGHA 2HUWA 4JE4A 1TCEA 2IUGA 1AYBA 3IMJA 2C0IA 1BLJA 2MRJA 1ZFPE 2HCKA 3IN7A 2EO3A 2EYVA 2MQIA 4U17A 4EY0A 2H8HA 1NRVA 4K44A 4DGXA 4H34A 2CI9A 2GSBA 1BF5A 4L1BB 1IJRA 2XP1A 1BMBA 2DCRA 1AOTF 3PS5A 5DC4A 1A1AA 4OHLA 3S8LA 2IUHA 3M7FA 1A09A 2RVFA 1I3ZA 1H9OA 1F1WA 1OO3A 1SPSA 2RSYA 3GXWA 5IBMA 1AYAA 1RJAA 3CWGA 2EOBA 1O41A 1LUIA 1O47A 5EHRA 3QWYA 3VS1A 1A07A 5D0JA 2K7AB 2LCTA 2QMSA 1AYCA 2OQ1A 3BUOB 1UUSA 2PNAA 5HKWA 3PSKA 5DC0B 4M4ZA 1O4LA 3PLFB 1FHSA 3VS2A 5I6VA 4FL2A 1AB2A 1KA7A 1B47A 1IS0A 4GL9E 5DF6A 1OPKA 3PSJA 3S9KA 3CBLA 2OZOA 1FU5A 1X6CA 2Y1MA 1BM2A 1A1CA 1P13A 2L4KA 4P9VA 1M61A 2AOAA 1OO4A 3VRRA 2H5KA 3BUWB 2DX0A 1MILA 1BKMA 4OHDA 3T04A 1BFJA 2ECDA 2CBLA 3VS7A 2KNOA 1O4PA 4NWGA 3VGOA 3VS6A 2K79B 2C0TA 1X0NA 3TL0A 5EHPA 2CR4A 2DLZA 3VRPA 2ETZA 2HDXA 1Z3KA 2HDVA 1NZVA 1BHHB 1CWDL 1CJ1A 2CS0A 2KK6A 1O4EA 1O45A 1YVHA 4XZ1A 1JU5A 4GPLB 4QSYA 4F59A 1O4AA 1CSZA 2MK2A 2DM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BHH A;  3VRN A;  1LUM A;  1BLK A;  1SPR A;  2EYZ A;  3UYO A;  4EIH A;  4XZ0 A;  3MXC A;  3BKB A;  1R1P A;  1LUK A;  1SHD A;  1X27 A;  1GHU A;  3EAC A;  4TZI A;  4F5A A;  1XA6 A;  1Y1U A;  2AUG A;  2FO0 A;  3K2M A;  2CI8 A;  2LQW A;  2IUI A;  1BKL A;  1A1B A;  3TKZ A;  4P9Z A;  2MRK A;  2DLY A;  4E68 A;  4H1O A;  3N7Y A;  4D8K A;  1G83 A;  3IN8 A;  1BHF A;  1KSW A;  1QAD A;  1AOU F;  3QWX X;  1RPY A;  2H46 E;  3HCK A;  4F5B A;  1KA6 A;  1D4T A;  1A1E A;  3KFJ A;  5HKZ A;  1SKJ A;  1LKL A;  1LCK A;  3BUM B;  3GQI B;  2ABL A;  5CDW A;  3S8O A;  1A08 A;  1FMK A;  1O42 A;  5HKY A;  2JYQ A;  1JYQ A;  1O4K A;  2SRC A;  3S8N A;  3MXY A;  1O4N A;  1SHB A;  2L6K A;  5GJI A;  1O48 A;  2PLD A;  1KC2 A;  4U1P A;  1D4W A;  2EU0 A;  3OV1 A;  1AD5 A;  1TZE E;  4DGP A;  1O4B A;  1O4Q A;  4X6S A;  1UUR A;  1O4O A;  1R1S A;  1GRI A;  1R1Q A;  2EYY A;  3ZNI A;  4FBN A;  1RQQ C;  2GE9 A;  2VIF A;  1FU6 A;  4OHE A;  1K9A A;  1QCF A;  3GXX A;  2EO6 A;  1HCT B;  2EL8 A;  3IMD