1AYDA

Crystal structures of peptide complexes of the amino-terminal sh2 domain of the syp tyrosine phosphatase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
b'MRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN-TYROSINE PHOSPHATASE SYP (N-TERMINAL SH2 DOMAIN)
publication title Crystal structures of peptide complexes of the amino-terminal SH2 domain of the Syp tyrosine phosphatase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase(sh2 domain)
total genus 25
structure length 101
sequence length 101
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 1994-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1aydA00
1O4OA 1O4BA 1OPLA 1XA6A 2IUGA 2DLYA 2CI9A 4K11A 4NWFA 3BUNB 1O4QA 2PNAA 1AYCA 4XZ0A 1BHFA 1MW4A 1FBVA 3PFVA 5EG3B 1HCSB 1A1AA 1NZLA 1F2FA 1NRVA 2CRHA 1X27A 4JE4A 2C0IA 2IUIA 1CJ1A 5AXIA 4EY0A 1MILA 3VS2A 2MQIA 1Y57A 3MXYA 2C0OA 1CWEA 3K2MA 2DCRA 2MK2A 2HMHA 4TZIA 2CBLA 1K9AA 3N84A 3BUOB 1OO3A 1JWOA 3PS5A 1RPYA 1O4GA 1FHSA 2DX0A 1QCFA 3N8MA 3OV1A 3VS4A 4GL9E 4LUEA 1A1EA 1O41A 1LKKA 1SPRA 1BKLA 1AOTF 3VS6A 2B3OA 2YU7A 4E68A 1IS0A 2RVFA 1AYDA 1D4TA 2L4KA 2H8HA 1SHAA 1KSWA 1F1WA 1A08A 3CD3A 3BUWB 1O4FA 5DC0B 1O42A 2YSXA 5DF6A 3VRZA 1OPKA 4NWGA 4L1BB 2MRJA 4JEGA 1O4IA 5D0JA 2EYZA 2L3TA 3QWXX 3OVEA 3VROA 1BFJA 2ETZA 2MC1A 1O4AA 3VGOA 1O49A 1O45A 2IZVA 4WWQA 1O4NA 1O4HA 2RORA 2PNBA 3BUXB 1GRIA 1O4RA 1SPSA 3KFJA 1KA6A 2DLZA 1O4EA 4H34A 2EO3A 1B47A 5IBMA 1BHHA 3VRYA 5EHRA 2RMXA 1A09A 3VS5A 4F5BA 2SHPA 5GJHA 3IN8A 2AOAA 2IUHA 1LUKA 3PSJA 4U17A 1BLJA 2HDXA 4XZ1A 1KC2A 3VS0A 1QADA 2LQNA 1NZVA 1P13A 5I6VA 2LQWA 1H9OA 1D1ZA 3GXWA 1O4KA 2LNXA 1R1PA 2C0TA 1A07A 2VIFA 1BKMA 1SHBA 5CDWA 1X6CA 2Y3AB 1IJRA 1LKLA 4D8KA 1R1QA 4JGHA 4OHLA 4E93A 3OB2B 5EELA 4OHIA 3WA4A 1AOUF 3PLFB 3HHMB 1FBZA 2GE9A 2HCKA 1YVHA 4P9ZA 3MAZA 2EL8A 2OZOA 1BLKA 1O4MA 1X0NA 5HKZA 1CSZA 1O4DA 4H1OA 3IN7A 1BHHB 4K45A 2EYVA 5HKYA 3PJPA 4FL2A 1TZEE 2OQ1A 2L6KA 4K44A 4DGXA 2PTKA 4A4CA 2Y1MA 4FBNA 4LUDA 2FO0A 2H5KA 1SHDA 5IBSA 1TCEA 2EOBA 3T04A 4K2RA 1D4WA 3HIZB 3VRRA 2AOBA 1O44A 1LUMA 1R1SA 3BKBA 5EHPA 2QMSA 4EIHA 2CS0A 3VRNA 2HDVA 1JU5A 3IMJA 2HUWA 4F59A 1OO4A 1CWDL 2CI8A 1O46A 5EEQA 3BUMB 1G83A 1M27A 2LNWA 3M7FA 1KA7A 2EU0A 2PLEA 1AD5A 3EAZA 1A1BA 2GSBA 2CR4A 1BF5A 2BBUA 1FU6A 1UUSA 3GQIB 3CBLA 4DGPA 3NHNA 3HCKA 4OHEA 2FCIA 4OHHA 5AULA 2JYQA 3TKZA 3OB1B 