1O4LA

Crystal structure of sh2 in complex with fragment2.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
b'SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
publication title Requirements for specific binding of low affinity inhibitor fragments to the SH2 domain of (pp60)Src are identical to those for high affinity binding of full length inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 26
structure length 105
sequence length 105
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1o4lA00
4P9VA 1O4NA 4GL9E 5DF6A 1R1PA 3N7YA 4X6SA 1O4MA 1SKJA 2CI8A 1CWEA 3GQIB 3BKBA 3S8OA 1A1EA 1O41A 1KSWA 1R1QA 2C0IA 3VGOA 2LNWA 1UUSA 1AYCA 3CD3A 2RMXA 1F1WA 2JYQA 2OQ1A 2HDVA 3WA4A 1LUNA 1IS0A 2B3OA 1KA7A 4DGXA 2EO3A 3HCKA 1NRVA 1X6CA 3GXWA 1O4RA 3OV1A 3PLFB 3VS2A 4D8KA 1YVLA 1XA6A 2C0TA 3VS0A 2PTKA 1SHAA 3PFVA 1JYUA 3US4A 1FYRA 1FU6A 2EYVA 1QCFA 3TL0A 1AB2A 3VROA 1M61A 2CBLA 5EG3B 1AOUF 5BO4A 1HCTB 3BUNB 1O4QA 5AULA 1LUIA 3N8MA 2QMSA 1TZEE 1BKLA 1O4OA 1A81A 1A08A 1H9OA 2SHPA 2ECDA 4K44A 3K2MA 1ZFPE 5J3XA 1D4TA 1CJ1A 1FHSA 1A1CA 1FU5A 1BHFA 2Y1NA 3HIZB 1NZVA 3IN7A 1G83A 1AYBA 4U1PA 1LKKA 1O4CA 1CSZA 2SRCA 1GRIA 1LCKA 3BUXB 1O49A 3S8NA 1IJRA 3S9KA 1O4AA 1X0NA 3OVEA 2DLZA 4L1BB 1BG1A 1O4EA 4H34A 1I3ZA 2DCRA 3QWXX 2CRHA 2RSYA 2KNOA 5DC4A 2EL8A 2L4KA 2KK6A 3OP0A 4K45A 3ZNIA 1MW4A 2BBUA 1O4GA 3PJPA 2DLYA 5EHPA 2RORA 1AOTF 4EIHA 1Y57A 2Y1MA 2IZVA 3VS5A 1AYDA 3N84A 3VRQA 3GXXA 2GSBA 4F59A 2CS0A 2C0OA 4OHIA 5EEQA 4JGHA 1F2FA 1O4HA 2HMHA 3UYOA 1A1AA 2MRJA 1JYRA 1KC2A 2IUIA 5EELA 2H8HA 4A4CA 1JWOA 1KA6A 4XZ1A 3OB2B 3MXCA 1BKMA 3C7IA 2LNXA 1B47A 4EY0A 2PNAA 2H5KA 1LUMA 1MILA 2CR4A 2EOBA 1RQQC 1BFJA 1A09A 2EU0A 1O4LA 4DGPA 1TCEA 2L6KA 2OZOA 1K9AA 1O46A 3CBLA 3NHNA 1A1BA 1O4KA 5HKWA 3VRZA 3S8LA 4E68A 2HCKA 1RPYA 4GPLB 4GWFA 1O4IA 2MC1A 2FO0A 4E93A 1O42A 2L3TA 5GJIA 3MAZA 4JE4A 1O47A 3MXYA 4LUEA 3EACA 5DC0B 3T04A 1O45A 3TKZA 4U17A 3PSJA 1FBZA 1OPKA 3IN8A 3PS5A 3QWYA 1FMKA 1JYQA 2C9WA 3HHMB 1BHHB 4K11A 1BLJA 1AD5A 1R1SA 5D0JA 5IBMA 2VIFA 1O4FA 4NWGA 2YSXA 2H46E 1NZLA 1BLKA 3EAZA 2K7AB 1SHBA 3KFJA 1Z3KA 5KAZA 4F5BA 2MRKA 5IBSA 1A07A 1D4WA 3IMJA 3PQZA 4TZIA 1LUKA 2LQWA 2IUGA 2PNBA 1BM2A 2RVFA 5GJHA 2DM0A 3BUWB 3VS1A 1OO3A 3VS3A 4QSYA 2IUHA 4K2RA 1PICA 1WQUA 1QG1E 5DC9A 2EO6A 3UF4A 1AYAA 4FL2A 1O4PA 1O43A 1CSYA 1JU5A 1O44A 5EHRA 