1O4NA

Crystal structure of sh2 in complex with oxalic acid.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
106
Chain Sequence
SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
publication title Requirements for specific binding of low affinity inhibitor fragments to the SH2 domain of (pp60)Src are identical to those for high affinity binding of full length inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 106
sequence length 106
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1o4nA00
3OP0A 2H46E 1I3ZA 1SPSA 2CI9A 1QG1E 4JGHA 1AB2A 4EIHA 1RQQC 1CWEA 1YVHA 1O4HA 3VS6A 3BUNB 1AOUF 2EYYA 2RVFA 3IMJA 2CI8A 4OHHA 4WWQA 1UUSA 1O44A 4FBNA 4D8KA 1MILA 2EYVA 2RSYA 3CXLA 2DM0A 1BLKA 4LUEA 3HHMB 4F5AA 1BLJA 4FL3A 4U1PA 2ECDA 1OPKA 1LCJA 1CWDL 3IN7A 2OZOA 1A81A 4FL2A 2EO3A 1JYQA 2EYZA 1NZVA 4OHEA 1ZFPE 2SHPA 3UF4A 1SKJA 3GXWA 3N84A 5IBMA 1MW4A 1O4OA 2GSBA 3MXYA 2DVJA 4TZIA 4E68A 2YSXA 1O48A 1A07A 3BUMB 1AD5A 2KK6A 2DLZA 1KA6A 2LNWA 2PLDA 1LCKA 1A1BA 2MK2A 2EU0A 1H9OA 5HKYA 1BFIA 2H8HA 1OPLA 1O4DA 4DGPA 1M27A 3VS3A 1A1AA 4LUDA 3PSKA 2MC1A 2AUGA 2HUWA 1JWOA 1FU5A 1SHDA 2PTKA 4OHLA 1AOTF 3UYOA 2IZVA 1KSWA 1TZEE 3QWXX 2K7AB 2DLYA 1X0NA 3OV1A 2AOBA 3M7FA 2MRKA 1O4RA 3VS5A 2L6KA 1AYAA 1BKLA 3TKZA 1OO4A 1O47A 2LCTA 5CDWA 4F5BA 1FBVA 1O41A 3VS0A 3S9KA 1UURA 1AYCA 1O42A 2MQIA 1JU5A 1Z3KA 1SHBA 1O4KA 3GXXA 3OB2B 4XZ1A 1QADA 3N7YA 1O4AA 4M4ZA 1LKLA 4ROJA 1G83A 2CIAA 5BO4A 2C0IA 3BUOB 1LUMA 1O4GA 2IUIA 4GPLB 2LNXA 5DC0B 1D1ZA 1O4IA 5GJIA 2HDXA 2L4KA 5DC9A 2CBLA 3PS5A 3VRZA 4F59A 3CWGA 2EKXA 3VRPA 5KAZA 3WA4A 2HMHA 5DF6A 1D4WA 1CSZA 1FU6A 3KFJA 1O4NA 3VROA 1B47A 3CD3A 1R1SA 2QMSA 3PLFB 5DC4A 2EOBA 5GJHA 3VRNA 1JYUA 1LUKA 1BHFA 3CBLA 2ETZA 1IJRA 2JYQA 1O4JA 3VRRA 1P13A 1SHAA 1F1WA 4H1OA 5D0JA 1BF5A 3HCKA 3OVEA 2EL8A 1NZLA 4GWFA 3S8NA 1JYRA 4K44A 3VS4A 1QCFA 5HKWA 3K2MA 4XZ0A 3VS1A 1O4MA 5EG3B 2C9WA 3PJPA 1LUIA 4L1BB 1NRVA 1FBZA 1XA6A 2YU7A 2GE9A 2VIFA 2ABLA 3VS2A 2PLEA 3TL0A 2L3TA 5EHPA 1BFJA 1A08A 4OHDA 1AYBA 1A09A 1O4LA 4EY0A 5IBSA 1O43A 5EELA 1BHHA 1PICA 3PSJA 1X27A 3VRYA 2HCKA 3BUWB 2DCRA 4QSYA 2H5KA 1SPRA 1O46A 3ZNIA 1TCEA 4K2RA 1O4FA 1BM2A 4H34A 2CR4A 1KA7A 3US4A 2IUGA 3PQZA 3BKBA 1D4TA 1FMKA 3C7IA 4JEGA 3EAZA 2IUHA 2C0OA 2CS0A 3VRQA 3EACA 1R1PA 2LQWA 1HCTB 4P9ZA 5AXIA 2LQNA 4JE4A 4E93A 1F2FA 1BG1A 2KNOA 1RJAA 