1RJAA 1AB2A 1O4JA 2C9WA 1GHUA 2SRCA 1JYRA 1QG1E 1LCKA 5KAZA 3EACA 2K7AB 3IMDA 2DVJA 3TL0A 3VRPA 1HCTB 3UF4A 1CSYA 3CWGA 5DC4A 4A4BA 2K79B 2MRKA 1AYBA 1BMBA 1I3ZA 1LCJA 1YVLA 2H46E 2LCTA 2Y1NA 1PICA 3CXLA 3VS3A 3OP0A 1O4LA 4GWFA 4FL3A 3VS1A 1Y1UA 1WQUA 1A81A 4X6SA 1UURA 3C7IA 1RQQC 5DC9A 2ABLA 1A1CA 1JYQA 1SKJA 1O4CA 3PSKA 1FYRA 2ECDA 3QWYA 1ZFPE 4M4ZA 1Z3KA 4OHDA 2AUGA 3S9KA 2RSYA 1AYAA 1FMKA 2XP1A 4GPLB 5J3XA 1BM2A 3N7YA 3UYOA 2PLDA 3US4A 1O43A 1O48A 1O4PA 5HKWA 4U1PA 3S8NA 4P9VA 5BO4A 3ZNIA 1LUIA 5GJIA 1BG1A 1FU5A 3S8OA 2CIAA 3VS7A 2KK6A 1O47A 3GXXA 2EO6A 3VRQA 3PQZA 1BFIA 1LUNA 1M61A 4QSYA 3S8LA 2EYYA 4ROJA 2DM0A 3MXCA 1JYUA 4F5AA 2EKXA 2KNOA
chains in the Genus database with same CATH superfamily
1O4OA 1O4BA 1OPLA 1XA6A 2IUGA 2DLYA 2CI9A 4K11A 4NWFA 3BUNB 1O4QA 2PNAA 1AYCA 4XZ0A 1BHFA 1MW4A 1FBVA 3PFVA 5EG3B 1HCSB 1A1AA 1NZLA 1F2FA 1NRVA 2CRHA 1X27A 4JE4A 2C0IA 2IUIA 1CJ1A 5AXIA 4EY0A 1MILA 3VS2A 2MQIA 1Y57A 3MXYA 2C0OA 1CWEA 3K2MA 2DCRA 2MK2A 2HMHA 4TZIA 2CBLA 1K9AA 2KGYA 3N84A 3BUOB 1OO3A 1JWOA 3PS5A 1RPYA 1O4GA 1FHSA 2DX0A 1QCFA 3N8MA 3OV1A 3VS4A 4GL9E 4LUEA 1A1EA 1O41A 1LKKA 1SPRA 1BKLA 1AOTF 3VS6A 2B3OA 2YU7A 4E68A 1IS0A 2RVFA 1AYDA 1D4TA 2L4KA 2H8HA 1SHAA 1KSWA 1F1WA 1A08A 3CD3A 3BUWB 1O4FA 5DC0B 1O42A 2YSXA 5DF6A 3VRZA 1OPKA 4NWGA 4L1BB 2MRJA 4JEGA 1O4IA 5D0JA 2EYZA 2L3TA 3QWXX 3OVEA 3VROA 1BFJA 2ETZA 2MC1A 1O4AA 3VGOA 1O49A 1O45A 2IZVA 4WWQA 1O4NA 1O4HA 2RORA 2PNBA 3BUXB 1GRIA 1O4RA 1SPSA 3KFJA 1KA6A 2DLZA 1O4EA 4H34A 2EO3A 1B47A 5IBMA 1BHHA 3VRYA 5EHRA 2RMXA 1A09A 3VS5A 4F5BA 2SHPA 5GJHA 3IN8A 2AOAA 2IUHA 1LUKA 3PSJA 4U17A 1BLJA 2HDXA 4XZ1A 1KC2A 3VS0A 1QADA 2LQNA 1NZVA 1P13A 5I6VA 2LQWA 1H9OA 1D1ZA 3GXWA 1O4KA 2LNXA 1R1PA 2C0TA 1A07A 2VIFA 1BKMA 1SHBA 2LRAA 5CDWA 1X6CA 2Y3AB 1IJRA 1LKLA 4D8KA 1R1QA 4JGHA 4OHLA 4E93A 3OB2B 5EELA 4OHIA 3WA4A 1AOUF 3PLFB 3HHMB 1FBZA 2GE9A 2HCKA 1YVHA 4P9ZA 3MAZA 2EL8A 2OZOA 1BLKA 1O4MA 1X0NA 5HKZA 1CSZA 1O4DA 4H1OA 3IN7A 1BHHB 4K45A 2EYVA 5HKYA 3PJPA 4FL2A 1TZEE 2OQ1A 2L6KA 4K44A 4DGXA 2PTKA 4A4CA 2Y1MA 4FBNA 4LUDA 2FO0A 2H5KA 1SHDA 5IBSA 1TCEA 2EOBA 3T04A 4K2RA 1D4WA 3HIZB 3VRRA 2AOBA 1O44A 1LUMA 1R1SA 3BKBA 5EHPA 2QMSA 4EIHA 2CS0A 3VRNA 2HDVA 1JU5A 3IMJA 2HUWA 4F59A 1OO4A 1CWDL 2CI8A 1O46A 5EEQA 3BUMB 1G83A 1M27A 2LNWA 3M7FA 1KA7A 2EU0A 2PLEA 1AD5A 3EAZA 1A1BA 2GSBA 2CR4A 1BF5A 2BBUA 