1OO4A

P395s mutant of the p85 regulatory subunit of the n-terminal src homology 2 domain of pi3-kinase complexed to a peptide derived from pdgfr
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
111
structure length
111
Chain Sequence
GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKSIKIFHRDGKYGFSDSLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Phosphatidylinositol 3-kinase regulatory alpha subunit
publication title Nuclear magnetic resonance structure of the P395S mutant of the N-SH2 domain of the p85 subunit of PI3 kinase: an SH2 domain with altered specificity
pubmed doi rcsb
source organism Bos taurus
total genus 16
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2003-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1oo4A00
5AULA 1O4IA 2RVFA 2B3OA 1LCKA 1IS0A 2PLDA 4OHIA 1NZVA 2AOAA 4E68A 2EO3A 2SRCA 1A09A 1HCTB 5I6VA 2EO6A 1LKKA 2CRHA 1F2FA 5EHPA 4OHLA 1FMKA 3PLFB 5EELA 1SPRA 1GRIA 4F5AA 3OVEA 4D8KA 4EY0A 4X6SA 1BG1A 1A1AA 1LUIA 5HKZA 4A4CA 1B47A 1RJAA 1AYCA 2FCIA 4K2RA 5DC9A 3NHNA 1O4AA 4GL9E 3KFJA 1O41A 4NWGA 1BM2A 1O46A 1JWOA 1AB2A 2PLEA 1LUMA 4DGXA 1O4PA 1OPKA 1O4JA 1O45A 2CR4A 1O42A 3BUOB 2K79B 3WA4A 1A1CA 1AYDA 1O4HA 5GJIA 1O4MA 2GSBA 2ABLA 1A08A 2EYZA 1O4BA 1FHSA 1BFJA 5EHRA 3MAZA 2H5KA 1FBZA 1SHBA 2LQNA 5KAZA 1D4TA 1M27A 3GXWA 3PFVA 1G83A 3N84A 3VS7A 2RSYA 2AOBA 3BUXB 1PICA 2EKXA 3VS6A 1BHHB 3GQIB 1KC2A 1K9AA 2PNAA 4K45A 1CSYA 2CI9A 3ZNIA 1X6CA 4E93A 1O4LA 2BBUA 3VRYA 3PJPA 1H9OA 3BUNB 2LNWA 1QCFA 3S9KA 1AOUF 3VRPA 2H8HA 1BHFA 1O48A 1GHUA 3N7YA 4F5BA 2CBLA 2IUGA 5HKWA 4LUDA 3T04A 1CWEA 1FU6A 2L3TA 4OHDA 4GWFA 1I3ZA 3IN7A 4K11A 2AUGA 4U17A 5GJHA 3VRRA 1BKMA 3VRZA 2KNOA 1WQUA 3HCKA 4DGPA 1Y57A 1BLJA 3PSJA 3MXCA 2GE9A 2IUHA 3CD3A 4QSYA 3MXYA 5HKYA 1Z3KA 4FBNA 3VS2A 1JYUA 3M7FA 1FYRA 2SHPA 2EU0A 1OO4A 2LNXA 1UUSA 3K2MA 1SPSA 5J3XA 3UYOA 3UF4A 2MC1A 4P9ZA 1XA6A 1O4NA 4JEGA 1TCEA 3HIZB 1A07A 3OB1B 3EACA 2Y1MA 3C7IA 5DF6A 2QMSA 1KA6A 1R1QA 3VS1A 1MW4A 5IBSA 1SKJA 2DLYA 3VS4A 4JGHA 2EYVA 1KSWA 1P13A 4WWQA 1SHDA 1TZEE 3CWGA 1YVLA 4EIHA 1FU5A 1MILA 2DM0A 2CS0A 1LKLA 4P9VA 2DLZA 4M4ZA 1QADA 1Y1UA 1RPYA 4L1BB 1RQQC 1CSZA 1BHHA 1O44A 2PNBA 2L4KA 3GXXA 2C0IA 2H46E 3QWYA 1CWDL 2C0TA 1SHAA 2VIFA 4FL3A 1LUKA 2OZOA 2EL8A 3BKBA 2HDXA 1O4GA 2K7AB 2MK2A 3S8LA 1JYRA 1R1SA 2DVJA 2HDVA 1NZLA 3HHMB 5IBMA 3CBLA 2RORA 4JE4A 2FO0A 