A;  1LUN A;  4JEG A;  1O4M A;  2Y3A B;  5EEL A;  1NZL A;  3VS3 A;  3CXL A;  2C0O A;  3OB2 B;  1O46 A;  1A81 A;  3OB1 B;  5KAZ A;  3HIZ B;  3VS0 A;  4E93 A;  1CSY A;  4K11 A;  1FYR A;  1O4D A;  5DC9 A;  3US4 A;  1PIC A;  4A4C A;  4ROJ A;  5AUL A;  2PNB A;  1M27 A;  1O44 A;  5J3X A;  2DVJ A;  1BFI A;  2AOB A;  1O4J A;  1WQU A;  4K2R A;  3VRQ A;  2Y1N A;  3VRO A;  4K45 A;  1O4I A;  2IZV A;  2LNW A;  1O49 A;  3VRZ A;  1JWO A;  1JYR A;  4LUE A;  1YVL A;  2B3O A;  4OHH A;  3PFV A;  1D1Z A;  2EKX A;  3VRY A;  1O4R A;  3N8M A;  3N84 A;  5IBS A;  1O4H A;  3WA4 A;  1BG1 A;  5GJH A;  2FCI A;  3VS4 A;  3PJP A;  1Y57 A;  2MC1 A;  1HCS B;  4NWF A;  5AXI A;  2YSX A;  4FL3 A;  3NHN A;  1LKK A;  5BO4 A;  1O4C A;  3CD3 A;  3VS5 A;  1CWE A;  3BUN B;  1MW4 A;  2BBU A;  2PLE A;  1AYD A;  2CIA A;  4WWQ A;  2HMH A;  3HHM B;  4A4B A;  3C7I A;  2SHP A;  1FBZ A;  2L3T A;  1O43 A;  2RMX A;  3UF4 A;  1SHA A;  2LQN A;  1O4F A;  3OVE A;  4LUD A;  5EEQ A;  1OPL A;  2CRH A;  3EAZ A;  2ROR A;  1O4G A;  1F2F A;  2C9W A;  1QG1 E;  2LNX A;  1JYU A;  1LCJ A;  5EG3 B;  3BUX B;  3OP0 A;  4GWF A;  4OHI A;  2PTK A;  3MAZ A;  3PQZ A;  1FBV A;  2YU7 A;  4JGH A;  2HUW A;  4JE4 A;  1TCE A;  2IUG A;  1AYB A;  3IMJ A;  2C0I A;  1BLJ A;  2MRJ A;  1ZFP E;  2HCK A;  3IN7 A;  2EO3 A;  2EYV A;  2MQI A;  4U17 A;  4EY0 A;  2H8H A;  1NRV A;  4K44 A;  4DGX A;  4H34 A;  2CI9 A;  2GSB A;  1BF5 A;  4L1B B;  1IJR A;  2XP1 A;  1BMB A;  2DCR A;  1AOT F;  3PS5 A;  5DC4 A;  1A1A A;  4OHL A;  3S8L A;  2IUH A;  3M7F A;  1A09 A;  2RVF A;  1I3Z A;  1H9O A;  1F1W A;  1OO3 A;  1SPS A;  2RSY A;  3GXW A;  5IBM A;  1AYA A;  1RJA A;  3CWG A;  2EOB A;  1O41 A;  1LUI A;  1O47 A;  5EHR A;  3QWY A;  3VS1 A;  1A07 A;  5D0J A;  2K7A B;  2LCT A;  2QMS A;  1AYC A;  2OQ1 A;  3BUO B;  1UUS A;  2PNA A;  5HKW A;  3PSK A;  5DC0 B;  4M4Z A;  1O4L A;  3PLF B;  1FHS A;  3VS2 A;  5I6V A;  4FL2 A;  1AB2 A;  1KA7 A;  1B47 A;  1IS0 A;  4GL9 E;  5DF6 A;  1OPK A;  