1FU6A 1UUSA 3GQIB 3CBLA 4DGPA 3NHNA 3HCKA 4OHEA 2FCIA 4OHHA 5AULA 2JYQA 3TKZA 3OB1B 1RJAA 1AB2A 1O4JA 2C9WA 1GHUA 2SRCA 1JYRA 1QG1E 1LCKA 3LYVA 3EACA 2K7AB 3IMDA 2DVJA 5KAZA 3TL0A 3VRPA 1HCTB 3UF4A 1CSYA 3CWGA 5DC4A 4A4BA 2K79B 2MRKA 1AYBA 1BMBA 1I3ZA 1LCJA 1YVLA 2H46E 2LCTA 2Y1NA 1PICA 3CXLA 3VS3A 3OP0A 1O4LA 4GWFA 4FL3A 3VS1A 1Y1UA 1WQUA 1A81A 4X6SA 1UURA 3C7IA 1RQQC 5DC9A 2ABLA 1A1CA 1JYQA 1SKJA 1O4CA 3PSKA 3K2TA 1FYRA 2ECDA 3QWYA 1ZFPE 4M4ZA 1Z3KA 4OHDA 2AUGA 3S9KA 2RSYA 1AYAA 1FMKA 2XP1A 4GPLB 5J3XA 1BM2A 3N7YA 3UYOA 2PLDA 3US4A 1O43A 1O48A 1O4PA 5HKWA 4U1PA 3S8NA 4P9VA 5BO4A 3ZNIA 1LUIA 5GJIA 1BG1A 1FU5A 3S8OA 2CIAA 3VS7A 2KK6A 1O47A 3GXXA 2EO6A 3VRQA 3PQZA 1BFIA 1LUNA 1M61A 4QSYA 3S8LA 2EYYA 4ROJA 2DM0A 3MXCA 1JYUA 4F5AA 2EKXA 2KNOA
chains in the Genus database with same CATH topology
1O4OA 1O4BA 1OPLA 1XA6A 2IUGA 2DLYA 2CI9A 4K11A 4NWFA 3BUNB 1O4QA 2PNAA 1AYCA 4XZ0A 1BHFA 1MW4A 1FBVA 3PFVA 5EG3B 1HCSB 1A1AA 1NZLA 1F2FA 1NRVA 2CRHA 1X27A 4JE4A 2C0IA 2IUIA 1CJ1A 5AXIA 4EY0A 1MILA 3VS2A 2MQIA 1Y57A 3MXYA 2C0OA 1CWEA 3K2MA 2DCRA 2MK2A 2HMHA 4TZIA 2CBLA 1K9AA 3N84A 3BUOB 1OO3A 1JWOA 3PS5A 1RPYA 1O4GA 1FHSA 2DX0A 1QCFA 3N8MA 3OV1A 3VS4A 4GL9E 4LUEA 1A1EA 1O41A 1LKKA 1SPRA 1BKLA 1AOTF 3VS6A 2B3OA 2YU7A 4E68A 1IS0A 2RVFA 1AYDA 1D4TA 2L4KA 2H8HA 1SHAA 1KSWA 1F1WA 1A08A 3CD3A 3BUWB 1O4FA 5DC0B 1O42A 2YSXA 5DF6A 3VRZA 1OPKA 4NWGA 4L1BB 2MRJA 4JEGA 1O4IA 5D0JA 2EYZA 2L3TA 3QWXX 3OVEA 3VROA 1BFJA 2ETZA 2MC1A 1O4AA 3VGOA 1O49A 1O45A 2IZVA 4WWQA 1O4NA 1O4HA 2RORA 2PNBA 3BUXB 1GRIA 1O4RA 1SPSA 3KFJA 1KA6A 2DLZA 1O4EA 4H34A 2EO3A 1B47A 5IBMA 1BHHA 3VRYA 5EHRA 2RMXA 1A09A 3VS5A 4F5BA 2SHPA 5GJHA 3IN8A 2AOAA 2IUHA 1LUKA 3PSJA 4U17A 1BLJA 2HDXA 4XZ1A 1KC2A 3VS0A 1QADA 2LQNA 1NZVA 1P13A 5I6VA 2LQWA 1H9OA 1D1ZA 3GXWA 1O4KA 2LNXA 1R1PA 2C0TA 1A07A 2VIFA 1BKMA 1SHBA 5CDWA 1X6CA 2Y3AB 1IJRA 1LKLA 4D8KA 1R1QA 4JGHA 4OHLA 4E93A 3OB2B 5EELA 4OHIA 3WA4A 1AOUF 3PLFB 3HHMB 1FBZA 2GE9A 2HCKA 1YVHA 4P9ZA 3MAZA 2EL8A 2OZOA 1BLKA 1O4MA 1X0NA 5HKZA 1CSZA 1O4DA 4H1OA 3IN7A 1BHHB 4K45A 2EYVA 5HKYA 3PJPA 4FL2A 1TZEE 2OQ1A 2L6KA 4K44A 4DGXA 2PTKA 4A4CA 2Y1MA 4FBNA 4LUDA 2FO0A 2H5KA 1SHDA 5IBSA 1TCEA 2EOBA 3T04A 4K2RA 1D4WA 3HIZB 3VRRA 2AOBA 1O44A 1LUMA 1R1SA 3BKBA 5EHPA 2QMSA 4EIHA 2CS0A 3VRNA 2HDVA 1JU5A 3IMJA 2HUWA 4F59A 1OO4A 1CWDL 2CI8A 1O46A 5EEQA 3BUMB 