5J3XA 1O4PA 1M61A 2RMXA 2FO0A 1O45A 1AYDA 4GL9E 1O4BA 4A4CA 3VS7A 3MXCA 1Y57A 3VGOA 1GRIA 2Y1MA 4NWGA 1O4QA 1OO3A 2PNAA 4A4BA 1R1QA 2BBUA 1CSYA 3BUXB 5HKZA 1FHSA 1A1CA 2B3OA 2MRJA 2DX0A 5EHRA 2FCIA 4P9VA 3IN8A 4K45A 2C0TA 2SRCA 1FYRA 1CJ1A 1O4EA 3OB1B 3IMDA 5AULA 3NHNA 4DGXA 1WQUA 5I6VA 2OQ1A 3S8OA 1LUNA 2Y3AB 1BMBA 2Y1NA 1O4CA 3MAZA 3HIZB 2RORA 5EEQA 4K11A 2PNBA 1K9AA 1KC2A 2CRHA 1X6CA 2K79B 4U17A 1O49A 2AOAA 1IS0A 3GQIB 2XP1A 1RPYA 3T04A 1A1EA 2EO6A 3QWYA 4OHIA 4X6SA 1LKKA 3S8LA 4NWFA 1GHUA 3N8MA 3PFVA 1BKMA 1Y1UA 1YVLA 1BHHB 2HDVA 1HCSB
chains in the Genus database with same CATH superfamily
3OP0A 2H46E 1I3ZA 1SPSA 2CI9A 1QG1E 4JGHA 1AB2A 4EIHA 1RQQC 1CWEA 1YVHA 1O4HA 3VS6A 3BUNB 1AOUF 2EYYA 2RVFA 3IMJA 2CI8A 4OHHA 4WWQA 1UUSA 1O44A 4FBNA 4D8KA 1MILA 2EYVA 2RSYA 3CXLA 2DM0A 1BLKA 4LUEA 3HHMB 4F5AA 1BLJA 4FL3A 4U1PA 2ECDA 1OPKA 1LCJA 1CWDL 3IN7A 2OZOA 1A81A 4FL2A 2EO3A 1JYQA 2EYZA 1NZVA 4OHEA 1ZFPE 2SHPA 3UF4A 1SKJA 3GXWA 3N84A 5IBMA 1MW4A 1O4OA 2GSBA 3MXYA 2DVJA 4TZIA 4E68A 2YSXA 1O48A 1A07A 3BUMB 1AD5A 2KK6A 2DLZA 1KA6A 2LNWA 2PLDA 1LCKA 1A1BA 2MK2A 2EU0A 1H9OA 5HKYA 1BFIA 2H8HA 1OPLA 1O4DA 4DGPA 1M27A 3VS3A 1A1AA 4LUDA 3PSKA 2MC1A 2AUGA 2HUWA 1JWOA 1FU5A 1SHDA 2PTKA 4OHLA 1AOTF 3UYOA 2IZVA 1KSWA 1TZEE 3QWXX 2K7AB 2DLYA 1X0NA 3OV1A 2AOBA 3M7FA 2MRKA 1O4RA 3VS5A 2L6KA 1AYAA 1BKLA 3TKZA 1OO4A 1O47A 2LCTA 5CDWA 4F5BA 1FBVA 1O41A 3VS0A 3S9KA 1UURA 1AYCA 1O42A 2MQIA 1JU5A 1Z3KA 1SHBA 1O4KA 2KGYA 3GXXA 3OB2B 4XZ1A 1QADA 3N7YA 1O4AA 4M4ZA 1LKLA 4ROJA 1G83A 2CIAA 5BO4A 2C0IA 3BUOB 1LUMA 1O4GA 2IUIA 4GPLB 2LNXA 5DC0B 1D1ZA 1O4IA 5GJIA 2HDXA 2L4KA 5DC9A 2CBLA 3PS5A 3VRZA 4F59A 3CWGA 2EKXA 3VRPA 5KAZA 3WA4A 2HMHA 5DF6A 1D4WA 2LRAA 1CSZA 1FU6A 3KFJA 1O4NA 3VROA 1B47A 3CD3A 1R1SA 2QMSA 3PLFB 5DC4A 2EOBA 5GJHA 3VRNA 1JYUA 1LUKA 1BHFA 3CBLA 2ETZA 1IJRA 2JYQA 1O4JA 3VRRA 1P13A 1SHAA 1F1WA 4H1OA 5D0JA 1BF5A 3HCKA 3OVEA 2EL8A 1NZLA 4GWFA 3S8NA 1JYRA 4K44A 3VS4A 1QCFA 5HKWA 3K2MA 4XZ0A 3VS1A 1O4MA 5EG3B 2C9WA 3PJPA 1LUIA 4L1BB 1NRVA 1FBZA 1XA6A 2YU7A 2GE9A 2VIFA 2ABLA 3VS2A 2PLEA 3TL0A 2L3TA 5EHPA 1BFJA 1A08A 4OHDA 1AYBA 1A09A 1O4LA 4EY0A 5IBSA 1O43A 5EELA 1BHHA 1PICA 3PSJA 1X27A 3VRYA 2HCKA 3BUWB 2DCRA 4QSYA 2H5KA 1SPRA 1O46A 3ZNIA 1TCEA 4K2RA 3K2TA 1O4FA 1BM2A 4H34A 2CR4A 1KA7A 3US4A 2IUGA 3PQZA 3BKBA 1D4TA 1FMKA 3C7IA 4JEGA 3EAZA 