3PSJ A;  3S9K A;  3CBL A;  2OZO A;  1FU5 A;  1X6C A;  2Y1M A;  1BM2 A;  1A1C A;  1P13 A;  2L4K A;  4P9V A;  1M61 A;  2AOA A;  1OO4 A;  3VRR A;  2H5K A;  3BUW B;  2DX0 A;  1MIL A;  1BKM A;  4OHD A;  3T04 A;  1BFJ A;  2ECD A;  2CBL A;  3VS7 A;  2KNO A;  1O4P A;  4NWG A;  3VGO A;  3VS6 A;  2K79 B;  2C0T A;  1X0N A;  3TL0 A;  5EHP A;  2CR4 A;  2DLZ A;  3VRP A;  2ETZ A;  2HDX A;  1Z3K A;  2HDV A;  1NZV A;  1BHH B;  1CWD L;  1CJ1 A;  2CS0 A;  2KK6 A;  1O4E A;  1O45 A;  1YVH A;  4XZ1 A;  1JU5 A;  4GPL B;  4QSY A;  4F59 A;  1O4A A;  1CSZ A;  2MK2 A;  2DM0 A; 
#chains in the Genus database with same CATH topology
 1BHH A;  3VRN A;  1LUM A;  1BLK A;  1SPR A;  2EYZ A;  3UYO A;  4EIH A;  4XZ0 A;  3MXC A;  3BKB A;  1R1P A;  1LUK A;  1SHD A;  1X27 A;  1GHU A;  3EAC A;  4TZI A;  4F5A A;  1XA6 A;  1Y1U A;  2AUG A;  2FO0 A;  3K2M A;  2CI8 A;  2LQW A;  2IUI A;  1BKL A;  1A1B A;  3TKZ A;  4P9Z A;  2MRK A;  2DLY A;  4E68 A;  4H1O A;  3N7Y A;  4D8K A;  1G83 A;  3IN8 A;  1BHF A;  1KSW A;  1QAD A;  1AOU F;  3QWX X;  1RPY A;  2H46 E;  3HCK A;  4F5B A;  1KA6 A;  1D4T A;  1A1E A;  3KFJ A;  5HKZ A;  1SKJ A;  1LKL A;  1LCK A;  3BUM B;  3GQI B;  2ABL A;  5CDW A;  3S8O A;  1A08 A;  1FMK A;  1O42 A;  5HKY A;  2JYQ A;  1JYQ A;  1O4K A;  2SRC A;  3S8N A;  3MXY A;  1O4N A;  1SHB A;  2L6K A;  5GJI A;  1O48 A;  2PLD A;  1KC2 A;  4U1P A;  1D4W A;  2EU0 A;  3OV1 A;  1AD5 A;  1TZE E;  4DGP A;  1O4B A;  1O4Q A;  4X6S A;  1UUR A;  1O4O A;  1R1S A;  1GRI A;  1R1Q A;  2EYY A;  3ZNI A;  4FBN A;  1RQQ C;  2GE9 A;  2VIF A;  1FU6 A;  4OHE A;  1K9A A;  1QCF A;  3GXX A;  2EO6 A;  1HCT B;  2EL8 A;  3IMD A;  1LUN A;  4JEG A;  1O4M A;  2Y3A B;  5EEL A;  1NZL A;  3VS3 A;  3CXL A;  2C0O A;  3OB2 B;  1O46 A;  1A81 A;  3OB1 B;  5KAZ A;  3HIZ B;  3VS0 A;  4E93 A;  1CSY A;  4K11 A;  1FYR A;  1O4D A;  5DC9 A;  3US4 A;  1PIC A;  4A4C A;  4ROJ A;  5AUL A;  2PNB A;  1M27 A;  1O44 A;  5J3X A;  2DVJ A;  1BFI A;  2AOB A;  1O4J A;  1WQU