1G83A 1M27A 2LNWA 3M7FA 1KA7A 2EU0A 2PLEA 1AD5A 3EAZA 1A1BA 2GSBA 2CR4A 1BF5A 2BBUA 1FU6A 1UUSA 3GQIB 3CBLA 4DGPA 3NHNA 3HCKA 4OHEA 2FCIA 4OHHA 5AULA 2JYQA 3TKZA 3OB1B 1RJAA 1AB2A 1O4JA 2C9WA 1GHUA 2SRCA 1JYRA 1QG1E 1LCKA 5KAZA 3EACA 2K7AB 3IMDA 2DVJA 3TL0A 3VRPA 1HCTB 3UF4A 1CSYA 3CWGA 5DC4A 4A4BA 2K79B 2MRKA 1AYBA 1BMBA 1I3ZA 1LCJA 1YVLA 2H46E 2LCTA 2Y1NA 1PICA 3CXLA 3VS3A 3OP0A 1O4LA 4GWFA 4FL3A 3VS1A 1Y1UA 1WQUA 1A81A 4X6SA 1UURA 3C7IA 1RQQC 5DC9A 2ABLA 1A1CA 1JYQA 1SKJA 1O4CA 3PSKA 1FYRA 2ECDA 3QWYA 1ZFPE 4M4ZA 1Z3KA 4OHDA 2AUGA 3S9KA 2RSYA 1AYAA 1FMKA 2XP1A 4GPLB 5J3XA 1BM2A 3N7YA 3UYOA 2PLDA 3US4A 1O43A 1O48A 1O4PA 5HKWA 4U1PA 3S8NA 4P9VA 5BO4A 3ZNIA 1LUIA 5GJIA 1BG1A 1FU5A 3S8OA 2CIAA 3VS7A 2KK6A 1O47A 3GXXA 2EO6A 3VRQA 3PQZA 1BFIA 1LUNA 1M61A 4QSYA 3S8LA 2EYYA 4ROJA 2DM0A 3MXCA 1JYUA 4F5AA 2EKXA 2KNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O4O A;  1O4B A;  1OPL A;  1XA6 A;  2IUG A;  2DLY A;  2CI9 A;  4K11 A;  4NWF A;  3BUN B;  1O4Q A;  2PNA A;  1AYC A;  4XZ0 A;  1BHF A;  1MW4 A;  1FBV A;  3PFV A;  5EG3 B;  1HCS B;  1A1A A;  1NZL A;  1F2F A;  1NRV A;  2CRH A;  1X27 A;  4JE4 A;  2C0I A;  2IUI A;  1CJ1 A;  5AXI A;  4EY0 A;  1MIL A;  3VS2 A;  2MQI A;  1Y57 A;  3MXY A;  2C0O A;  1CWE A;  3K2M A;  2DCR A;  2MK2 A;  2HMH A;  4TZI A;  2CBL A;  1K9A A;  3N84 A;  3BUO B;  1OO3 A;  1JWO A;  3PS5 A;  1RPY A;  1O4G A;  1FHS A;  2DX0 A;  1QCF A;  3N8M A;  3OV1 A;  3VS4 A;  4GL9 E;  4LUE A;  1A1E A;  1O41 A;  1LKK A;  1SPR A;  1BKL A;  1AOT F;  3VS6 A;  2B3O A;  2YU7 A;  4E68 A;  1IS0 A;  2RVF A;  1AYD A;  1D4T A;  2L4K A;  2H8H A;  1SHA A;  1KSW A;  1F1W A;  1A08 A;  3CD3 A;  3BUW B;  1O4F A;  5DC0 B;  1O42 A;  2YSX A;  5DF6 A;  3VRZ A;  1OPK A;  4NWG A;  4L1B B;  2MRJ A;  4JEG A;  1O4I A;  5D0J A;  2EYZ A;  2L3T A;  3QWX X;  3OVE A;  3VRO A;  1BFJ A;  2ETZ A;  2MC1 A;  1O4A A;  3VGO A;  1O49 A;  1O45 A;  2IZV A;  4WWQ A;  1O4N A;  1O4H A;  2ROR A;  2PNB A;  3BUX B;  1GRI A;  1O4R A;  1SPS A;  3KFJ A;  1KA6 A;  2DLZ A;  1O4E A;  4H34 A;  2EO3 A;  1B47 A;  5IBM A;  1BHH A;  3VRY A;  5EHR A;  2RMX A;  1A09 A;  3VS5 A;  4F5B A;  2SHP A;  5GJH A;  3IN8 A;  2AOA A;  2IUH A;  1LUK A;  3PSJ A;  4U17 A;  1BLJ A;  2HDX A;  4XZ1 A;  1KC2 A;  3VS0 A;  1QAD A;  2LQN A;  1NZV A;  1P13 A;  5I6V A;  2LQW A;  1H9O A;  1D1Z A;  3GXW A;  1O4K