1M27A

Crystal structure of sap/fynsh3/slam ternary complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, transferase
molecule keywords SH2 domain protein 1A
publication title SAP couples Fyn to SLAM immune receptors.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2002-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1m27A00
3VS7A 3VS2A 2CS0A 2ECDA 4K44A 2EYVA 1R1SA 4L1BB 1FMKA 1FHSA 1G83A 4H1OA 3CWGA 1D4TA 1AD5A 1BKMA 4OHLA 2K79B 3VS1A 1RJAA 2GSBA 4F5AA 3WA4A 1QCFA 4EY0A 3VRZA 3VRQA 4GPLB 2CI9A 3M7FA 2LCTA 1A08A 5KAZA 2C0IA 4XZ1A 3VS3A 2ETZA 1RPYA 1BHHA 1IJRA 1JU5A 2RMXA 1SKJA 1O4IA 1O4FA 2DLZA 2IUIA 2HCKA 1O41A 2C0TA 5IBSA 1AOUF 1SPSA 1TZEE 1BM2A 2MC1A 4K45A 1FBVA 1KA7A 2PLDA 3NHNA 3KFJA 2AOBA 1KSWA 1Y1UA 2OQ1A 1Y57A 2EYZA 2RORA 1O46A 3IMDA 1FBZA 3IMJA 3QWYA 2IZVA 2L3TA 1FU6A 5DC4A 4EIHA 4DGPA 1O4OA 3CD3A 1O4RA 5EHPA 1O47A 3TKZA 1ZFPE 2OZOA 1Z3KA 3VRNA 4P9VA 1BG1A 2LQWA 2H8HA 2PTKA 1JYQA 4OHHA 3US4A 3BUOB 4TZIA 1AYDA 2CBLA 1BHHB 1CWDL 5CDWA 1O4NA 3MXCA 1M27A 1OPLA 5EELA 1LKLA 1O4HA 2EU0A 2YSXA 5IBMA 3VRPA 3VRYA 2RSYA 4OHIA 2HUWA 4NWFA 2CR4A 2GE9A 1O4LA 3OP0A 1I3ZA 4GL9E 1NZVA 3S8LA 3ZNIA 1BLJA 2PLEA 3OB2B 3PS5A 1BHFA 1YVLA 2PNBA 2HMHA 4U17A 4E93A 3S8NA 1LUKA 3BKBA 3IN8A 4DGXA 3EAZA 1M61A 1A1AA 2PNAA 2DLYA 1A81A 1UUSA 1A07A 1UURA 1KC2A 2K7AB 5EEQA 2H5KA 2SRCA 3BUMB 1LUIA 3PJPA 1A1BA 1AOTF 1O4CA 1B47A 2DCRA 3N84A 3MAZA 1HCSB 2MRKA 4LUEA 2L4KA 5AULA 2FCIA 2CIAA 2XP1A 3N8MA 4U1PA 1A09A 3K2MA 2DX0A 1SHDA 4F5BA 4FL3A 1QADA 1CWEA 3QWXX 1BMBA 3OVEA 1JYRA 1OPKA 2EO3A 1GRIA 1CSYA 2HDVA 1AYCA 2H46E 1O4QA 3UYOA 1LUNA 1O4DA 2KK6A 4JE4A 2MQIA 1O44A 1F1WA 2EL8A 1JYUA 1R1QA 1K9AA 4P9ZA 3OB1B 4LUDA 1X6CA 1LCJA 1TCEA 1SHBA 1BFIA 3S9KA 1O43A 5BO4A 1AYAA 4FBNA 2RVFA 1BFJA 2FO0A 2LNWA 3S8OA 1BLKA 2CRHA 5DC9A 1SHAA 3HCKA 5J3XA 4JEGA 3GQIB 3GXXA 3PSKA 3BUXB 2EKXA 5HKYA 1JWOA 1FU5A 5HKZA 2VIFA 2Y3AB 5EHRA 2C0OA 2EO6A 1O4PA 1D1ZA 1OO4A 3C7IA 4OHEA 3N7YA 2JYQA 3OV1A 1XA6A 2DVJA 1FYRA 1X0NA 1O49A 3CBLA 1LUMA 1O48A 5D0JA 1O42A 1F2FA 5HKWA 2BBUA 3UF4A 4FL2A 5DF6A 3CXLA 1NRVA 4M4ZA 1O45A 3PFVA 4K2RA 4XZ0A 3IN7A 1X27A 1MW4A 1GHUA 3BUNB 5GJIA 2KNOA 4K11A 4NWGA 2YU7A 3GXWA 2DM0A 4GWFA 1MILA 3MXYA 1R1PA 3HHMB 3VS4A 2Y1NA 3VS0A 1PICA 2SHPA 1LCKA 1A1CA 1AYBA 1KA6A 2MK2A 4QSYA 2B3OA 4A4CA 4X6SA 2AOAA 1NZLA 4JGHA 1LKKA 2IUHA 3VRRA 3VS5A 4D8KA 1BKLA 4H34A 1D4WA 2LQNA 4A4BA 2L6KA 3VGOA 2IUGA 3PQZA 1H9OA 2HDXA 1QG1E 1P13A 2EYYA 1AB2A 4WWQA 1HCTB 2ABLA 5GJHA 3EACA 4ROJA 1O4EA 2EOBA 5AXIA 3HIZB 2LNXA 1OO3A 4F59A 2MRJA 5DC0B 2CI8A 2Y1MA 5EG3B 4OHDA 1O4AA 1CSZA 1O4JA 1A1EA 1YVHA 3PSJA 1CJ1A 1WQUA 1BF5A 1O4KA 3TL0A 5I6VA 1RQQC 1SPRA 2C9WA 2AUGA 2QMSA 3T04A 4E68A 1O4MA 1O4GA 3PLFB 3VROA 1IS0A 1O4BA 3VS6A 3BUWB