3OB1B 1X27A 3M7FA 4P9ZA 5HKZA 1O4JA 3VRRA 4LUDA 1O4BA 4ROJA 1GHUA 1O48A 1P13A 1SPSA 4NWFA 4H1OA 1FBVA 4JEGA 1HCSB 2CI9A 2MQIA 4OHHA 2DX0A 3VRYA 5HKYA 1D1ZA 1O4DA 3VS7A 2MK2A 1BHHA 2EYYA 4F5AA 2AOAA 3CXLA 4XZ0A 2HUWA 4FBNA 1OPLA 2LQNA 4M4ZA 3VRNA 5AXIA 1BFIA 5I6VA 3CWGA 1UURA 3BUOB 1QADA 3VRPA 5CDWA 3VS6A 2PLDA 2AOBA 4OHEA 2FCIA 1SPRA 3PSKA 1CWDL 1LKLA 2PLEA 4WWQA 2CIAA 2HDXA 1M27A 1OO4A 4FL3A 3IMDA 4A4BA 2GE9A 2AUGA 1BF5A 1Y1UA 1RJAA 2DVJA 2YU7A 1BMBA 1YVHA 2EKXA 2EYZA 2XP1A 2LCTA 4OHDA 2ETZA 1LCJA 3BUMB 4OHLA 2K79B 2ABLA 1SHDA 3VS4A 2Y3AB
chains in the Genus database with same CATH superfamily
4P9VA 1O4NA 4GL9E 5DF6A 1R1PA 3N7YA 4X6SA 1O4MA 1SKJA 2CI8A 1CWEA 3GQIB 3BKBA 3S8OA 1A1EA 1O41A 1KSWA 1R1QA 2C0IA 3VGOA 2LNWA 1UUSA 1AYCA 3CD3A 2RMXA 1F1WA 2JYQA 2OQ1A 2HDVA 3WA4A 1LUNA 1IS0A 2B3OA 1KA7A 4DGXA 2EO3A 3HCKA 1NRVA 1X6CA 3GXWA 1O4RA 3OV1A 3PLFB 3VS2A 4D8KA 1YVLA 1XA6A 2C0TA 3VS0A 2PTKA 1SHAA 3PFVA 1JYUA 3US4A 1FYRA 1FU6A 2EYVA 1QCFA 3TL0A 1AB2A 3VROA 1M61A 2CBLA 5EG3B 1AOUF 5BO4A 1HCTB 3BUNB 1O4QA 5AULA 1LUIA 3N8MA 2QMSA 1TZEE 1BKLA 1O4OA 1A81A 1A08A 1H9OA 2SHPA 2ECDA 4K44A 3K2MA 1ZFPE 5J3XA 1D4TA 1CJ1A 1FHSA 1A1CA 1FU5A 1BHFA 2Y1NA 3HIZB 1NZVA 3IN7A 1G83A 1AYBA 4U1PA 1LKKA 1O4CA 1CSZA 2SRCA 1GRIA 1LCKA 3BUXB 1O49A 3S8NA 1IJRA 3S9KA 1O4AA 1X0NA 3OVEA 2DLZA 4L1BB 1BG1A 1O4EA 4H34A 1I3ZA 2DCRA 3QWXX 2CRHA 2RSYA 2KNOA 5DC4A 2EL8A 2L4KA 2KK6A 3OP0A 4K45A 3ZNIA 1MW4A 2BBUA 1O4GA 3PJPA 2DLYA 5EHPA 2RORA 1AOTF 4EIHA 1Y57A 2Y1MA 2IZVA 3VS5A 1AYDA 3N84A 3VRQA 3GXXA 2GSBA 4F59A 2CS0A 2C0OA 4OHIA 5EEQA 4JGHA 1F2FA 1O4HA 2HMHA 3UYOA 1A1AA 2MRJA 1JYRA 1KC2A 2IUIA 5EELA 2H8HA 4A4CA 1JWOA 1KA6A 4XZ1A 3OB2B 3MXCA 1BKMA 3C7IA 2LNXA 1B47A 4EY0A 2PNAA 2H5KA 1LUMA 1MILA 2CR4A 2EOBA 1RQQC 1BFJA 1A09A 2EU0A 1O4LA 4DGPA 1TCEA 2L6KA 2OZOA 1K9AA 1O46A 3CBLA 3NHNA 1A1BA 1O4KA 5HKWA 3VRZA 3S8LA 4E68A 2HCKA 1RPYA 4GPLB 4GWFA 1O4IA 2MC1A 2FO0A 4E93A 1O42A 2L3TA 5GJIA 3MAZA 4JE4A 1O47A 3MXYA 4LUEA 3EACA 5DC0B 3T04A 1O45A 3TKZA 4U17A 3PSJA 1FBZA 1OPKA 3IN8A 3PS5A 2KGYA 3QWYA 1FMKA 1JYQA 2C9WA 3HHMB 1BHHB 4K11A 1BLJA 1AD5A 1R1SA 5D0JA 5IBMA 2VIFA 1O4FA 4NWGA 2YSXA 2H46E 1NZLA 1BLKA 3EAZA 2K7AB 1SHBA 3KFJA 1Z3KA 5KAZA 4F5BA 2MRKA 5IBSA 1A07A 1D4WA 3IMJA 3PQZA 4TZIA 1LUKA 2LQWA 2IUGA 2PNBA 1BM2A 2RVFA 5GJHA 2DM0A 3BUWB 3VS1A 1OO3A 3VS3A 4QSYA 2IUHA 