A;  2LNX A;  1R1P A;  2C0T A;  1A07 A;  2VIF A;  1BKM A;  1SHB A;  5CDW A;  1X6C A;  2Y3A B;  1IJR A;  1LKL A;  4D8K A;  1R1Q A;  4JGH A;  4OHL A;  4E93 A;  3OB2 B;  5EEL A;  4OHI A;  3WA4 A;  1AOU F;  3PLF B;  3HHM B;  1FBZ A;  2GE9 A;  2HCK A;  1YVH A;  4P9Z A;  3MAZ A;  2EL8 A;  2OZO A;  1BLK A;  1O4M A;  1X0N A;  5HKZ A;  1CSZ A;  1O4D A;  4H1O A;  3IN7 A;  1BHH B;  4K45 A;  2EYV A;  5HKY A;  3PJP A;  4FL2 A;  1TZE E;  2OQ1 A;  2L6K A;  4K44 A;  4DGX A;  2PTK A;  4A4C A;  2Y1M A;  4FBN A;  4LUD A;  2FO0 A;  2H5K A;  1SHD A;  5IBS A;  1TCE A;  2EOB A;  3T04 A;  4K2R A;  1D4W A;  3HIZ B;  3VRR A;  2AOB A;  1O44 A;  1LUM A;  1R1S A;  3BKB A;  5EHP A;  2QMS A;  4EIH A;  2CS0 A;  3VRN A;  2HDV A;  1JU5 A;  3IMJ A;  2HUW A;  4F59 A;  1OO4 A;  1CWD L;  2CI8 A;  1O46 A;  5EEQ A;  3BUM B;  1G83 A;  1M27 A;  2LNW A;  3M7F A;  1KA7 A;  2EU0 A;  2PLE A;  1AD5 A;  3EAZ A;  1A1B A;  2GSB A;  2CR4 A;  1BF5 A;  2BBU A;  1FU6 A;  1UUS A;  3GQI B;  3CBL A;  4DGP A;  3NHN A;  3HCK A;  4OHE A;  2FCI A;  4OHH A;  5AUL A;  2JYQ A;  3TKZ A;  3OB1 B;  1RJA A;  1AB2 A;  1O4J A;  2C9W A;  1GHU A;  2SRC A;  1JYR A;  1QG1 E;  1LCK A;  5KAZ A;  3EAC A;  2K7A B;  3IMD A;  2DVJ A;  3TL0 A;  3VRP A;  1HCT B;  3UF4 A;  1CSY A;  3CWG A;  5DC4 A;  4A4B A;  2K79 B;  2MRK A;  1AYB A;  1BMB A;  1I3Z A;  1LCJ A;  1YVL A;  2H46 E;  2LCT A;  2Y1N A;  1PIC A;  3CXL A;  3VS3 A;  3OP0 A;  1O4L A;  4GWF A;  4FL3 A;  3VS1 A;  1Y1U A;  1WQU A;  1A81 A;  4X6S A;  1UUR A;  3C7I A;  1RQQ C;  5DC9 A;  2ABL A;  1A1C A;  1JYQ A;  1SKJ A;  1O4C A;  3PSK A;  1FYR A;  2ECD A;  3QWY A;  1ZFP E;  4M4Z A;  1Z3K A;  4OHD A;  2AUG A;  3S9K A;  2RSY A;  1AYA A;  1FMK A;  2XP1 A;  4GPL B;  5J3X A;  1BM2 A;  3N7Y A;  3UYO A;  2PLD A;  3US4 A;  1O43 A;  1O48 A;  1O4P A;  5HKW A;  4U1P A;  3S8N A;  4P9V A;  5BO4 A;  3ZNI A;  1LUI A;  5GJI A;  1BG1 A;  1FU5 A;  3S8O A;  2CIA A;  3VS7 A;  2KK6 A;  1O47 A;  3GXX A;  2EO6 A;  3VRQ A;  3PQZ A;  1BFI A;  1LUN A;  1M61 A;  4QSY A;  3S8L A;  2EYY A;  4ROJ A;  2DM0 A;  3MXC A;  1JYU A;  4F5A A;  2EKX A;  2KNO A; 
#chains in the Genus database with same CATH topology