4H34A 3TL0A 2CIAA 5BO4A 5DC0B 1O4DA 1LCJA 1A1BA 5CDWA 1OO3A 1A81A 5EG3B 2PTKA 1LUNA 1BF5A 1D1ZA 1O4QA 2YU7A 2HUWA 3VS0A 5EEQA 3N8MA 3VS3A 1BKLA 3CXLA 1ZFPE 3IN8A 4A4BA 3VRQA 3PS5A 4F59A 1AOTF 4ROJA 2LCTA 2L6KA 4U1PA 3S8OA 1QG1E 1BFIA 1UURA 2EOBA 2RMXA 3PQZA 2JYQA 4FL2A 4NWFA 2HMHA 4K44A 1O4EA 2LQWA 1BMBA 1YVHA 4GPLB 1AD5A 1OPLA 1AYBA 1CJ1A 1D4WA 1KA7A 5D0JA 3VGOA 1O4OA 5AXIA 4LUEA 1O4FA 3BUWB 3OB2B 1AYAA 1FBVA 2DCRA 2ETZA 2OQ1A 4H1OA 3IMJA 1HCSB 1O4KA 1JYQA 1IJRA 2MRJA 2Y1NA 2C9WA 1O4CA 3US4A 2CI8A 2Y3AB 2ECDA 3EAZA 2IUIA 4XZ0A 3S8NA 1F1WA 1NRVA 2EYYA 4XZ1A 3BUMB 3IMDA 3OV1A 1M61A 1JU5A 3VROA 2MQIA 4OHEA 3PSKA 3VS5A 2DX0A 2YSXA 3OP0A 1X0NA 1O47A 5DC4A 1R1PA 1A1EA 1O49A 1X27A 2HCKA 1O4RA 2C0OA 1O43A 2XP1A 3VRNA 1BLKA 4TZIA 3TKZA 2IZVA 2KK6A 3QWXX 4OHHA 2MRKA
chains in the Genus database with same CATH superfamily
5AULA 1O4IA 2RVFA 2B3OA 1LCKA 1IS0A 2PLDA 4OHIA 1NZVA 2LRAA 2AOAA 4E68A 2EO3A 2SRCA 1A09A 1HCTB 5I6VA 2EO6A 1LKKA 2CRHA 1F2FA 5EHPA 4OHLA 1FMKA 3PLFB 5EELA 1SPRA 1GRIA 4F5AA 3OVEA 4D8KA 4EY0A 4X6SA 1BG1A 1A1AA 1LUIA 5HKZA 4A4CA 1B47A 1RJAA 1AYCA 2FCIA 4K2RA 5DC9A 3NHNA 1O4AA 4GL9E 3KFJA 1O41A 4NWGA 1BM2A 1O46A 1JWOA 1AB2A 2PLEA 3LYVA 1LUMA 4DGXA 1O4PA 1OPKA 1O4JA 1O45A 2CR4A 1O42A 3BUOB 2K79B 3WA4A 1A1CA 1AYDA 1O4HA 5GJIA 1O4MA 2GSBA 2ABLA 1A08A 2EYZA 1O4BA 1FHSA 1BFJA 5EHRA 3MAZA 2H5KA 1FBZA 1SHBA 2LQNA 5KAZA 1D4TA 1M27A 3GXWA 3PFVA 1G83A 3N84A 3VS7A 2RSYA 2AOBA 3BUXB 1PICA 2EKXA 3VS6A 1BHHB 3GQIB 1KC2A 1K9AA 2PNAA 4K45A 3K2TA 1CSYA 2CI9A 3ZNIA 1X6CA 4E93A 1O4LA 2BBUA 3VRYA 3PJPA 1H9OA 3BUNB 2LNWA 1QCFA 3S9KA 1AOUF 3VRPA 2H8HA 1BHFA 1O48A 1GHUA 3N7YA 4F5BA 2CBLA 2IUGA 5HKWA 4LUDA 3T04A 1CWEA 1FU6A 2L3TA 4OHDA 4GWFA 1I3ZA 3IN7A 4K11A 2AUGA 4U17A 5GJHA 3VRRA 1BKMA 3VRZA 2KNOA 1WQUA 3HCKA 4DGPA 1Y57A 1BLJA 3PSJA 2KGYA 3MXCA 2GE9A 2IUHA 3CD3A 4QSYA 3MXYA 5HKYA 1Z3KA 4FBNA 3VS2A 1JYUA 3M7FA 1FYRA 2SHPA 2EU0A 1OO4A 2LNXA 1UUSA 3K2MA 1SPSA 5J3XA 3UYOA 3UF4A 2MC1A 4P9ZA 1XA6A 1O4NA 4JEGA 1TCEA 3HIZB 1A07A 3OB1B 3EACA 2Y1MA 3C7IA 5DF6A 2QMSA 1KA6A 1R1QA 3VS1A 1MW4A 5IBSA 1SKJA 2DLYA 3VS4A 4JGHA 2EYVA 1KSWA 1P13A 4WWQA 1SHDA 1TZEE 3CWGA 1YVLA 4EIHA 1FU5A 1MILA 2DM0A 2CS0A 1LKLA 4P9VA 2DLZA 4M4ZA 1QADA 1Y1UA 1RPYA 4L1BB 1RQQC 1CSZA 1BHHA 1O44A 2PNBA 2L4KA 3GXXA 2C0IA 2H46E 3QWYA 1CWDL 2C0TA 1SHAA 2VIFA 4FL3A 1LUKA 2OZOA 2EL8A 3BKBA 2HDXA 1O4GA 2K7AB 