4K2RA 1PICA 1WQUA 1QG1E 5DC9A 2EO6A 3UF4A 3LYVA 1AYAA 4FL2A 1O4PA 1O43A 1CSYA 1JU5A 1O44A 5EHRA 3OB1B 1X27A 3M7FA 4P9ZA 5HKZA 1O4JA 3VRRA 4LUDA 1O4BA 4ROJA 1GHUA 1O48A 1P13A 1SPSA 4NWFA 4H1OA 1FBVA 4JEGA 1HCSB 2CI9A 2MQIA 4OHHA 2DX0A 3VRYA 5HKYA 1D1ZA 1O4DA 3VS7A 2MK2A 1BHHA 2EYYA 4F5AA 2AOAA 3CXLA 4XZ0A 2HUWA 4FBNA 1OPLA 2LQNA 3K2TA 4M4ZA 3VRNA 5AXIA 1BFIA 5I6VA 3CWGA 1UURA 3BUOB 1QADA 3VRPA 5CDWA 3VS6A 2PLDA 2AOBA 4OHEA 2FCIA 2LRAA 1SPRA 3PSKA 1CWDL 1LKLA 2PLEA 4WWQA 2CIAA 2HDXA 1M27A 1OO4A 4FL3A 3IMDA 4A4BA 2GE9A 2AUGA 1BF5A 1Y1UA 1RJAA 2DVJA 2YU7A 1BMBA 1YVHA 2EKXA 2EYZA 2XP1A 2LCTA 4OHDA 2ETZA 1LCJA 3BUMB 4OHLA 2K79B 2ABLA 1SHDA 3VS4A 2Y3AB
chains in the Genus database with same CATH topology
4P9VA 1O4NA 4GL9E 5DF6A 1R1PA 3N7YA 4X6SA 1O4MA 1SKJA 2CI8A 1CWEA 3GQIB 3BKBA 3S8OA 1A1EA 1O41A 1KSWA 1R1QA 2C0IA 3VGOA 2LNWA 1UUSA 1AYCA 3CD3A 2RMXA 1F1WA 2JYQA 2OQ1A 2HDVA 3WA4A 1LUNA 1IS0A 2B3OA 1KA7A 4DGXA 2EO3A 3HCKA 1NRVA 1X6CA 3GXWA 1O4RA 3OV1A 3PLFB 3VS2A 4D8KA 1YVLA 1XA6A 2C0TA 3VS0A 2PTKA 1SHAA 3PFVA 1JYUA 3US4A 1FYRA 1FU6A 2EYVA 1QCFA 3TL0A 1AB2A 3VROA 1M61A 2CBLA 5EG3B 1AOUF 5BO4A 1HCTB 3BUNB 1O4QA 5AULA 1LUIA 3N8MA 2QMSA 1TZEE 1BKLA 1O4OA 1A81A 1A08A 1H9OA 2SHPA 2ECDA 4K44A 3K2MA 1ZFPE 5J3XA 1D4TA 1CJ1A 1FHSA 1A1CA 1FU5A 1BHFA 2Y1NA 3HIZB 1NZVA 3IN7A 1G83A 1AYBA 4U1PA 1LKKA 1O4CA 1CSZA 2SRCA 1GRIA 1LCKA 3BUXB 1O49A 3S8NA 1IJRA 3S9KA 1O4AA 1X0NA 3OVEA 2DLZA 4L1BB 1BG1A 1O4EA 4H34A 1I3ZA 2DCRA 3QWXX 2CRHA 2RSYA 2KNOA 5DC4A 2EL8A 2L4KA 2KK6A 3OP0A 4K45A 3ZNIA 1MW4A 2BBUA 1O4GA 3PJPA 2DLYA 5EHPA 2RORA 1AOTF 4EIHA 1Y57A 2Y1MA 2IZVA 3VS5A 1AYDA 3N84A 3VRQA 3GXXA 2GSBA 4F59A 2CS0A 2C0OA 4OHIA 5EEQA 4JGHA 1F2FA 1O4HA 2HMHA 3UYOA 1A1AA 2MRJA 1JYRA 1KC2A 2IUIA 5EELA 2H8HA 4A4CA 1JWOA 1KA6A 4XZ1A 3OB2B 3MXCA 1BKMA 3C7IA 2LNXA 1B47A 4EY0A 2PNAA 2H5KA 1LUMA 1MILA 2CR4A 2EOBA 1RQQC 1BFJA 1A09A 2EU0A 1O4LA 4DGPA 1TCEA 2L6KA 2OZOA 1K9AA 1O46A 3CBLA 3NHNA 1A1BA 1O4KA 5HKWA 3VRZA 3S8LA 4E68A 2HCKA 1RPYA 4GPLB 4GWFA 1O4IA 2MC1A 2FO0A 4E93A 1O42A 2L3TA 5GJIA 3MAZA 4JE4A 1O47A 3MXYA 4LUEA 3EACA 5DC0B 3T04A 1O45A 3TKZA 4U17A 3PSJA 1FBZA 1OPKA 3IN8A 3PS5A 3QWYA 1FMKA 1JYQA 2C9WA 3HHMB 1BHHB 4K11A 1BLJA 1AD5A 1R1SA 5D0JA 5IBMA 2VIFA 1O4FA 4NWGA 2YSXA 2H46E 1NZLA 1BLKA 3EAZA 2K7AB 1SHBA 3KFJA 1Z3KA 5KAZA 4F5BA 2MRKA 5IBSA 1A07A 1D4WA 