2IUHA 2C0OA 2CS0A 3VRQA 3EACA 1R1PA 2LQWA 1HCTB 4P9ZA 5AXIA 2LQNA 4JE4A 4E93A 1F2FA 1BG1A 2KNOA 1RJAA 5J3XA 1O4PA 1M61A 2RMXA 2FO0A 1O45A 1AYDA 4GL9E 1O4BA 4A4CA 3VS7A 3MXCA 1Y57A 3VGOA 1GRIA 2Y1MA 4NWGA 1O4QA 1OO3A 2PNAA 4A4BA 1R1QA 2BBUA 1CSYA 3BUXB 5HKZA 1FHSA 1A1CA 2B3OA 2MRJA 2DX0A 5EHRA 2FCIA 4P9VA 3IN8A 4K45A 2C0TA 2SRCA 1FYRA 1CJ1A 1O4EA 3OB1B 3IMDA 5AULA 3NHNA 4DGXA 1WQUA 5I6VA 2OQ1A 3S8OA 1LUNA 2Y3AB 1BMBA 2Y1NA 1O4CA 3MAZA 3HIZB 2RORA 5EEQA 4K11A 3LYVA 2PNBA 1K9AA 1KC2A 2CRHA 1X6CA 2K79B 4U17A 1O49A 2AOAA 1IS0A 3GQIB 2XP1A 1RPYA 3T04A 1A1EA 2EO6A 3QWYA 4OHIA 4X6SA 1LKKA 3S8LA 4NWFA 1GHUA 3N8MA 3PFVA 1BKMA 1Y1UA 1YVLA 1BHHB 2HDVA 1HCSB
chains in the Genus database with same CATH topology
3OP0A 2H46E 1I3ZA 1SPSA 2CI9A 1QG1E 4JGHA 1AB2A 4EIHA 1RQQC 1CWEA 1YVHA 1O4HA 3VS6A 3BUNB 1AOUF 2EYYA 2RVFA 3IMJA 2CI8A 4OHHA 4WWQA 1UUSA 1O44A 4FBNA 4D8KA 1MILA 2EYVA 2RSYA 3CXLA 2DM0A 1BLKA 4LUEA 3HHMB 4F5AA 1BLJA 4FL3A 4U1PA 2ECDA 1OPKA 1LCJA 1CWDL 3IN7A 2OZOA 1A81A 4FL2A 2EO3A 1JYQA 2EYZA 1NZVA 4OHEA 1ZFPE 2SHPA 3UF4A 1SKJA 3GXWA 3N84A 5IBMA 1MW4A 1O4OA 2GSBA 3MXYA 2DVJA 4TZIA 4E68A 2YSXA 1O48A 1A07A 3BUMB 1AD5A 2KK6A 2DLZA 1KA6A 2LNWA 2PLDA 1LCKA 1A1BA 2MK2A 2EU0A 1H9OA 5HKYA 1BFIA 2H8HA 1OPLA 1O4DA 4DGPA 1M27A 3VS3A 1A1AA 4LUDA 3PSKA 2MC1A 2AUGA 2HUWA 1JWOA 1FU5A 1SHDA 2PTKA 4OHLA 1AOTF 3UYOA 2IZVA 1KSWA 1TZEE 3QWXX 2K7AB 2DLYA 1X0NA 3OV1A 2AOBA 3M7FA 2MRKA 1O4RA 3VS5A 2L6KA 1AYAA 1BKLA 3TKZA 1OO4A 1O47A 2LCTA 5CDWA 4F5BA 1FBVA 1O41A 3VS0A 3S9KA 1UURA 1AYCA 1O42A 2MQIA 1JU5A 1Z3KA 1SHBA 1O4KA 3GXXA 3OB2B 4XZ1A 1QADA 3N7YA 1O4AA 4M4ZA 1LKLA 4ROJA 1G83A 2CIAA 5BO4A 2C0IA 3BUOB 1LUMA 1O4GA 2IUIA 4GPLB 2LNXA 5DC0B 1D1ZA 1O4IA 5GJIA 2HDXA 2L4KA 5DC9A 2CBLA 3PS5A 3VRZA 4F59A 3CWGA 2EKXA 3VRPA 5KAZA 3WA4A 2HMHA 5DF6A 1D4WA 1CSZA 1FU6A 3KFJA 1O4NA 3VROA 1B47A 3CD3A 1R1SA 2QMSA 3PLFB 5DC4A 2EOBA 5GJHA 3VRNA 1JYUA 1LUKA 1BHFA 3CBLA 2ETZA 1IJRA 2JYQA 1O4JA 3VRRA 1P13A 1SHAA 1F1WA 4H1OA 5D0JA 1BF5A 3HCKA 3OVEA 2EL8A 1NZLA 4GWFA 3S8NA 1JYRA 4K44A 3VS4A 1QCFA 5HKWA 3K2MA 4XZ0A 3VS1A 1O4MA 5EG3B 2C9WA 3PJPA 1LUIA 4L1BB 1NRVA 1FBZA 1XA6A 2YU7A 2GE9A 2VIFA 2ABLA 3VS2A 2PLEA 3TL0A 2L3TA 5EHPA 1BFJA 1A08A 4OHDA 1AYBA 1A09A 1O4LA 4EY0A 5IBSA 1O43A 5EELA 1BHHA 1PICA 3PSJA 1X27A 3VRYA 2HCKA 3BUWB 2DCRA 4QSYA 2H5KA 1SPRA 1O46A 3ZNIA 1TCEA 