2MK2A 3S8LA 1JYRA 1R1SA 2DVJA 2HDVA 1NZLA 3HHMB 5IBMA 3CBLA 2RORA 4JE4A 2FO0A 4H34A 3TL0A 2CIAA 5BO4A 5DC0B 1O4DA 1LCJA 1A1BA 5CDWA 1OO3A 1A81A 5EG3B 2PTKA 1LUNA 1BF5A 1D1ZA 1O4QA 2YU7A 2HUWA 3VS0A 5EEQA 3N8MA 3VS3A 1BKLA 3CXLA 1ZFPE 3IN8A 4A4BA 3VRQA 3PS5A 4F59A 1AOTF 4ROJA 2LCTA 2L6KA 4U1PA 3S8OA 1QG1E 1BFIA 1UURA 2EOBA 2RMXA 3PQZA 2JYQA 4FL2A 4NWFA 2HMHA 4K44A 1O4EA 2LQWA 1BMBA 1YVHA 4GPLB 1AD5A 1OPLA 1AYBA 1CJ1A 1D4WA 1KA7A 5D0JA 3VGOA 1O4OA 5AXIA 4LUEA 1O4FA 3BUWB 3OB2B 1AYAA 1FBVA 2DCRA 2ETZA 2OQ1A 4H1OA 3IMJA 1HCSB 1O4KA 1JYQA 1IJRA 2MRJA 2Y1NA 2C9WA 1O4CA 3US4A 2CI8A 2Y3AB 2ECDA 3EAZA 2IUIA 4XZ0A 3S8NA 1F1WA 1NRVA 2EYYA 4XZ1A 3BUMB 3IMDA 3OV1A 1M61A 1JU5A 3VROA 2MQIA 4OHEA 3PSKA 3VS5A 2DX0A 2YSXA 3OP0A 1X0NA 1O47A 5DC4A 1R1PA 1A1EA 1O49A 1X27A 2HCKA 1O4RA 2C0OA 1O43A 2XP1A 3VRNA 1BLKA 4TZIA 3TKZA 2IZVA 2KK6A 3QWXX 4OHHA 2MRKA
chains in the Genus database with same CATH topology
5AULA 1O4IA 2RVFA 2B3OA 1LCKA 1IS0A 2PLDA 4OHIA 1NZVA 2AOAA 4E68A 2EO3A 2SRCA 1A09A 1HCTB 5I6VA 2EO6A 1LKKA 2CRHA 1F2FA 5EHPA 4OHLA 1FMKA 3PLFB 5EELA 1SPRA 1GRIA 4F5AA 3OVEA 4D8KA 4EY0A 4X6SA 1BG1A 1A1AA 1LUIA 5HKZA 4A4CA 1B47A 1RJAA 1AYCA 2FCIA 4K2RA 5DC9A 3NHNA 1O4AA 4GL9E 3KFJA 1O41A 4NWGA 1BM2A 1O46A 1JWOA 1AB2A 2PLEA 1LUMA 4DGXA 1O4PA 1OPKA 1O4JA 1O45A 2CR4A 1O42A 3BUOB 2K79B 3WA4A 1A1CA 1AYDA 1O4HA 5GJIA 1O4MA 2GSBA 2ABLA 1A08A 2EYZA 1O4BA 1FHSA 1BFJA 5EHRA 3MAZA 2H5KA 1FBZA 1SHBA 2LQNA 5KAZA 1D4TA 1M27A 3GXWA 3PFVA 1G83A 3N84A 3VS7A 2RSYA 2AOBA 3BUXB 1PICA 2EKXA 3VS6A 1BHHB 3GQIB 1KC2A 1K9AA 2PNAA 4K45A 1CSYA 2CI9A 3ZNIA 1X6CA 4E93A 1O4LA 2BBUA 3VRYA 3PJPA 1H9OA 3BUNB 2LNWA 1QCFA 3S9KA 1AOUF 3VRPA 2H8HA 1BHFA 1O48A 1GHUA 3N7YA 4F5BA 2CBLA 2IUGA 5HKWA 4LUDA 3T04A 1CWEA 1FU6A 2L3TA 4OHDA 4GWFA 1I3ZA 3IN7A 4K11A 2AUGA 4U17A 5GJHA 3VRRA 1BKMA 3VRZA 2KNOA 1WQUA 3HCKA 4DGPA 1Y57A 1BLJA 3PSJA 3MXCA 2GE9A 2IUHA 3CD3A 4QSYA 3MXYA 5HKYA 1Z3KA 4FBNA 3VS2A 1JYUA 3M7FA 1FYRA 2SHPA 2EU0A 1OO4A 2LNXA 1UUSA 3K2MA 1SPSA 5J3XA 3UYOA 3UF4A 2MC1A 4P9ZA 1XA6A 1O4NA 4JEGA 1TCEA 3HIZB 1A07A 3OB1B 3EACA 2Y1MA 3C7IA 5DF6A 2QMSA 1KA6A 1R1QA 3VS1A 1MW4A 5IBSA 1SKJA 2DLYA 3VS4A 4JGHA 2EYVA 1KSWA 1P13A 4WWQA 1SHDA 1TZEE 3CWGA 1YVLA 4EIHA 1FU5A 1MILA 2DM0A 2CS0A 1LKLA 4P9VA 2DLZA 4M4ZA 1QADA 1Y1UA 1RPYA 4L1BB 1RQQC 1CSZA 1BHHA 1O44A 2PNBA 2L4KA 3GXXA 2C0IA 2H46E 3QWYA 1CWDL 2C0TA 1SHAA 