3IMJA 3PQZA 4TZIA 1LUKA 2LQWA 2IUGA 2PNBA 1BM2A 2RVFA 5GJHA 2DM0A 3BUWB 3VS1A 1OO3A 3VS3A 4QSYA 2IUHA 4K2RA 1PICA 1WQUA 1QG1E 5DC9A 2EO6A 3UF4A 1AYAA 4FL2A 1O4PA 1O43A 1CSYA 1JU5A 1O44A 5EHRA 3OB1B 1X27A 3M7FA 4P9ZA 5HKZA 1O4JA 3VRRA 4LUDA 1O4BA 4ROJA 1GHUA 1O48A 1P13A 1SPSA 4NWFA 4H1OA 1FBVA 4JEGA 1HCSB 2CI9A 2MQIA 4OHHA 2DX0A 3VRYA 5HKYA 1D1ZA 1O4DA 3VS7A 2MK2A 1BHHA 2EYYA 4F5AA 2AOAA 3CXLA 4XZ0A 2HUWA 4FBNA 1OPLA 2LQNA 4M4ZA 3VRNA 5AXIA 1BFIA 5I6VA 3CWGA 1UURA 3BUOB 1QADA 3VRPA 5CDWA 3VS6A 2PLDA 2AOBA 4OHEA 2FCIA 1SPRA 3PSKA 1CWDL 1LKLA 2PLEA 4WWQA 2CIAA 2HDXA 1M27A 1OO4A 4FL3A 3IMDA 4A4BA 2GE9A 2AUGA 1BF5A 1Y1UA 1RJAA 2DVJA 2YU7A 1BMBA 1YVHA 2EKXA 2EYZA 2XP1A 2LCTA 4OHDA 2ETZA 1LCJA 3BUMB 4OHLA 2K79B 2ABLA 1SHDA 3VS4A 2Y3AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P9V A;  1O4N A;  4GL9 E;  5DF6 A;  1R1P A;  3N7Y A;  4X6S A;  1O4M A;  1SKJ A;  2CI8 A;  1CWE A;  3GQI B;  3BKB A;  3S8O A;  1A1E A;  1O41 A;  1KSW A;  1R1Q A;  2C0I A;  3VGO A;  2LNW A;  1UUS A;  1AYC A;  3CD3 A;  2RMX A;  1F1W A;  2JYQ A;  2OQ1 A;  2HDV A;  3WA4 A;  1LUN A;  1IS0 A;  2B3O A;  1KA7 A;  4DGX A;  2EO3 A;  3HCK A;  1NRV A;  1X6C A;  3GXW A;  1O4R A;  3OV1 A;  3PLF B;  3VS2 A;  4D8K A;  1YVL A;  1XA6 A;  2C0T A;  3VS0 A;  2PTK A;  1SHA A;  3PFV A;  1JYU A;  3US4 A;  1FYR A;  1FU6 A;  2EYV A;  1QCF A;  3TL0 A;  1AB2 A;  3VRO A;  1M61 A;  2CBL A;  5EG3 B;  1AOU F;  5BO4 A;  1HCT B;  3BUN B;  1O4Q A;  5AUL A;  1LUI A;  3N8M A;  2QMS A;  1TZE E;  1BKL A;  1O4O A;  1A81 A;  1A08 A;  1H9O A;  2SHP A;  2ECD A;  4K44 A;  3K2M A;  1ZFP E;  5J3X A;  1D4T A;  1CJ1 A;  1FHS A;  1A1C A;  1FU5 A;  1BHF A;  2Y1N A;  3HIZ B;  1NZV A;  3IN7 A;  1G83 A;  1AYB A;  4U1P A;  1LKK A;  1O4C A;  1CSZ A;  2SRC A;  1GRI A;  1LCK A;  3BUX B;  1O49 A;  3S8N A;  1IJR A;  3S9K A;  1O4A A;  1X0N A;  3OVE A;  2DLZ A;  4L1B B;  1BG1 A;  1O4E A;  4H34 A;  1I3Z A;  2DCR A;  3QWX X;  2CRH A;  2RSY A;  2KNO A;  5DC4 A;  2EL8 A;  2L4K A;  2KK6 A;  3OP0 A;  4K45 A;  3ZNI A;  1MW4 A;  2BBU A;  1O4G A;  3PJP A;  2DLY A;  5EHP A;  2ROR A;  1AOT F;  4EIH A;  1Y57 A;  2Y1M A;  2IZV A;  3VS5 A;  1AYD A;  3N84 A;  3VRQ A;  3GXX A;  2GSB A;  4F59 A;  2CS0 A;  2C0O A;  4OHI A;  5EEQ A;  4JGH A;  1F2F A;  1O4H A;  2HMH A;  3UYO A;  1A1A A;  2MRJ A;  1JYR A;  1KC2 A;  2IUI