A;  4K2R A;  3VRQ A;  2Y1N A;  3VRO A;  4K45 A;  1O4I A;  2IZV A;  2LNW A;  1O49 A;  3VRZ A;  1JWO A;  1JYR A;  4LUE A;  1YVL A;  2B3O A;  4OHH A;  3PFV A;  1D1Z A;  2EKX A;  3VRY A;  1O4R A;  3N8M A;  3N84 A;  5IBS A;  1O4H A;  3WA4 A;  1BG1 A;  5GJH A;  2FCI A;  3VS4 A;  3PJP A;  1Y57 A;  2MC1 A;  1HCS B;  4NWF A;  5AXI A;  2YSX A;  4FL3 A;  3NHN A;  1LKK A;  5BO4 A;  1O4C A;  3CD3 A;  3VS5 A;  1CWE A;  3BUN B;  1MW4 A;  2BBU A;  2PLE A;  1AYD A;  2CIA A;  4WWQ A;  2HMH A;  3HHM B;  4A4B A;  3C7I A;  2SHP A;  1FBZ A;  2L3T A;  1O43 A;  2RMX A;  2LRA A;  3UF4 A;  1SHA A;  2LQN A;  1O4F A;  3OVE A;  4LUD A;  5EEQ A;  1OPL A;  2CRH A;  3EAZ A;  2ROR A;  1O4G A;  1F2F A;  2C9W A;  1QG1 E;  2LNX A;  1JYU A;  1LCJ A;  5EG3 B;  3BUX B;  3OP0 A;  4GWF A;  4OHI A;  2PTK A;  3MAZ A;  3PQZ A;  1FBV A;  2YU7 A;  4JGH A;  2HUW A;  4JE4 A;  1TCE A;  2IUG A;  3K2T A;  1AYB A;  3IMJ A;  2C0I A;  1BLJ A;  2MRJ A;  1ZFP E;  2HCK A;  3IN7 A;  2EO3 A;  2EYV A;  2MQI A;  4U17 A;  4EY0 A;  2H8H A;  1NRV A;  4K44 A;  4DGX A;  4H34 A;  2CI9 A;  2GSB A;  1BF5 A;  4L1B B;  1IJR A;  2XP1 A;  1BMB A;  2DCR A;  1AOT F;  3PS5 A;  5DC4 A;  1A1A A;  4OHL A;  3S8L A;  2IUH A;  3M7F A;  1A09 A;  2RVF A;  1I3Z A;  1H9O A;  1F1W A;  1OO3 A;  1SPS A;  2RSY A;  3GXW A;  5IBM A;  1AYA A;  1RJA A;  3CWG A;  2EOB A;  1O41 A;  1LUI A;  1O47 A;  5EHR A;  3LYV A;  3QWY A;  3VS1 A;  1A07 A;  5D0J A;  2K7A B;  2LCT A;  2QMS A;  1AYC A;  2OQ1 A;  3BUO B;  1UUS A;  2PNA A;  5HKW A;  3PSK A;  5DC0 B;  4M4Z A;  1O4L A;  3PLF B;  1FHS A;  3VS2 A;  5I6V A;  4FL2 A;  1AB2 A;  1KA7 A;  1B47 A;  1IS0 A;  4GL9 E;  5DF6 A;  1OPK A;  3PSJ A;  3S9K A;  3CBL A;  2OZO A;  1FU5 A;  1X6C A;  2Y1M A;  1BM2 A;  1A1C A;  1P13 A;  2L4K A;  4P9V A;  1M61 A;  2AOA A;  1OO4 A;  3VRR A;  2H5K A;  3BUW B;  2DX0 A;  1MIL A;  1BKM A;  4OHD A;  3T04 A;  1BFJ A;  2ECD A;  2CBL A;  3VS7 A;  2KNO A;  1O4P A;  4NWG A;  3VGO A;  3VS6 A;  2KGY A;  2K79 B;  2C0T A;  1X0N A;  3TL0 A;  5EHP A;  2CR4 A;  2DLZ A;  3VRP A;  2ETZ A;  2HDX A;  1Z3K A;  2HDV A;  1NZV A;  1BHH B;  1CWD L;  1CJ1 A;  2CS0 A;  2KK6 A;  1O4E A;  1O45 A;  1YVH A;  4XZ1 A;  1JU5 A;  4GPL B;  4QSY A;  4F59 A;  1O4A A;  1CSZ A;  2MK2 A;  2DM0 A; 