2VIFA 4FL3A 1LUKA 2OZOA 2EL8A 3BKBA 2HDXA 1O4GA 2K7AB 2MK2A 3S8LA 1JYRA 1R1SA 2DVJA 2HDVA 1NZLA 3HHMB 5IBMA 3CBLA 2RORA 4JE4A 2FO0A 4H34A 3TL0A 2CIAA 5BO4A 5DC0B 1O4DA 1LCJA 1A1BA 5CDWA 1OO3A 1A81A 5EG3B 2PTKA 1LUNA 1BF5A 1D1ZA 1O4QA 2YU7A 2HUWA 3VS0A 5EEQA 3N8MA 3VS3A 1BKLA 3CXLA 1ZFPE 3IN8A 4A4BA 3VRQA 3PS5A 4F59A 1AOTF 4ROJA 2LCTA 2L6KA 4U1PA 3S8OA 1QG1E 1BFIA 1UURA 2EOBA 2RMXA 3PQZA 2JYQA 4FL2A 4NWFA 2HMHA 4K44A 1O4EA 2LQWA 1BMBA 1YVHA 4GPLB 1AD5A 1OPLA 1AYBA 1CJ1A 1D4WA 1KA7A 5D0JA 3VGOA 1O4OA 5AXIA 4LUEA 1O4FA 3BUWB 3OB2B 1AYAA 1FBVA 2DCRA 2ETZA 2OQ1A 4H1OA 3IMJA 1HCSB 1O4KA 1JYQA 1IJRA 2MRJA 2Y1NA 2C9WA 1O4CA 3US4A 2CI8A 2Y3AB 2ECDA 3EAZA 2IUIA 4XZ0A 3S8NA 1F1WA 1NRVA 2EYYA 4XZ1A 3BUMB 3IMDA 3OV1A 1M61A 1JU5A 3VROA 2MQIA 4OHEA 3PSKA 3VS5A 2DX0A 2YSXA 3OP0A 1X0NA 1O47A 5DC4A 1R1PA 1A1EA 1O49A 1X27A 2HCKA 1O4RA 2C0OA 1O43A 2XP1A 3VRNA 1BLKA 4TZIA 3TKZA 2IZVA 2KK6A 3QWXX 4OHHA 2MRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AUL A;  1O4I A;  2RVF A;  2B3O A;  1LCK A;  1IS0 A;  2PLD A;  4OHI A;  1NZV A;  2AOA A;  4E68 A;  2EO3 A;  2SRC A;  1A09 A;  1HCT B;  5I6V A;  2EO6 A;  1LKK A;  2CRH A;  1F2F A;  5EHP A;  4OHL A;  1FMK A;  3PLF B;  5EEL A;  1SPR A;  1GRI A;  4F5A A;  3OVE A;  4D8K A;  4EY0 A;  4X6S A;  1BG1 A;  1A1A A;  1LUI A;  5HKZ A;  4A4C A;  1B47 A;  1RJA A;  1AYC A;  2FCI A;  4K2R A;  5DC9 A;  3NHN A;  1O4A A;  4GL9 E;  3KFJ A;  1O41 A;  4NWG A;  1BM2 A;  1O46 A;  1JWO A;  1AB2 A;  2PLE A;  1LUM A;  4DGX A;  1O4P A;  1OPK A;  1O4J A;  1O45 A;  2CR4 A;  1O42 A;  3BUO B;  2K79 B;  3WA4 A;  1A1C A;  1AYD A;  1O4H A;  5GJI A;  1O4M A;  2GSB A;  2ABL A;  1A08 A;  2EYZ A;  1O4B A;  1FHS A;  1BFJ A;  5EHR A;  3MAZ A;  2H5K A;  1FBZ A;  1SHB A;  2LQN A;  5KAZ A;  1D4T A;  1M27 A;  3GXW A;  3PFV A;  1G83 A;  3N84 A;  3VS7 A;  2RSY A;  2AOB A;  3BUX B;  1PIC A;  2EKX A;  3VS6 A;  1BHH B;  3GQI B;  1KC2 A;  1K9A A;  2PNA A;  4K45 A;  1CSY A;  2CI9 A;  3ZNI A;  1X6C A;  4E93 A;  1O4L A;  2BBU A;  3VRY A;  3PJP A;  1H9O A;  3BUN B;  2LNW A;  1QCF A;  3S9K A;  1AOU F;  3VRP A;  2H8H A;  1BHF A;  1O48 A;  1GHU A;  3N7Y A;  4F5B A;  2CBL A;  2IUG A;  5HKW A;  4LUD A;  3T04 A;  1CWE A;  1FU6 A;  2L3T A;  4OHD A;  4GWF A;  1I3Z A;  3IN7 A;  4K11 A;  2AUG A;  4U17 A;  5GJH A;  3VRR A;  1BKM A;  3VRZ A;  2KNO A;  1WQU A;  3HCK A;  4DGP A;  1Y57 