 1O4O A;  1O4B A;  1OPL A;  1XA6 A;  2IUG A;  2DLY A;  2CI9 A;  4K11 A;  4NWF A;  3BUN B;  1O4Q A;  2PNA A;  1AYC A;  4XZ0 A;  1BHF A;  1MW4 A;  1FBV A;  3PFV A;  5EG3 B;  1HCS B;  1A1A A;  1NZL A;  1F2F A;  1NRV A;  2CRH A;  1X27 A;  4JE4 A;  2C0I A;  2IUI A;  1CJ1 A;  5AXI A;  4EY0 A;  1MIL A;  3VS2 A;  2MQI A;  1Y57 A;  3MXY A;  2C0O A;  1CWE A;  3K2M A;  2DCR A;  2MK2 A;  2HMH A;  4TZI A;  2CBL A;  1K9A A;  2KGY A;  3N84 A;  3BUO B;  1OO3 A;  1JWO A;  3PS5 A;  1RPY A;  1O4G A;  1FHS A;  2DX0 A;  1QCF A;  3N8M A;  3OV1 A;  3VS4 A;  4GL9 E;  4LUE A;  1A1E A;  1O41 A;  1LKK A;  1SPR A;  1BKL A;  1AOT F;  3VS6 A;  2B3O A;  2YU7 A;  4E68 A;  1IS0 A;  2RVF A;  1AYD A;  1D4T A;  2L4K A;  2H8H A;  1SHA A;  1KSW A;  1F1W A;  1A08 A;  3CD3 A;  3BUW B;  1O4F A;  5DC0 B;  1O42 A;  2YSX A;  5DF6 A;  3VRZ A;  1OPK A;  4NWG A;  4L1B B;  2MRJ A;  4JEG A;  1O4I A;  5D0J A;  2EYZ A;  2L3T A;  3QWX X;  3OVE A;  3VRO A;  1BFJ A;  2ETZ A;  2MC1 A;  1O4A A;  3VGO A;  1O49 A;  1O45 A;  2IZV A;  4WWQ A;  1O4N A;  1O4H A;  2ROR A;  2PNB A;  3BUX B;  1GRI A;  1O4R A;  1SPS A;  3KFJ A;  1KA6 A;  2DLZ A;  1O4E A;  4H34 A;  2EO3 A;  1B47 A;  5IBM A;  1BHH A;  3VRY A;  5EHR A;  2RMX A;  1A09 A;  3VS5 A;  4F5B A;  2SHP A;  5GJH A;  3IN8 A;  2AOA A;  2IUH A;  1LUK A;  3PSJ A;  4U17 A;  1BLJ A;  2HDX A;  4XZ1 A;  1KC2 A;  3VS0 A;  1QAD A;  2LQN A;  1NZV A;  1P13 A;  5I6V A;  2LQW A;  1H9O A;  1D1Z A;  3GXW A;  1O4K A;  2LNX A;  1R1P A;  2C0T A;  1A07 A;  2VIF A;  1BKM A;  1SHB A;  2LRA A;  5CDW A;  1X6C A;  2Y3A B;  1IJR A;  1LKL A;  4D8K A;  1R1Q A;  4JGH A;  4OHL A;  4E93 A;  3OB2 B;  5EEL A;  4OHI A;  3WA4 A;  1AOU F;  3PLF B;  3HHM B;  1FBZ A;  2GE9 A;  2HCK A;  1YVH A;  4P9Z A;  3MAZ A;  2EL8 A;  2OZO A;  1BLK A;  1O4M A;  1X0N A;  5HKZ A;  1CSZ A;  1O4D A;  4H1O A;  3IN7 A;  1BHH B;  4K45 A;  2EYV A;  5HKY A;  3PJP A;  4FL2 A;  1TZE E;  2OQ1 A;  2L6K A;  4K44 A;  4DGX A;  2PTK A;  4A4C A;  2Y1M A;  4FBN A;  4LUD A;  2FO0 A;  2H5K A;  1SHD A;  5IBS A;  1TCE A;  2EOB A;  3T04 A;  4K2R A;  1D4W A;  3HIZ B;  3VRR A;  2AOB A;  1O44 A;  1LUM A;  1R1S A;  3BKB A;  5EHP A;  2QMS A;  4EIH A;  2CS0 A;  3VRN A;  2HDV A;  1JU5 A;  3IMJ A;  2HUW A;  4F59 A;  1OO4 A;  1CWD L;  2CI8 A;  1O46 A;  5EEQ A;  3BUM B;  1G83 A;  1M27 A;  2LNW A;  3M7F A;  1KA7 A;  2EU0 A;  2PLE A;  1AD5 A;  3EAZ A;  1A1B A;  2GSB A;  2CR4 A;  1BF5 A;  2BBU A;  1FU6 A;  1UUS A;  3GQI B;  3CBL A;  4DGP A;  3NHN A;  3HCK A;  4OHE A;  2FCI A;  4OHH A;  5AUL A;  2JYQ A;  3TKZ A;  