#chains in the Genus database with same CATH homology
 1BHH A;  3VRN A;  1LUM A;  1BLK A;  1SPR A;  2EYZ A;  3UYO A;  4EIH A;  4XZ0 A;  3MXC A;  3BKB A;  1R1P A;  1LUK A;  1SHD A;  1X27 A;  1GHU A;  3EAC A;  4TZI A;  4F5A A;  1XA6 A;  1Y1U A;  2AUG A;  2FO0 A;  3K2M A;  2CI8 A;  2LQW A;  2IUI A;  1BKL A;  1A1B A;  3TKZ A;  4P9Z A;  2MRK A;  2DLY A;  4E68 A;  4H1O A;  3N7Y A;  4D8K A;  1G83 A;  3IN8 A;  1BHF A;  1KSW A;  1QAD A;  1AOU F;  3QWX X;  1RPY A;  2H46 E;  3HCK A;  4F5B A;  1KA6 A;  1D4T A;  1A1E A;  3KFJ A;  5HKZ A;  1SKJ A;  1LKL A;  1LCK A;  3BUM B;  3GQI B;  2ABL A;  5CDW A;  3S8O A;  1A08 A;  1FMK A;  1O42 A;  5HKY A;  2JYQ A;  1JYQ A;  1O4K A;  2SRC A;  3S8N A;  3MXY A;  1O4N A;  1SHB A;  2L6K A;  5GJI A;  1O48 A;  2PLD A;  1KC2 A;  4U1P A;  1D4W A;  2EU0 A;  3OV1 A;  1AD5 A;  1TZE E;  4DGP A;  1O4B A;  1O4Q A;  4X6S A;  1UUR A;  1O4O A;  1R1S A;  1GRI A;  1R1Q A;  2EYY A;  3ZNI A;  4FBN A;  1RQQ C;  2GE9 A;  2VIF A;  1FU6 A;  4OHE A;  1K9A A;  1QCF A;  3GXX A;  2EO6 A;  1HCT B;  2EL8 A;  3IMD A;  1LUN A;  4JEG A;  1O4M A;  2Y3A B;  5EEL A;  1NZL A;  3VS3 A;  3CXL A;  2C0O A;  3OB2 B;  1O46 A;  1A81 A;  3OB1 B;  5KAZ A;  3HIZ B;  3VS0 A;  4E93 A;  1CSY A;  4K11 A;  1FYR A;  1O4D A;  5DC9 A;  3US4 A;  1PIC A;  4A4C A;  4ROJ A;  5AUL A;  2PNB A;  1M27 A;  1O44 A;  5J3X A;  2DVJ A;  1BFI A;  2AOB A;  1O4J A;  1WQU A;  4K2R A;  3VRQ A;  2Y1N A;  3VRO A;  4K45 A;  1O4I A;  2IZV A;  2LNW A;  1O49 A;  3VRZ A;  1JWO A;  1JYR A;  4LUE A;  1YVL A;  2B3O A;  4OHH A;  3PFV A;  1D1Z A;  2EKX A;  3VRY A;  1O4R A;  3N8M A;  3N84 A;  5IBS A;  1O4H A;  3WA4 A;  1BG1 A;  5GJH A;  2FCI A;  3VS4 A;  3PJP A;  