4K2RA 1O4FA 1BM2A 4H34A 2CR4A 1KA7A 3US4A 2IUGA 3PQZA 3BKBA 1D4TA 1FMKA 3C7IA 4JEGA 3EAZA 2IUHA 2C0OA 2CS0A 3VRQA 3EACA 1R1PA 2LQWA 1HCTB 4P9ZA 5AXIA 2LQNA 4JE4A 4E93A 1F2FA 1BG1A 2KNOA 1RJAA 5J3XA 1O4PA 1M61A 2RMXA 2FO0A 1O45A 1AYDA 4GL9E 1O4BA 4A4CA 3VS7A 3MXCA 1Y57A 3VGOA 1GRIA 2Y1MA 4NWGA 1O4QA 1OO3A 2PNAA 4A4BA 1R1QA 2BBUA 1CSYA 3BUXB 5HKZA 1FHSA 1A1CA 2B3OA 2MRJA 2DX0A 5EHRA 2FCIA 4P9VA 3IN8A 4K45A 2C0TA 2SRCA 1FYRA 1CJ1A 1O4EA 3OB1B 3IMDA 5AULA 3NHNA 4DGXA 1WQUA 5I6VA 2OQ1A 3S8OA 1LUNA 2Y3AB 1BMBA 2Y1NA 1O4CA 3MAZA 3HIZB 2RORA 5EEQA 4K11A 2PNBA 1K9AA 1KC2A 2CRHA 1X6CA 2K79B 4U17A 1O49A 2AOAA 1IS0A 3GQIB 2XP1A 1RPYA 3T04A 1A1EA 2EO6A 3QWYA 4OHIA 4X6SA 1LKKA 3S8LA 4NWFA 1GHUA 3N8MA 3PFVA 1BKMA 1Y1UA 1YVLA 1BHHB 2HDVA 1HCSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OP0 A;  2H46 E;  1I3Z A;  1SPS A;  2CI9 A;  1QG1 E;  4JGH A;  1AB2 A;  4EIH A;  1RQQ C;  1CWE A;  1YVH A;  1O4H A;  3VS6 A;  3BUN B;  1AOU F;  2EYY A;  2RVF A;  3IMJ A;  2CI8 A;  4OHH A;  4WWQ A;  1UUS A;  1O44 A;  4FBN A;  4D8K A;  1MIL A;  2EYV A;  2RSY A;  3CXL A;  2DM0 A;  1BLK A;  4LUE A;  3HHM B;  4F5A A;  1BLJ A;  4FL3 A;  4U1P A;  2ECD A;  1OPK A;  1LCJ A;  1CWD L;  3IN7 A;  2OZO A;  1A81 A;  4FL2 A;  2EO3 A;  1JYQ A;  2EYZ A;  1NZV A;  4OHE A;  1ZFP E;  2SHP A;  3UF4 A;  1SKJ A;  3GXW A;  3N84 A;  5IBM A;  1MW4 A;  1O4O A;  2GSB A;  3MXY A;  2DVJ A;  4TZI A;  4E68 A;  2YSX A;  1O48 A;  1A07 A;  3BUM B;  1AD5 A;  2KK6 A;  2DLZ A;  1KA6 A;  2LNW A;  2PLD A;  1LCK A;  1A1B A;  2MK2 A;  2EU0 A;  1H9O A;  5HKY A;  1BFI A;  2H8H A;  1OPL A;  1O4D A;  4DGP A;  1M27 A;  3VS3 A;  1A1A A;  4LUD A;  3PSK A;  2MC1 A;  2AUG A;  2HUW A;  1JWO A;  1FU5 A;  1SHD A;  2PTK A;  4OHL A;  1AOT F;  3UYO A;  2IZV A;  1KSW A;  1TZE E;  3QWX X;  2K7A B;  2DLY A;  1X0N A;  3OV1 A;  2AOB A;  3M7F A;  2MRK A;  1O4R A;  3VS5 A;  2L6K A;  1AYA A;  1BKL A;  3TKZ A;  1OO4 A;  1O47 A;  2LCT A;  5CDW A;  4F5B A;  1FBV A;  1O41 A;  3VS0 A;  3S9K A;  1UUR A;  1AYC A;  1O42 A;  2MQI A;  1JU5 A;  1Z3K A;  1SHB A;  1O4K A;  3GXX A;  3OB2 B;  4XZ1 A;  1QAD A;  3N7Y A;  1O4A A;  4M4Z A;  1LKL A;  4ROJ A;  1G83 A;  2CIA A;  5BO4 A;  2C0I A;  3BUO B;  1LUM A;  1O4G A;  2IUI A;  4GPL B;  2LNX A;  5DC0 B;  1D1Z A;  1O4I A;  5GJI A;  2HDX A;  2L4K A;  5DC9 A;  2CBL A;  3PS5 A;  