A;  1BLJ A;  3PSJ A;  3MXC A;  2GE9 A;  2IUH A;  3CD3 A;  4QSY A;  3MXY A;  5HKY A;  1Z3K A;  4FBN A;  3VS2 A;  1JYU A;  3M7F A;  1FYR A;  2SHP A;  2EU0 A;  1OO4 A;  2LNX A;  1UUS A;  3K2M A;  1SPS A;  5J3X A;  3UYO A;  3UF4 A;  2MC1 A;  4P9Z A;  1XA6 A;  1O4N A;  4JEG A;  1TCE A;  3HIZ B;  1A07 A;  3OB1 B;  3EAC A;  2Y1M A;  3C7I A;  5DF6 A;  2QMS A;  1KA6 A;  1R1Q A;  3VS1 A;  1MW4 A;  5IBS A;  1SKJ A;  2DLY A;  3VS4 A;  4JGH A;  2EYV A;  1KSW A;  1P13 A;  4WWQ A;  1SHD A;  1TZE E;  3CWG A;  1YVL A;  4EIH A;  1FU5 A;  1MIL A;  2DM0 A;  2CS0 A;  1LKL A;  4P9V A;  2DLZ A;  4M4Z A;  1QAD A;  1Y1U A;  1RPY A;  4L1B B;  1RQQ C;  1CSZ A;  1BHH A;  1O44 A;  2PNB A;  2L4K A;  3GXX A;  2C0I A;  2H46 E;  3QWY A;  1CWD L;  2C0T A;  1SHA A;  2VIF A;  4FL3 A;  1LUK A;  2OZO A;  2EL8 A;  3BKB A;  2HDX A;  1O4G A;  2K7A B;  2MK2 A;  3S8L A;  1JYR A;  1R1S A;  2DVJ A;  2HDV A;  1NZL A;  3HHM B;  5IBM A;  3CBL A;  2ROR A;  4JE4 A;  2FO0 A;  4H34 A;  3TL0 A;  2CIA A;  5BO4 A;  5DC0 B;  1O4D A;  1LCJ A;  1A1B A;  5CDW A;  1OO3 A;  1A81 A;  5EG3 B;  2PTK A;  1LUN A;  1BF5 A;  1D1Z A;  1O4Q A;  2YU7 A;  2HUW A;  3VS0 A;  5EEQ A;  3N8M A;  3VS3 A;  1BKL A;  3CXL A;  1ZFP E;  3IN8 A;  4A4B A;  3VRQ A;  3PS5 A;  4F59 A;  1AOT F;  4ROJ A;  2LCT A;  2L6K A;  4U1P A;  3S8O A;  1QG1 E;  1BFI A;  1UUR A;  2EOB A;  2RMX A;  3PQZ A;  2JYQ A;  4FL2 A;  4NWF A;  2HMH A;  4K44 A;  1O4E A;  2LQW A;  1BMB A;  1YVH A;  4GPL B;  1AD5 A;  1OPL A;  1AYB A;  1CJ1 A;  1D4W A;  1KA7 A;  5D0J A;  3VGO A;  1O4O A;  5AXI A;  4LUE A;  1O4F A;  3BUW B;  3OB2 B;  1AYA A;  1FBV A;  2DCR A;  2ETZ A;  2OQ1 A;  4H1O A;  3IMJ A;  1HCS B;  1O4K A;  1JYQ A;  1IJR A;  2MRJ A;  2Y1N A;  2C9W A;  1O4C A;  3US4 A;  2CI8 A;  2Y3A B;  2ECD A;  3EAZ A;  2IUI A;  4XZ0 A;  3S8N A;  1F1W A;  1NRV A;  2EYY A;  4XZ1 A;  3BUM B;  3IMD A;  3OV1 A;  1M61 A;  1JU5 A;  3VRO A;  2MQI A;  4OHE A;  3PSK A;  3VS5 A;  2DX0 A;  2YSX A;  3OP0 A;  1X0N A;  1O47 A;  5DC4 A;  1R1P A;  1A1E A;  1O49 A;  1X27 A;  2HCK A;  1O4R A;  2C0O A;  1O43 A;  2XP1 A;  3VRN A;  1BLK A;  4TZI A;  3TKZ A;  2IZV A;  2KK6 A;  3QWX X;  4OHH A;  2MRK A; 
#chains in the Genus database with same CATH topology