1Y57 A;  2MC1 A;  1HCS B;  4NWF A;  5AXI A;  2YSX A;  4FL3 A;  3NHN A;  1LKK A;  5BO4 A;  1O4C A;  3CD3 A;  3VS5 A;  1CWE A;  3BUN B;  1MW4 A;  2BBU A;  2PLE A;  1AYD A;  2CIA A;  4WWQ A;  2HMH A;  3HHM B;  4A4B A;  3C7I A;  2SHP A;  1FBZ A;  2L3T A;  1O43 A;  2RMX A;  3UF4 A;  1SHA A;  2LQN A;  1O4F A;  3OVE A;  4LUD A;  5EEQ A;  1OPL A;  2CRH A;  3EAZ A;  2ROR A;  1O4G A;  1F2F A;  2C9W A;  1QG1 E;  2LNX A;  1JYU A;  1LCJ A;  5EG3 B;  3BUX B;  3OP0 A;  4GWF A;  4OHI A;  2PTK A;  3MAZ A;  3PQZ A;  1FBV A;  2YU7 A;  4JGH A;  2HUW A;  4JE4 A;  1TCE A;  2IUG A;  1AYB A;  3IMJ A;  2C0I A;  1BLJ A;  2MRJ A;  1ZFP E;  2HCK A;  3IN7 A;  2EO3 A;  2EYV A;  2MQI A;  4U17 A;  4EY0 A;  2H8H A;  1NRV A;  4K44 A;  4DGX A;  4H34 A;  2CI9 A;  2GSB A;  1BF5 A;  4L1B B;  1IJR A;  2XP1 A;  1BMB A;  2DCR A;  1AOT F;  3PS5 A;  5DC4 A;  1A1A A;  4OHL A;  3S8L A;  2IUH A;  3M7F A;  1A09 A;  2RVF A;  1I3Z A;  1H9O A;  1F1W A;  1OO3 A;  1SPS A;  2RSY A;  3GXW A;  5IBM A;  1AYA A;  1RJA A;  3CWG A;  2EOB A;  1O41 A;  1LUI A;  1O47 A;  5EHR A;  3QWY A;  3VS1 A;  1A07 A;  5D0J A;  2K7A B;  2LCT A;  2QMS A;  1AYC A;  2OQ1 A;  3BUO B;  1UUS A;  2PNA A;  5HKW A;  3PSK A;  5DC0 B;  4M4Z A;  1O4L A;  3PLF B;  1FHS A;  3VS2 A;  5I6V A;  4FL2 A;  1AB2 A;  1KA7 A;  1B47 A;  1IS0 A;  4GL9 E;  5DF6 A;  1OPK A;  3PSJ A;  3S9K A;  3CBL A;  2OZO A;  1FU5 A;  1X6C A;  2Y1M A;  1BM2 A;  1A1C A;  1P13 A;  2L4K A;  4P9V A;  1M61 A;  2AOA A;  1OO4 A;  3VRR A;  2H5K A;  3BUW B;  2DX0 A;  1MIL A;  1BKM A;  4OHD A;  3T04 A;  1BFJ A;  2ECD A;  2CBL A;  3VS7 A;  2KNO A;  1O4P A;  4NWG A;  3VGO A;  3VS6 A;  2K79 B;  2C0T A;  1X0N A;  3TL0 A;  5EHP A;  2CR4 A;  2DLZ A;  3VRP A;  2ETZ A;  2HDX A;  1Z3K A;  2HDV A;  1NZV A;  1BHH B;  1CWD L;  1CJ1 A;  2CS0 A;  2KK6 A;  1O4E A;  1O45 A;  1YVH A;  4XZ1 A;  1JU5 A;  4GPL B;  4QSY A;  4F59 A;  1O4A A;  1CSZ A;  2MK2 A;  2DM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...