3VRZ A;  4F59 A;  3CWG A;  2EKX A;  3VRP A;  5KAZ A;  3WA4 A;  2HMH A;  5DF6 A;  1D4W A;  1CSZ A;  1FU6 A;  3KFJ A;  1O4N A;  3VRO A;  1B47 A;  3CD3 A;  1R1S A;  2QMS A;  3PLF B;  5DC4 A;  2EOB A;  5GJH A;  3VRN A;  1JYU A;  1LUK A;  1BHF A;  3CBL A;  2ETZ A;  1IJR A;  2JYQ A;  1O4J A;  3VRR A;  1P13 A;  1SHA A;  1F1W A;  4H1O A;  5D0J A;  1BF5 A;  3HCK A;  3OVE A;  2EL8 A;  1NZL A;  4GWF A;  3S8N A;  1JYR A;  4K44 A;  3VS4 A;  1QCF A;  5HKW A;  3K2M A;  4XZ0 A;  3VS1 A;  1O4M A;  5EG3 B;  2C9W A;  3PJP A;  1LUI A;  4L1B B;  1NRV A;  1FBZ A;  1XA6 A;  2YU7 A;  2GE9 A;  2VIF A;  2ABL A;  3VS2 A;  2PLE A;  3TL0 A;  2L3T A;  5EHP A;  1BFJ A;  1A08 A;  4OHD A;  1AYB A;  1A09 A;  1O4L A;  4EY0 A;  5IBS A;  1O43 A;  5EEL A;  1BHH A;  1PIC A;  3PSJ A;  1X27 A;  3VRY A;  2HCK A;  3BUW B;  2DCR A;  4QSY A;  2H5K A;  1SPR A;  1O46 A;  3ZNI A;  1TCE A;  4K2R A;  1O4F A;  1BM2 A;  4H34 A;  2CR4 A;  1KA7 A;  3US4 A;  2IUG A;  3PQZ A;  3BKB A;  1D4T A;  1FMK A;  3C7I A;  4JEG A;  3EAZ A;  2IUH A;  2C0O A;  2CS0 A;  3VRQ A;  3EAC A;  1R1P A;  2LQW A;  1HCT B;  4P9Z A;  5AXI A;  2LQN A;  4JE4 A;  4E93 A;  1F2F A;  1BG1 A;  2KNO A;  1RJA A;  5J3X A;  1O4P A;  1M61 A;  2RMX A;  2FO0 A;  1O45 A;  1AYD A;  4GL9 E;  1O4B A;  4A4C A;  3VS7 A;  3MXC A;  1Y57 A;  3VGO A;  1GRI A;  2Y1M A;  4NWG A;  1O4Q A;  1OO3 A;  2PNA A;  4A4B A;  1R1Q A;  2BBU A;  1CSY A;  3BUX B;  5HKZ A;  1FHS A;  1A1C A;  2B3O A;  2MRJ A;  2DX0 A;  5EHR A;  2FCI A;  4P9V A;  3IN8 A;  4K45 A;  2C0T A;  2SRC A;  1FYR A;  1CJ1 A;  1O4E A;  3OB1 B;  3IMD A;  5AUL A;  3NHN A;  4DGX A;  1WQU A;  5I6V A;  2OQ1 A;  3S8O A;  1LUN A;  2Y3A B;  1BMB A;  2Y1N A;  1O4C A;  3MAZ A;  3HIZ B;  2ROR A;  5EEQ A;  4K11 A;  2PNB A;  1K9A A;  1KC2 A;  2CRH A;  1X6C A;  2K79 B;  4U17 A;  1O49 A;  2AOA A;  1IS0 A;  3GQI B;  2XP1 A;  1RPY A;  3T04 A;  1A1E A;  2EO6 A;  3QWY A;  4OHI A;  4X6S A;  1LKK A;  3S8L A;  4NWF A;  1GHU A;  3N8M A;  3PFV A;  1BKM A;  1Y1U A;  1YVL A;  1BHH B;  2HDV A;  1HCS B; 
#chains in the Genus database with same CATH topology