 5AUL A;  1O4I A;  2RVF A;  2B3O A;  1LCK A;  1IS0 A;  2PLD A;  4OHI A;  1NZV A;  2LRA A;  2AOA A;  4E68 A;  2EO3 A;  2SRC A;  1A09 A;  1HCT B;  5I6V A;  2EO6 A;  1LKK A;  2CRH A;  1F2F A;  5EHP A;  4OHL A;  1FMK A;  3PLF B;  5EEL A;  1SPR A;  1GRI A;  4F5A A;  3OVE A;  4D8K A;  4EY0 A;  4X6S A;  1BG1 A;  1A1A A;  1LUI A;  5HKZ A;  4A4C A;  1B47 A;  1RJA A;  1AYC A;  2FCI A;  4K2R A;  5DC9 A;  3NHN A;  1O4A A;  4GL9 E;  3KFJ A;  1O41 A;  4NWG A;  1BM2 A;  1O46 A;  1JWO A;  1AB2 A;  2PLE A;  3LYV A;  1LUM A;  4DGX A;  1O4P A;  1OPK A;  1O4J A;  1O45 A;  2CR4 A;  1O42 A;  3BUO B;  2K79 B;  3WA4 A;  1A1C A;  1AYD A;  1O4H A;  5GJI A;  1O4M A;  2GSB A;  2ABL A;  1A08 A;  2EYZ A;  1O4B A;  1FHS A;  1BFJ A;  5EHR A;  3MAZ A;  2H5K A;  1FBZ A;  1SHB A;  2LQN A;  5KAZ A;  1D4T A;  1M27 A;  3GXW A;  3PFV A;  1G83 A;  3N84 A;  3VS7 A;  2RSY A;  2AOB A;  3BUX B;  1PIC A;  2EKX A;  3VS6 A;  1BHH B;  3GQI B;  1KC2 A;  1K9A A;  2PNA A;  4K45 A;  3K2T A;  1CSY A;  2CI9 A;  3ZNI A;  1X6C A;  4E93 A;  1O4L A;  2BBU A;  3VRY A;  3PJP A;  1H9O A;  3BUN B;  2LNW A;  1QCF A;  3S9K A;  1AOU F;  3VRP A;  2H8H A;  1BHF A;  1O48 A;  1GHU A;  3N7Y A;  4F5B A;  2CBL A;  2IUG A;  5HKW A;  4LUD A;  3T04 A;  1CWE A;  1FU6 A;  2L3T A;  4OHD A;  4GWF A;  1I3Z A;  3IN7 A;  4K11 A;  2AUG A;  4U17 A;  5GJH A;  3VRR A;  1BKM A;  3VRZ A;  2KNO A;  1WQU A;  3HCK A;  4DGP A;  1Y57 A;  1BLJ A;  3PSJ A;  2KGY A;  3MXC A;  2GE9 A;  2IUH A;  3CD3 A;  4QSY A;  3MXY A;  5HKY A;  1Z3K A;  4FBN A;  3VS2 A;  1JYU A;  3M7F A;  1FYR A;  2SHP A;  2EU0 A;  1OO4 A;  2LNX A;  1UUS A;  3K2M A;  1SPS A;  5J3X A;  3UYO A;  3UF4 A;  2MC1 A;  4P9Z A;  1XA6 A;  1O4N A;  4JEG A;  1TCE A;  3HIZ B;  1A07 A;  3OB1 B;  3EAC A;  2Y1M A;  3C7I A;  5DF6 A;  2QMS A;  1KA6 A;  1R1Q A;  3VS1 A;  1MW4 A;  5IBS A;  1SKJ A;  2DLY A;  3VS4 A;  4JGH A;  2EYV A;  1KSW A;  1P13 A;  4WWQ A;  1SHD A;  1TZE E;  3CWG A;  1YVL A;  4EIH A;  1FU5 A;  1MIL A;  2DM0 A;  2CS0 A;  1LKL A;  4P9V A;  2DLZ A;  4M4Z A;  1QAD A;  1Y1U A;  1RPY A;  4L1B B;  1RQQ C;  1CSZ A;  1BHH A;  1O44 A;  2PNB A;  2L4K A;  3GXX A;  2C0I A;  2H46 E;  3QWY A;  1CWD L;  2C0T A;  1SHA A;  2VIF A;  4FL3 A;  1LUK A;  2OZO A;  2EL8 A;  3BKB A;  2HDX A;  1O4G A;  2K7A B;  2MK2 A;  3S8L A;  1JYR A;  1R1S A;  2DVJ A;  2HDV A;  1NZL A;  3HHM B;  5IBM A;  3CBL A;  2ROR A;  4JE4 A;  2FO0 A;  4H34 A;  3TL0 A;  2CIA A;  5BO4 A;  5DC0 B;  1O4D A;  1LCJ A;  1A1B A;  5CDW A;  1OO3 A;  1A81 A;  5EG3 B;  2PTK