3OB1 B;  1RJA A;  1AB2 A;  1O4J A;  2C9W A;  1GHU A;  2SRC A;  1JYR A;  1QG1 E;  1LCK A;  3LYV A;  3EAC A;  2K7A B;  3IMD A;  2DVJ A;  5KAZ A;  3TL0 A;  3VRP A;  1HCT B;  3UF4 A;  1CSY A;  3CWG A;  5DC4 A;  4A4B A;  2K79 B;  2MRK A;  1AYB A;  1BMB A;  1I3Z A;  1LCJ A;  1YVL A;  2H46 E;  2LCT A;  2Y1N A;  1PIC A;  3CXL A;  3VS3 A;  3OP0 A;  1O4L A;  4GWF A;  4FL3 A;  3VS1 A;  1Y1U A;  1WQU A;  1A81 A;  4X6S A;  1UUR A;  3C7I A;  1RQQ C;  5DC9 A;  2ABL A;  1A1C A;  1JYQ A;  1SKJ A;  1O4C A;  3PSK A;  3K2T A;  1FYR A;  2ECD A;  3QWY A;  1ZFP E;  4M4Z A;  1Z3K A;  4OHD A;  2AUG A;  3S9K A;  2RSY A;  1AYA A;  1FMK A;  2XP1 A;  4GPL B;  5J3X A;  1BM2 A;  3N7Y A;  3UYO A;  2PLD A;  3US4 A;  1O43 A;  1O48 A;  1O4P A;  5HKW A;  4U1P A;  3S8N A;  4P9V A;  5BO4 A;  3ZNI A;  1LUI A;  5GJI A;  1BG1 A;  1FU5 A;  3S8O A;  2CIA A;  3VS7 A;  2KK6 A;  1O47 A;  3GXX A;  2EO6 A;  3VRQ A;  3PQZ A;  1BFI A;  1LUN A;  1M61 A;  4QSY A;  3S8L A;  2EYY A;  4ROJ A;  2DM0 A;  3MXC A;  1JYU A;  4F5A A;  2EKX A;  2KNO A; 
#chains in the Genus database with same CATH homology
 1O4O A;  1O4B A;  1OPL A;  1XA6 A;  2IUG A;  2DLY A;  2CI9 A;  4K11 A;  4NWF A;  3BUN B;  1O4Q A;  2PNA A;  1AYC A;  4XZ0 A;  1BHF A;  1MW4 A;  1FBV A;  3PFV A;  5EG3 B;  1HCS B;  1A1A A;  1NZL A;  1F2F A;  1NRV A;  2CRH A;  1X27 A;  4JE4 A;  2C0I A;  2IUI A;  1CJ1 A;  5AXI A;  4EY0 A;  1MIL A;  3VS2 A;  2MQI A;  1Y57 A;  3MXY A;  2C0O A;  1CWE A;  3K2M A;  2DCR A;  2MK2 A;  2HMH A;  4TZI A;  2CBL A;  1K9A A;  3N84 A;  3BUO B;  1OO3 A;  1JWO A;  3PS5 A;  1RPY A;  1O4G A;  1FHS A;  2DX0 A;  1QCF A;  3N8M A;  3OV1 A;  3VS4 A;  4GL9 E;  4LUE A;  1A1E A;  1O41 A;  1LKK A;  1SPR A;  1BKL A;  1AOT F;  3VS6 A;  2B3O A;  2YU7 A;  4E68 A;  1IS0 A;  2RVF A;  1AYD A;  1D4T A;  2L4K A;  2H8H A;  1SHA A;  1KSW A;  1F1W A;  1A08 A;  3CD3 A;  3BUW B;  1O4F A;  5DC0 B;  1O42 A;  2YSX A;  5DF6 A;  3VRZ A;  1OPK A;  4NWG A;  4L1B B;  2MRJ A;  4JEG A;  1O4I A;  5D0J A;  2EYZ A;  2L3T A;  3QWX X;  3OVE A;  3VRO A;  1BFJ A;  2ETZ A;  2MC1 A;  1O4A A;  3VGO A;  1O49 A;  1O45 A;  2IZV A;  4WWQ A;  1O4N A;  1O4H A;  2ROR A;  2PNB A;  3BUX B;  1GRI A;  1O4R A;  1SPS A;  3KFJ A;  1KA6 A;  2DLZ A;  1O4E A;  4H34 A;  2EO3 A;  1B47 A;  5IBM A;  1BHH A;  3VRY A;  5EHR A;  2RMX A;  1A09 A;  3VS5 A;  4F5B A;  2SHP A;  5GJH