A;  5EEL A;  2H8H A;  4A4C A;  1JWO A;  1KA6 A;  4XZ1 A;  3OB2 B;  3MXC A;  1BKM A;  3C7I A;  2LNX A;  1B47 A;  4EY0 A;  2PNA A;  2H5K A;  1LUM A;  1MIL A;  2CR4 A;  2EOB A;  1RQQ C;  1BFJ A;  1A09 A;  2EU0 A;  1O4L A;  4DGP A;  1TCE A;  2L6K A;  2OZO A;  1K9A A;  1O46 A;  3CBL A;  3NHN A;  1A1B A;  1O4K A;  5HKW A;  3VRZ A;  3S8L A;  4E68 A;  2HCK A;  1RPY A;  4GPL B;  4GWF A;  1O4I A;  2MC1 A;  2FO0 A;  4E93 A;  1O42 A;  2L3T A;  5GJI A;  3MAZ A;  4JE4 A;  1O47 A;  3MXY A;  4LUE A;  3EAC A;  5DC0 B;  3T04 A;  1O45 A;  3TKZ A;  4U17 A;  3PSJ A;  1FBZ A;  1OPK A;  3IN8 A;  3PS5 A;  3QWY A;  1FMK A;  1JYQ A;  2C9W A;  3HHM B;  1BHH B;  4K11 A;  1BLJ A;  1AD5 A;  1R1S A;  5D0J A;  5IBM A;  2VIF A;  1O4F A;  4NWG A;  2YSX A;  2H46 E;  1NZL A;  1BLK A;  3EAZ A;  2K7A B;  1SHB A;  3KFJ A;  1Z3K A;  5KAZ A;  4F5B A;  2MRK A;  5IBS A;  1A07 A;  1D4W A;  3IMJ A;  3PQZ A;  4TZI A;  1LUK A;  2LQW A;  2IUG A;  2PNB A;  1BM2 A;  2RVF A;  5GJH A;  2DM0 A;  3BUW B;  3VS1 A;  1OO3 A;  3VS3 A;  4QSY A;  2IUH A;  4K2R A;  1PIC A;  1WQU A;  1QG1 E;  5DC9 A;  2EO6 A;  3UF4 A;  1AYA A;  4FL2 A;  1O4P A;  1O43 A;  1CSY A;  1JU5 A;  1O44 A;  5EHR A;  3OB1 B;  1X27 A;  3M7F A;  4P9Z A;  5HKZ A;  1O4J A;  3VRR A;  4LUD A;  1O4B A;  4ROJ A;  1GHU A;  1O48 A;  1P13 A;  1SPS A;  4NWF A;  4H1O A;  1FBV A;  4JEG A;  1HCS B;  2CI9 A;  2MQI A;  4OHH A;  2DX0 A;  3VRY A;  5HKY A;  1D1Z A;  1O4D A;  3VS7 A;  2MK2 A;  1BHH A;  2EYY A;  4F5A A;  2AOA A;  3CXL A;  4XZ0 A;  2HUW A;  4FBN A;  1OPL A;  2LQN A;  4M4Z A;  3VRN A;  5AXI A;  1BFI A;  5I6V A;  3CWG A;  1UUR A;  3BUO B;  1QAD A;  3VRP A;  5CDW A;  3VS6 A;  2PLD A;  2AOB A;  4OHE A;  2FCI A;  1SPR A;  3PSK A;  1CWD L;  1LKL A;  2PLE A;  4WWQ A;  2CIA A;  2HDX A;  1M27 A;  1OO4 A;  4FL3 A;  3IMD A;  4A4B A;  2GE9 A;  2AUG A;  1BF5 A;  1Y1U A;  1RJA A;  2DVJ A;  2YU7 A;  1BMB A;  1YVH A;  2EKX A;  2EYZ A;  2XP1 A;  2LCT A;  4OHD A;  2ETZ A;  1LCJ A;  3BUM B;  4OHL A;  2K79 B;  2ABL A;  1SHD A;  3VS4 A;  2Y3A B; 
#chains in the Genus database with same CATH topology