 3OP0 A;  2H46 E;  1I3Z A;  1SPS A;  2CI9 A;  1QG1 E;  4JGH A;  1AB2 A;  4EIH A;  1RQQ C;  1CWE A;  1YVH A;  1O4H A;  3VS6 A;  3BUN B;  1AOU F;  2EYY A;  2RVF A;  3IMJ A;  2CI8 A;  4OHH A;  4WWQ A;  1UUS A;  1O44 A;  4FBN A;  4D8K A;  1MIL A;  2EYV A;  2RSY A;  3CXL A;  2DM0 A;  1BLK A;  4LUE A;  3HHM B;  4F5A A;  1BLJ A;  4FL3 A;  4U1P A;  2ECD A;  1OPK A;  1LCJ A;  1CWD L;  3IN7 A;  2OZO A;  1A81 A;  4FL2 A;  2EO3 A;  1JYQ A;  2EYZ A;  1NZV A;  4OHE A;  1ZFP E;  2SHP A;  3UF4 A;  1SKJ A;  3GXW A;  3N84 A;  5IBM A;  1MW4 A;  1O4O A;  2GSB A;  3MXY A;  2DVJ A;  4TZI A;  4E68 A;  2YSX A;  1O48 A;  1A07 A;  3BUM B;  1AD5 A;  2KK6 A;  2DLZ A;  1KA6 A;  2LNW A;  2PLD A;  1LCK A;  1A1B A;  2MK2 A;  2EU0 A;  1H9O A;  5HKY A;  1BFI A;  2H8H A;  1OPL A;  1O4D A;  4DGP A;  1M27 A;  3VS3 A;  1A1A A;  4LUD A;  3PSK A;  2MC1 A;  2AUG A;  2HUW A;  1JWO A;  1FU5 A;  1SHD A;  2PTK A;  4OHL A;  1AOT F;  3UYO A;  2IZV A;  1KSW A;  1TZE E;  3QWX X;  2K7A B;  2DLY A;  1X0N A;  3OV1 A;  2AOB A;  3M7F A;  2MRK A;  1O4R A;  3VS5 A;  2L6K A;  1AYA A;  1BKL A;  3TKZ A;  1OO4 A;  1O47 A;  2LCT A;  5CDW A;  4F5B A;  1FBV A;  1O41 A;  3VS0 A;  3S9K A;  1UUR A;  1AYC A;  1O42 A;  2MQI A;  1JU5 A;  1Z3K A;  1SHB A;  1O4K A;  2KGY A;  3GXX A;  3OB2 B;  4XZ1 A;  1QAD A;  3N7Y A;  1O4A A;  4M4Z A;  1LKL A;  4ROJ A;  1G83 A;  2CIA A;  5BO4 A;  2C0I A;  3BUO B;  1LUM A;  1O4G A;  2IUI A;  4GPL B;  2LNX A;  5DC0 B;  1D1Z A;  1O4I A;  5GJI A;  2HDX A;  2L4K A;  5DC9 A;  2CBL A;  3PS5 A;  3VRZ A;  4F59 A;  3CWG A;  2EKX A;  3VRP A;  5KAZ A;  3WA4 A;  2HMH A;  5DF6 A;  1D4W A;  2LRA A;  1CSZ A;  1FU6 A;  3KFJ A;  1O4N A;  3VRO A;  1B47 A;  3CD3 A;  1R1S A;  2QMS A;  3PLF B;  5DC4 A;  2EOB A;  5GJH A;  3VRN A;  1JYU A;  1LUK A;  1BHF A;  3CBL A;  2ETZ A;  1IJR A;  2JYQ A;  1O4J A;  3VRR A;  1P13 A;  1SHA A;  1F1W A;  4H1O A;  5D0J A;  1BF5 A;  3HCK A;  3OVE A;  2EL8 A;  1NZL A;  4GWF A;  3S8N A;  1JYR A;  4K44 A;  3VS4 A;  1QCF A;  5HKW A;  3K2M A;  4XZ0 A;  3VS1 A;  1O4M A;  5EG3 B;  2C9W A;  3PJP A;  1LUI A;  4L1B B;  1NRV A;  1FBZ A;  1XA6 A;  2YU7 A;  2GE9 A;  2VIF A;  2ABL A;  3VS2 A;  2PLE A;  3TL0 A;  2L3T A;  5EHP A;  1BFJ A;  1A08 A;  4OHD A;  1AYB A;  1A09 A;  1O4L A;  4EY0 A;  5IBS A;  1O43 A;  5EEL A;  1BHH A;  1PIC A;  3PSJ A;  1X27 A;  3VRY A;  2HCK A;  3BUW B;  2DCR A;  4QSY A;  2H5K A;  1SPR A;  1O46 A;  3ZNI A;  1TCE A;  4K2R A;  3K2T A;  1O4F A;  1BM2 A;  4H34 A;  2CR4 A;  1KA7 A;  3US4 A;  2IUG A;  3PQZ A;  3BKB A;  1D4T A;  1FMK A;  3C7I A;  4JEG A;  3EAZ A;  2IUH