A;  3IN8 A;  2AOA A;  2IUH A;  1LUK A;  3PSJ A;  4U17 A;  1BLJ A;  2HDX A;  4XZ1 A;  1KC2 A;  3VS0 A;  1QAD A;  2LQN A;  1NZV A;  1P13 A;  5I6V A;  2LQW A;  1H9O A;  1D1Z A;  3GXW A;  1O4K A;  2LNX A;  1R1P A;  2C0T A;  1A07 A;  2VIF A;  1BKM A;  1SHB A;  5CDW A;  1X6C A;  2Y3A B;  1IJR A;  1LKL A;  4D8K A;  1R1Q A;  4JGH A;  4OHL A;  4E93 A;  3OB2 B;  5EEL A;  4OHI A;  3WA4 A;  1AOU F;  3PLF B;  3HHM B;  1FBZ A;  2GE9 A;  2HCK A;  1YVH A;  4P9Z A;  3MAZ A;  2EL8 A;  2OZO A;  1BLK A;  1O4M A;  1X0N A;  5HKZ A;  1CSZ A;  1O4D A;  4H1O A;  3IN7 A;  1BHH B;  4K45 A;  2EYV A;  5HKY A;  3PJP A;  4FL2 A;  1TZE E;  2OQ1 A;  2L6K A;  4K44 A;  4DGX A;  2PTK A;  4A4C A;  2Y1M A;  4FBN A;  4LUD A;  2FO0 A;  2H5K A;  1SHD A;  5IBS A;  1TCE A;  2EOB A;  3T04 A;  4K2R A;  1D4W A;  3HIZ B;  3VRR A;  2AOB A;  1O44 A;  1LUM A;  1R1S A;  3BKB A;  5EHP A;  2QMS A;  4EIH A;  2CS0 A;  3VRN A;  2HDV A;  1JU5 A;  3IMJ A;  2HUW A;  4F59 A;  1OO4 A;  1CWD L;  2CI8 A;  1O46 A;  5EEQ A;  3BUM B;  1G83 A;  1M27 A;  2LNW A;  3M7F A;  1KA7 A;  2EU0 A;  2PLE A;  1AD5 A;  3EAZ A;  1A1B A;  2GSB A;  2CR4 A;  1BF5 A;  2BBU A;  1FU6 A;  1UUS A;  3GQI B;  3CBL A;  4DGP A;  3NHN A;  3HCK A;  4OHE A;  2FCI A;  4OHH A;  5AUL A;  2JYQ A;  3TKZ A;  3OB1 B;  1RJA A;  1AB2 A;  1O4J A;  2C9W A;  1GHU A;  2SRC A;  1JYR A;  1QG1 E;  1LCK A;  5KAZ A;  3EAC A;  2K7A B;  3IMD A;  2DVJ A;  3TL0 A;  3VRP A;  1HCT B;  3UF4 A;  1CSY A;  3CWG A;  5DC4 A;  4A4B A;  2K79 B;  2MRK A;  1AYB A;  1BMB A;  1I3Z A;  1LCJ A;  1YVL A;  2H46 E;  2LCT A;  2Y1N A;  1PIC A;  3CXL A;  3VS3 A;  3OP0 A;  1O4L A;  4GWF A;  4FL3 A;  3VS1 A;  1Y1U A;  1WQU A;  1A81 A;  4X6S A;  1UUR A;  3C7I A;  1RQQ C;  5DC9 A;  2ABL A;  1A1C A;  1JYQ A;  1SKJ A;  1O4C A;  3PSK A;  1FYR A;  2ECD A;  3QWY A;  1ZFP E;  4M4Z A;  1Z3K A;  4OHD A;  2AUG A;  3S9K A;  2RSY A;  1AYA A;  1FMK A;  2XP1 A;  4GPL B;  5J3X A;  1BM2 A;  3N7Y A;  3UYO A;  2PLD A;  3US4 A;  1O43 A;  1O48 A;  1O4P A;  5HKW A;  4U1P A;  3S8N A;  4P9V A;  5BO4 A;  3ZNI A;  1LUI A;  5GJI A;  1BG1 A;  1FU5 A;  3S8O A;  2CIA A;  3VS7 A;  2KK6 A;  1O47 A;  3GXX A;  2EO6 A;  3VRQ A;  3PQZ A;  1BFI A;  1LUN A;  1M61 A;  4QSY A;  3S8L A;  2EYY A;  4ROJ A;  2DM0 A;  3MXC A;  1JYU A;  4F5A A;  2EKX A;  2KNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...