 4P9V A;  1O4N A;  4GL9 E;  5DF6 A;  1R1P A;  3N7Y A;  4X6S A;  1O4M A;  1SKJ A;  2CI8 A;  1CWE A;  3GQI B;  3BKB A;  3S8O A;  1A1E A;  1O41 A;  1KSW A;  1R1Q A;  2C0I A;  3VGO A;  2LNW A;  1UUS A;  1AYC A;  3CD3 A;  2RMX A;  1F1W A;  2JYQ A;  2OQ1 A;  2HDV A;  3WA4 A;  1LUN A;  1IS0 A;  2B3O A;  1KA7 A;  4DGX A;  2EO3 A;  3HCK A;  1NRV A;  1X6C A;  3GXW A;  1O4R A;  3OV1 A;  3PLF B;  3VS2 A;  4D8K A;  1YVL A;  1XA6 A;  2C0T A;  3VS0 A;  2PTK A;  1SHA A;  3PFV A;  1JYU A;  3US4 A;  1FYR A;  1FU6 A;  2EYV A;  1QCF A;  3TL0 A;  1AB2 A;  3VRO A;  1M61 A;  2CBL A;  5EG3 B;  1AOU F;  5BO4 A;  1HCT B;  3BUN B;  1O4Q A;  5AUL A;  1LUI A;  3N8M A;  2QMS A;  1TZE E;  1BKL A;  1O4O A;  1A81 A;  1A08 A;  1H9O A;  2SHP A;  2ECD A;  4K44 A;  3K2M A;  1ZFP E;  5J3X A;  1D4T A;  1CJ1 A;  1FHS A;  1A1C A;  1FU5 A;  1BHF A;  2Y1N A;  3HIZ B;  1NZV A;  3IN7 A;  1G83 A;  1AYB A;  4U1P A;  1LKK A;  1O4C A;  1CSZ A;  2SRC A;  1GRI A;  1LCK A;  3BUX B;  1O49 A;  3S8N A;  1IJR A;  3S9K A;  1O4A A;  1X0N A;  3OVE A;  2DLZ A;  4L1B B;  1BG1 A;  1O4E A;  4H34 A;  1I3Z A;  2DCR A;  3QWX X;  2CRH A;  2RSY A;  2KNO A;  5DC4 A;  2EL8 A;  2L4K A;  2KK6 A;  3OP0 A;  4K45 A;  3ZNI A;  1MW4 A;  2BBU A;  1O4G A;  3PJP A;  2DLY A;  5EHP A;  2ROR A;  1AOT F;  4EIH A;  1Y57 A;  2Y1M A;  2IZV A;  3VS5 A;  1AYD A;  3N84 A;  3VRQ A;  3GXX A;  2GSB A;  4F59 A;  2CS0 A;  2C0O A;  4OHI A;  5EEQ A;  4JGH A;  1F2F A;  1O4H A;  2HMH A;  3UYO A;  1A1A A;  2MRJ A;  1JYR A;  1KC2 A;  2IUI A;  5EEL A;  2H8H A;  4A4C A;  1JWO A;  1KA6 A;  4XZ1 A;  3OB2 B;  3MXC A;  1BKM A;  3C7I A;  2LNX A;  1B47 A;  4EY0 A;  2PNA A;  2H5K A;  1LUM A;  1MIL A;  2CR4 A;  2EOB A;  1RQQ C;  1BFJ A;  1A09 A;  2EU0 A;  1O4L A;  4DGP A;  1TCE A;  2L6K A;  2OZO A;  1K9A A;  1O46 A;  3CBL A;  3NHN A;  1A1B A;  1O4K A;  5HKW A;  3VRZ A;  3S8L A;  4E68 A;  2HCK A;  1RPY A;  4GPL B;  4GWF A;  1O4I A;  2MC1 A;  2FO0 A;  4E93 A;  1O42 A;  2L3T A;  5GJI A;  3MAZ A;  4JE4 A;  1O47 A;  3MXY A;  4LUE A;  3EAC A;  5DC0 B;  3T04 A;  1O45 A;  3TKZ A;  4U17 A;  3PSJ A;  1FBZ A;  1OPK A;  3IN8 A;  3PS5 A;  2KGY A;  3QWY A;  1FMK A;  1JYQ A;  2C9W A;  3HHM B;  1BHH B;  4K11 A;  1BLJ A;  1AD5 A;  1R1S A;  5D0J A;  5IBM A;  2VIF A;  1O4F A;  4NWG A;  2YSX A;  2H46 E;  1NZL A;  1BLK A;  3EAZ A;  2K7A B;  1SHB A;  3KFJ A;  1Z3K A;  5KAZ A;  4F5B A;  2MRK A;  5IBS A;  1A07 A;  1D4W A;  3IMJ A;  3PQZ A;  4TZI A;  1LUK A;  2LQW A;  2IUG A;  2PNB A;  1BM2 A;  2RVF A;  5GJH A;  2DM0 A;  3BUW B;  3VS1 A;  1OO3 A;  3VS3 A;  4QSY A;  2IUH A;  4K2R