A;  2C0O A;  2CS0 A;  3VRQ A;  3EAC A;  1R1P A;  2LQW A;  1HCT B;  4P9Z A;  5AXI A;  2LQN A;  4JE4 A;  4E93 A;  1F2F A;  1BG1 A;  2KNO A;  1RJA A;  5J3X A;  1O4P A;  1M61 A;  2RMX A;  2FO0 A;  1O45 A;  1AYD A;  4GL9 E;  1O4B A;  4A4C A;  3VS7 A;  3MXC A;  1Y57 A;  3VGO A;  1GRI A;  2Y1M A;  4NWG A;  1O4Q A;  1OO3 A;  2PNA A;  4A4B A;  1R1Q A;  2BBU A;  1CSY A;  3BUX B;  5HKZ A;  1FHS A;  1A1C A;  2B3O A;  2MRJ A;  2DX0 A;  5EHR A;  2FCI A;  4P9V A;  3IN8 A;  4K45 A;  2C0T A;  2SRC A;  1FYR A;  1CJ1 A;  1O4E A;  3OB1 B;  3IMD A;  5AUL A;  3NHN A;  4DGX A;  1WQU A;  5I6V A;  2OQ1 A;  3S8O A;  1LUN A;  2Y3A B;  1BMB A;  2Y1N A;  1O4C A;  3MAZ A;  3HIZ B;  2ROR A;  5EEQ A;  4K11 A;  3LYV A;  2PNB A;  1K9A A;  1KC2 A;  2CRH A;  1X6C A;  2K79 B;  4U17 A;  1O49 A;  2AOA A;  1IS0 A;  3GQI B;  2XP1 A;  1RPY A;  3T04 A;  1A1E A;  2EO6 A;  3QWY A;  4OHI A;  4X6S A;  1LKK A;  3S8L A;  4NWF A;  1GHU A;  3N8M A;  3PFV A;  1BKM A;  1Y1U A;  1YVL A;  1BHH B;  2HDV A;  1HCS B; 
#chains in the Genus database with same CATH homology
 3OP0 A;  2H46 E;  1I3Z A;  1SPS A;  2CI9 A;  1QG1 E;  4JGH A;  1AB2 A;  4EIH A;  1RQQ C;  1CWE A;  1YVH A;  1O4H A;  3VS6 A;  3BUN B;  1AOU F;  2EYY A;  2RVF A;  3IMJ A;  2CI8 A;  4OHH A;  4WWQ A;  1UUS A;  1O44 A;  4FBN A;  4D8K A;  1MIL A;  2EYV A;  2RSY A;  3CXL A;  2DM0 A;  1BLK A;  4LUE A;  3HHM B;  4F5A A;  1BLJ A;  4FL3 A;  4U1P A;  2ECD A;  1OPK A;  1LCJ A;  1CWD L;  3IN7 A;  2OZO A;  1A81 A;  4FL2 A;  2EO3 A;  1JYQ A;  2EYZ A;  1NZV A;  4OHE A;  1ZFP E;  2SHP A;  3UF4 A;  1SKJ A;  3GXW A;  3N84 A;  5IBM A;  1MW4 A;  1O4O A;  2GSB A;  3MXY A;  2DVJ A;  4TZI A;  4E68 A;  2YSX A;  1O48 A;  1A07 A;  3BUM B;  1AD5 A;  2KK6 A;  2DLZ A;  1KA6 A;  2LNW A;  2PLD A;  1LCK A;  1A1B A;  2MK2 A;  2EU0 A;  1H9O A;  5HKY A;  1BFI A;  2H8H A;  1OPL A;  1O4D A;  4DGP A;  1M27 A;  3VS3 A;  1A1A A;  4LUD A;  3PSK A;  2MC1 A;  2AUG A;  2HUW A;  1JWO A;  1FU5 A;  1SHD A;  2PTK A;  4OHL A;  1AOT F;  3UYO A;  2IZV A;  1KSW A;  1TZE E;  3QWX X;  2K7A B;  2DLY A;  1X0N A;  3OV1 A;  2AOB A;  3M7F A;  2MRK A;  1O4R A;  3VS5 A;  2L6K A;  1AYA A;  1BKL A;  3TKZ A;  1OO4 A;  1O47 A;  2LCT A;  5CDW A;  4F5B A;  1FBV A;  1O41 A;  3VS0 A;  3S9K A;  1UUR A;  1AYC A;  1O42 A;  2MQI A;  1JU5 A;  1Z3K A;  1SHB A;  1O4K A;  3GXX A;  