A;  1LUN A;  1BF5 A;  1D1Z A;  1O4Q A;  2YU7 A;  2HUW A;  3VS0 A;  5EEQ A;  3N8M A;  3VS3 A;  1BKL A;  3CXL A;  1ZFP E;  3IN8 A;  4A4B A;  3VRQ A;  3PS5 A;  4F59 A;  1AOT F;  4ROJ A;  2LCT A;  2L6K A;  4U1P A;  3S8O A;  1QG1 E;  1BFI A;  1UUR A;  2EOB A;  2RMX A;  3PQZ A;  2JYQ A;  4FL2 A;  4NWF A;  2HMH A;  4K44 A;  1O4E A;  2LQW A;  1BMB A;  1YVH A;  4GPL B;  1AD5 A;  1OPL A;  1AYB A;  1CJ1 A;  1D4W A;  1KA7 A;  5D0J A;  3VGO A;  1O4O A;  5AXI A;  4LUE A;  1O4F A;  3BUW B;  3OB2 B;  1AYA A;  1FBV A;  2DCR A;  2ETZ A;  2OQ1 A;  4H1O A;  3IMJ A;  1HCS B;  1O4K A;  1JYQ A;  1IJR A;  2MRJ A;  2Y1N A;  2C9W A;  1O4C A;  3US4 A;  2CI8 A;  2Y3A B;  2ECD A;  3EAZ A;  2IUI A;  4XZ0 A;  3S8N A;  1F1W A;  1NRV A;  2EYY A;  4XZ1 A;  3BUM B;  3IMD A;  3OV1 A;  1M61 A;  1JU5 A;  3VRO A;  2MQI A;  4OHE A;  3PSK A;  3VS5 A;  2DX0 A;  2YSX A;  3OP0 A;  1X0N A;  1O47 A;  5DC4 A;  1R1P A;  1A1E A;  1O49 A;  1X27 A;  2HCK A;  1O4R A;  2C0O A;  1O43 A;  2XP1 A;  3VRN A;  1BLK A;  4TZI A;  3TKZ A;  2IZV A;  2KK6 A;  3QWX X;  4OHH A;  2MRK A; 
#chains in the Genus database with same CATH homology
 5AUL A;  1O4I A;  2RVF A;  2B3O A;  1LCK A;  1IS0 A;  2PLD A;  4OHI A;  1NZV A;  2AOA A;  4E68 A;  2EO3 A;  2SRC A;  1A09 A;  1HCT B;  5I6V A;  2EO6 A;  1LKK A;  2CRH A;  1F2F A;  5EHP A;  4OHL A;  1FMK A;  3PLF B;  5EEL A;  1SPR A;  1GRI A;  4F5A A;  3OVE A;  4D8K A;  4EY0 A;  4X6S A;  1BG1 A;  1A1A A;  1LUI A;  5HKZ A;  4A4C A;  1B47 A;  1RJA A;  1AYC A;  2FCI A;  4K2R A;  5DC9 A;  3NHN A;  1O4A A;  4GL9 E;  3KFJ A;  1O41 A;  4NWG A;  1BM2 A;  1O46 A;  1JWO A;  1AB2 A;  2PLE A;  1LUM A;  4DGX A;  1O4P A;  1OPK A;  1O4J A;  1O45 A;  2CR4 A;  1O42 A;  3BUO B;  2K79 B;  3WA4 A;  1A1C A;  1AYD A;  1O4H A;  5GJI A;  1O4M A;  2GSB A;  2ABL A;  1A08 A;  2EYZ A;  1O4B A;  1FHS A;  1BFJ A;  5EHR A;  3MAZ A;  2H5K A;  1FBZ A;  1SHB A;  2LQN A;  5KAZ A;  1D4T A;  1M27 A;  3GXW A;  3PFV A;  1G83 A;  3N84 A;  3VS7 A;  2RSY A;  2AOB A;  3BUX B;  1PIC A;  2EKX A;  3VS6 A;  1BHH B;  3GQI B;  1KC2 A;  1K9A A;  2PNA A;  4K45 A;  1CSY A;  2CI9 A;  3ZNI A;  1X6C A;  4E93 A;  1O4L A;  2BBU A;  3VRY A;  3PJP A;  1H9O A;  3BUN B;  2LNW A;  1QCF A;  3S9K A;  1AOU F;  3VRP A;  2H8H A;  1BHF A;  1O48 A;  1GHU A;  3N7Y A;  4F5B A;  2CBL A;  2IUG A;  5HKW A;  4LUD A;  3T04 A;  1CWE A;  1FU6 A;  2L3T