A;  1PIC A;  1WQU A;  1QG1 E;  5DC9 A;  2EO6 A;  3UF4 A;  3LYV A;  1AYA A;  4FL2 A;  1O4P A;  1O43 A;  1CSY A;  1JU5 A;  1O44 A;  5EHR A;  3OB1 B;  1X27 A;  3M7F A;  4P9Z A;  5HKZ A;  1O4J A;  3VRR A;  4LUD A;  1O4B A;  4ROJ A;  1GHU A;  1O48 A;  1P13 A;  1SPS A;  4NWF A;  4H1O A;  1FBV A;  4JEG A;  1HCS B;  2CI9 A;  2MQI A;  4OHH A;  2DX0 A;  3VRY A;  5HKY A;  1D1Z A;  1O4D A;  3VS7 A;  2MK2 A;  1BHH A;  2EYY A;  4F5A A;  2AOA A;  3CXL A;  4XZ0 A;  2HUW A;  4FBN A;  1OPL A;  2LQN A;  3K2T A;  4M4Z A;  3VRN A;  5AXI A;  1BFI A;  5I6V A;  3CWG A;  1UUR A;  3BUO B;  1QAD A;  3VRP A;  5CDW A;  3VS6 A;  2PLD A;  2AOB A;  4OHE A;  2FCI A;  2LRA A;  1SPR A;  3PSK A;  1CWD L;  1LKL A;  2PLE A;  4WWQ A;  2CIA A;  2HDX A;  1M27 A;  1OO4 A;  4FL3 A;  3IMD A;  4A4B A;  2GE9 A;  2AUG A;  1BF5 A;  1Y1U A;  1RJA A;  2DVJ A;  2YU7 A;  1BMB A;  1YVH A;  2EKX A;  2EYZ A;  2XP1 A;  2LCT A;  4OHD A;  2ETZ A;  1LCJ A;  3BUM B;  4OHL A;  2K79 B;  2ABL A;  1SHD A;  3VS4 A;  2Y3A B; 
#chains in the Genus database with same CATH homology
 4P9V A;  1O4N A;  4GL9 E;  5DF6 A;  1R1P A;  3N7Y A;  4X6S A;  1O4M A;  1SKJ A;  2CI8 A;  1CWE A;  3GQI B;  3BKB A;  3S8O A;  1A1E A;  1O41 A;  1KSW A;  1R1Q A;  2C0I A;  3VGO A;  2LNW A;  1UUS A;  1AYC A;  3CD3 A;  2RMX A;  1F1W A;  2JYQ A;  2OQ1 A;  2HDV A;  3WA4 A;  1LUN A;  1IS0 A;  2B3O A;  1KA7 A;  4DGX A;  2EO3 A;  3HCK A;  1NRV A;  1X6C A;  3GXW A;  1O4R A;  3OV1 A;  3PLF B;  3VS2 A;  4D8K A;  1YVL A;  1XA6 A;  2C0T A;  3VS0 A;  2PTK A;  1SHA A;  3PFV A;  1JYU A;  3US4 A;  1FYR A;  1FU6 A;  2EYV A;  1QCF A;  3TL0 A;  1AB2 A;  3VRO A;  1M61 A;  2CBL A;  5EG3 B;  1AOU F;  5BO4 A;  1HCT B;  3BUN B;  1O4Q A;  5AUL A;  1LUI A;  3N8M A;  2QMS A;  1TZE E;  1BKL A;  1O4O A;  1A81 A;  1A08 A;  1H9O A;  2SHP A;  2ECD A;  4K44 A;  3K2M A;  1ZFP E;  5J3X A;  1D4T A;  1CJ1 A;  1FHS A;  1A1C A;  1FU5 A;  1BHF A;  2Y1N A;  3HIZ B;  1NZV A;  3IN7 A;  1G83 A;  1AYB A;  4U1P A;  1LKK A;  1O4C A;  1CSZ A;  2SRC A;  1GRI A;  1LCK A;  3BUX B;  1O49 A;  3S8N A;  1IJR A;  3S9K A;  1O4A A;  1X0N A;  3OVE A;  2DLZ A;  4L1B B;  1BG1 A;  1O4E A;  4H34 A;  1I3Z A;  2DCR A;  3QWX X;  2CRH A;  2RSY A;  2KNO A;  5DC4 A;  2EL8 A;  2L4K A;  2KK6 A;  3OP0 A;  4K45 A;  3ZNI A;  1MW4 A;  2BBU A;  1O4G A;  3PJP A;  2DLY A;  5EHP A;  