3OB2 B;  4XZ1 A;  1QAD A;  3N7Y A;  1O4A A;  4M4Z A;  1LKL A;  4ROJ A;  1G83 A;  2CIA A;  5BO4 A;  2C0I A;  3BUO B;  1LUM A;  1O4G A;  2IUI A;  4GPL B;  2LNX A;  5DC0 B;  1D1Z A;  1O4I A;  5GJI A;  2HDX A;  2L4K A;  5DC9 A;  2CBL A;  3PS5 A;  3VRZ A;  4F59 A;  3CWG A;  2EKX A;  3VRP A;  5KAZ A;  3WA4 A;  2HMH A;  5DF6 A;  1D4W A;  1CSZ A;  1FU6 A;  3KFJ A;  1O4N A;  3VRO A;  1B47 A;  3CD3 A;  1R1S A;  2QMS A;  3PLF B;  5DC4 A;  2EOB A;  5GJH A;  3VRN A;  1JYU A;  1LUK A;  1BHF A;  3CBL A;  2ETZ A;  1IJR A;  2JYQ A;  1O4J A;  3VRR A;  1P13 A;  1SHA A;  1F1W A;  4H1O A;  5D0J A;  1BF5 A;  3HCK A;  3OVE A;  2EL8 A;  1NZL A;  4GWF A;  3S8N A;  1JYR A;  4K44 A;  3VS4 A;  1QCF A;  5HKW A;  3K2M A;  4XZ0 A;  3VS1 A;  1O4M A;  5EG3 B;  2C9W A;  3PJP A;  1LUI A;  4L1B B;  1NRV A;  1FBZ A;  1XA6 A;  2YU7 A;  2GE9 A;  2VIF A;  2ABL A;  3VS2 A;  2PLE A;  3TL0 A;  2L3T A;  5EHP A;  1BFJ A;  1A08 A;  4OHD A;  1AYB A;  1A09 A;  1O4L A;  4EY0 A;  5IBS A;  1O43 A;  5EEL A;  1BHH A;  1PIC A;  3PSJ A;  1X27 A;  3VRY A;  2HCK A;  3BUW B;  2DCR A;  4QSY A;  2H5K A;  1SPR A;  1O46 A;  3ZNI A;  1TCE A;  4K2R A;  1O4F A;  1BM2 A;  4H34 A;  2CR4 A;  1KA7 A;  3US4 A;  2IUG A;  3PQZ A;  3BKB A;  1D4T A;  1FMK A;  3C7I A;  4JEG A;  3EAZ A;  2IUH A;  2C0O A;  2CS0 A;  3VRQ A;  3EAC A;  1R1P A;  2LQW A;  1HCT B;  4P9Z A;  5AXI A;  2LQN A;  4JE4 A;  4E93 A;  1F2F A;  1BG1 A;  2KNO A;  1RJA A;  5J3X A;  1O4P A;  1M61 A;  2RMX A;  2FO0 A;  1O45 A;  1AYD A;  4GL9 E;  1O4B A;  4A4C A;  3VS7 A;  3MXC A;  1Y57 A;  3VGO A;  1GRI A;  2Y1M A;  4NWG A;  1O4Q A;  1OO3 A;  2PNA A;  4A4B A;  1R1Q A;  2BBU A;  1CSY A;  3BUX B;  5HKZ A;  1FHS A;  1A1C A;  2B3O A;  2MRJ A;  2DX0 A;  5EHR A;  2FCI A;  4P9V A;  3IN8 A;  4K45 A;  2C0T A;  2SRC A;  1FYR A;  1CJ1 A;  1O4E A;  3OB1 B;  3IMD A;  5AUL A;  3NHN A;  4DGX A;  1WQU A;  5I6V A;  2OQ1 A;  3S8O A;  1LUN A;  2Y3A B;  1BMB A;  2Y1N A;  1O4C A;  3MAZ A;  3HIZ B;  2ROR A;  5EEQ A;  4K11 A;  2PNB A;  1K9A A;  1KC2 A;  2CRH A;  1X6C A;  2K79 B;  4U17 A;  1O49 A;  2AOA A;  1IS0 A;  3GQI B;  2XP1 A;  1RPY A;  3T04 A;  1A1E A;  2EO6 A;  3QWY A;  4OHI A;  4X6S A;  1LKK A;  3S8L A;  4NWF A;  1GHU A;  3N8M A;  3PFV A;  1BKM A;  1Y1U A;  1YVL A;  1BHH B;  2HDV A;  1HCS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...