A;  4OHD A;  4GWF A;  1I3Z A;  3IN7 A;  4K11 A;  2AUG A;  4U17 A;  5GJH A;  3VRR A;  1BKM A;  3VRZ A;  2KNO A;  1WQU A;  3HCK A;  4DGP A;  1Y57 A;  1BLJ A;  3PSJ A;  3MXC A;  2GE9 A;  2IUH A;  3CD3 A;  4QSY A;  3MXY A;  5HKY A;  1Z3K A;  4FBN A;  3VS2 A;  1JYU A;  3M7F A;  1FYR A;  2SHP A;  2EU0 A;  1OO4 A;  2LNX A;  1UUS A;  3K2M A;  1SPS A;  5J3X A;  3UYO A;  3UF4 A;  2MC1 A;  4P9Z A;  1XA6 A;  1O4N A;  4JEG A;  1TCE A;  3HIZ B;  1A07 A;  3OB1 B;  3EAC A;  2Y1M A;  3C7I A;  5DF6 A;  2QMS A;  1KA6 A;  1R1Q A;  3VS1 A;  1MW4 A;  5IBS A;  1SKJ A;  2DLY A;  3VS4 A;  4JGH A;  2EYV A;  1KSW A;  1P13 A;  4WWQ A;  1SHD A;  1TZE E;  3CWG A;  1YVL A;  4EIH A;  1FU5 A;  1MIL A;  2DM0 A;  2CS0 A;  1LKL A;  4P9V A;  2DLZ A;  4M4Z A;  1QAD A;  1Y1U A;  1RPY A;  4L1B B;  1RQQ C;  1CSZ A;  1BHH A;  1O44 A;  2PNB A;  2L4K A;  3GXX A;  2C0I A;  2H46 E;  3QWY A;  1CWD L;  2C0T A;  1SHA A;  2VIF A;  4FL3 A;  1LUK A;  2OZO A;  2EL8 A;  3BKB A;  2HDX A;  1O4G A;  2K7A B;  2MK2 A;  3S8L A;  1JYR A;  1R1S A;  2DVJ A;  2HDV A;  1NZL A;  3HHM B;  5IBM A;  3CBL A;  2ROR A;  4JE4 A;  2FO0 A;  4H34 A;  3TL0 A;  2CIA A;  5BO4 A;  5DC0 B;  1O4D A;  1LCJ A;  1A1B A;  5CDW A;  1OO3 A;  1A81 A;  5EG3 B;  2PTK A;  1LUN A;  1BF5 A;  1D1Z A;  1O4Q A;  2YU7 A;  2HUW A;  3VS0 A;  5EEQ A;  3N8M A;  3VS3 A;  1BKL A;  3CXL A;  1ZFP E;  3IN8 A;  4A4B A;  3VRQ A;  3PS5 A;  4F59 A;  1AOT F;  4ROJ A;  2LCT A;  2L6K A;  4U1P A;  3S8O A;  1QG1 E;  1BFI A;  1UUR A;  2EOB A;  2RMX A;  3PQZ A;  2JYQ A;  4FL2 A;  4NWF A;  2HMH A;  4K44 A;  1O4E A;  2LQW A;  1BMB A;  1YVH A;  4GPL B;  1AD5 A;  1OPL A;  1AYB A;  1CJ1 A;  1D4W A;  1KA7 A;  5D0J A;  3VGO A;  1O4O A;  5AXI A;  4LUE A;  1O4F A;  3BUW B;  3OB2 B;  1AYA A;  1FBV A;  2DCR A;  2ETZ A;  2OQ1 A;  4H1O A;  3IMJ A;  1HCS B;  1O4K A;  1JYQ A;  1IJR A;  2MRJ A;  2Y1N A;  2C9W A;  1O4C A;  3US4 A;  2CI8 A;  2Y3A B;  2ECD A;  3EAZ A;  2IUI A;  4XZ0 A;  3S8N A;  1F1W A;  1NRV A;  2EYY A;  4XZ1 A;  3BUM B;  3IMD A;  3OV1 A;  1M61 A;  1JU5 A;  3VRO A;  2MQI A;  4OHE A;  3PSK A;  3VS5 A;  2DX0 A;  2YSX A;  3OP0 A;  1X0N A;  1O47 A;  5DC4 A;  1R1P A;  1A1E A;  1O49 A;  1X27 A;  2HCK A;  1O4R A;  2C0O A;  1O43 A;  2XP1 A;  3VRN A;  1BLK A;  4TZI A;  3TKZ A;  2IZV A;  2KK6 A;  3QWX X;  4OHH A;  2MRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...