2ROR A;  1AOT F;  4EIH A;  1Y57 A;  2Y1M A;  2IZV A;  3VS5 A;  1AYD A;  3N84 A;  3VRQ A;  3GXX A;  2GSB A;  4F59 A;  2CS0 A;  2C0O A;  4OHI A;  5EEQ A;  4JGH A;  1F2F A;  1O4H A;  2HMH A;  3UYO A;  1A1A A;  2MRJ A;  1JYR A;  1KC2 A;  2IUI A;  5EEL A;  2H8H A;  4A4C A;  1JWO A;  1KA6 A;  4XZ1 A;  3OB2 B;  3MXC A;  1BKM A;  3C7I A;  2LNX A;  1B47 A;  4EY0 A;  2PNA A;  2H5K A;  1LUM A;  1MIL A;  2CR4 A;  2EOB A;  1RQQ C;  1BFJ A;  1A09 A;  2EU0 A;  1O4L A;  4DGP A;  1TCE A;  2L6K A;  2OZO A;  1K9A A;  1O46 A;  3CBL A;  3NHN A;  1A1B A;  1O4K A;  5HKW A;  3VRZ A;  3S8L A;  4E68 A;  2HCK A;  1RPY A;  4GPL B;  4GWF A;  1O4I A;  2MC1 A;  2FO0 A;  4E93 A;  1O42 A;  2L3T A;  5GJI A;  3MAZ A;  4JE4 A;  1O47 A;  3MXY A;  4LUE A;  3EAC A;  5DC0 B;  3T04 A;  1O45 A;  3TKZ A;  4U17 A;  3PSJ A;  1FBZ A;  1OPK A;  3IN8 A;  3PS5 A;  3QWY A;  1FMK A;  1JYQ A;  2C9W A;  3HHM B;  1BHH B;  4K11 A;  1BLJ A;  1AD5 A;  1R1S A;  5D0J A;  5IBM A;  2VIF A;  1O4F A;  4NWG A;  2YSX A;  2H46 E;  1NZL A;  1BLK A;  3EAZ A;  2K7A B;  1SHB A;  3KFJ A;  1Z3K A;  5KAZ A;  4F5B A;  2MRK A;  5IBS A;  1A07 A;  1D4W A;  3IMJ A;  3PQZ A;  4TZI A;  1LUK A;  2LQW A;  2IUG A;  2PNB A;  1BM2 A;  2RVF A;  5GJH A;  2DM0 A;  3BUW B;  3VS1 A;  1OO3 A;  3VS3 A;  4QSY A;  2IUH A;  4K2R A;  1PIC A;  1WQU A;  1QG1 E;  5DC9 A;  2EO6 A;  3UF4 A;  1AYA A;  4FL2 A;  1O4P A;  1O43 A;  1CSY A;  1JU5 A;  1O44 A;  5EHR A;  3OB1 B;  1X27 A;  3M7F A;  4P9Z A;  5HKZ A;  1O4J A;  3VRR A;  4LUD A;  1O4B A;  4ROJ A;  1GHU A;  1O48 A;  1P13 A;  1SPS A;  4NWF A;  4H1O A;  1FBV A;  4JEG A;  1HCS B;  2CI9 A;  2MQI A;  4OHH A;  2DX0 A;  3VRY A;  5HKY A;  1D1Z A;  1O4D A;  3VS7 A;  2MK2 A;  1BHH A;  2EYY A;  4F5A A;  2AOA A;  3CXL A;  4XZ0 A;  2HUW A;  4FBN A;  1OPL A;  2LQN A;  4M4Z A;  3VRN A;  5AXI A;  1BFI A;  5I6V A;  3CWG A;  1UUR A;  3BUO B;  1QAD A;  3VRP A;  5CDW A;  3VS6 A;  2PLD A;  2AOB A;  4OHE A;  2FCI A;  1SPR A;  3PSK A;  1CWD L;  1LKL A;  2PLE A;  4WWQ A;  2CIA A;  2HDX A;  1M27 A;  1OO4 A;  4FL3 A;  3IMD A;  4A4B A;  2GE9 A;  2AUG A;  1BF5 A;  1Y1U A;  1RJA A;  2DVJ A;  2YU7 A;  1BMB A;  1YVH A;  2EKX A;  2EYZ A;  2XP1 A;  2LCT A;  4OHD A;  2ETZ A;  1LCJ A;  3BUM B;  4OHL A;  2K79 B;  2ABL A;  1SHD A;  3VS4 A;  2Y3A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...