chains in the Genus database with same CATH superfamily
3VS7A 3VS2A 2CS0A 2ECDA 4K44A 2KGYA 2EYVA 1R1SA 4L1BB 1FMKA 1FHSA 1G83A 4H1OA 3CWGA 1D4TA 1AD5A 1BKMA 4OHLA 2K79B 3VS1A 1RJAA 2GSBA 4F5AA 3WA4A 1QCFA 4EY0A 3VRZA 3VRQA 4GPLB 2CI9A 3M7FA 2LCTA 1A08A 5KAZA 2C0IA 4XZ1A 3VS3A 2ETZA 1RPYA 1BHHA 1IJRA 1JU5A 2RMXA 1SKJA 1O4IA 1O4FA 2DLZA 2IUIA 2HCKA 1O41A 2C0TA 5IBSA 1AOUF 1SPSA 1TZEE 1BM2A 2MC1A 4K45A 1FBVA 1KA7A 2PLDA 3NHNA 3KFJA 2AOBA 1KSWA 1Y1UA 2OQ1A 1Y57A 2EYZA 2RORA 1O46A 3IMDA 1FBZA 3IMJA 3QWYA 2IZVA 2L3TA 1FU6A 5DC4A 4EIHA 4DGPA 1O4OA 3CD3A 1O4RA 5EHPA 1O47A 3TKZA 1ZFPE 2OZOA 1Z3KA 3VRNA 4P9VA 1BG1A 2LQWA 2H8HA 2PTKA 1JYQA 4OHHA 3US4A 3BUOB 4TZIA 1AYDA 2CBLA 1BHHB 1CWDL 5CDWA 1O4NA 3MXCA 1M27A 1OPLA 5EELA 1LKLA 1O4HA 2EU0A 2YSXA 5IBMA 3VRPA 3VRYA 2RSYA 4OHIA 2HUWA 4NWFA 2CR4A 2GE9A 1O4LA 3OP0A 1I3ZA 4GL9E 1NZVA 3S8LA 3ZNIA 1BLJA 2PLEA 3OB2B 3PS5A 1BHFA 3K2TA 2LRAA 1YVLA 2PNBA 2HMHA 4U17A 4E93A 3S8NA 1LUKA 3BKBA 3IN8A 4DGXA 3EAZA 1M61A 1A1AA 2PNAA 2DLYA 1A81A 1UUSA 1A07A 1UURA 1KC2A 2K7AB 5EEQA 2H5KA 3LYVA 2SRCA 3BUMB 1LUIA 3PJPA 1A1BA 1AOTF 1O4CA 1B47A 2DCRA 3N84A 3MAZA 1HCSB 2MRKA 4LUEA 2L4KA 5AULA 2FCIA 2CIAA 2XP1A 3N8MA 4U1PA 1A09A 3K2MA 2DX0A 1SHDA 4F5BA 4FL3A 1QADA 1CWEA 3QWXX 1BMBA 3OVEA 1JYRA 1OPKA 2EO3A 1GRIA 1CSYA 2HDVA 1AYCA 2H46E 1O4QA 3UYOA 1LUNA 1O4DA 2KK6A 4JE4A 2MQIA 1O44A 1F1WA 2EL8A 1JYUA 1R1QA 1K9AA 4P9ZA 3OB1B 4LUDA 1X6CA 1LCJA 1TCEA 1SHBA 1BFIA 3S9KA 1O43A 5BO4A 1AYAA 4FBNA 2RVFA 1BFJA 2FO0A 2LNWA 3S8OA 1BLKA 2CRHA 5DC9A 1SHAA 3HCKA 5J3XA 4JEGA 3GQIB 3GXXA 3PSKA 3BUXB 2EKXA 5HKYA 1JWOA 1FU5A 5HKZA 2VIFA 2Y3AB 5EHRA 2C0OA 2EO6A 1O4PA 1D1ZA 1OO4A 3C7IA 4OHEA 3N7YA 2JYQA 3OV1A 1XA6A 2DVJA 1FYRA 1X0NA 1O49A 3CBLA 1LUMA 1O48A 5D0JA 1O42A 1F2FA 5HKWA 2BBUA 3UF4A 4FL2A 5DF6A 3CXLA 1NRVA 4M4ZA 1O45A 3PFVA 4K2RA 4XZ0A 3IN7A 1X27A 1MW4A 1GHUA 3BUNB 5GJIA 2KNOA 4K11A 4NWGA 2YU7A 3GXWA 2DM0A 4GWFA 1MILA 3MXYA 1R1PA 3HHMB 3VS4A 2Y1NA 3VS0A 1PICA 2SHPA 1LCKA 1A1CA 1AYBA 1KA6A 2MK2A 4QSYA 2B3OA 4A4CA 4X6SA 2AOAA 1NZLA 4JGHA 1LKKA 2IUHA 3VRRA 3VS5A 4D8KA 1BKLA 4H34A 1D4WA 2LQNA 4A4BA 2L6KA 3VGOA 2IUGA 3PQZA 1H9OA 2HDXA 1QG1E 1P13A 2EYYA 1AB2A 4WWQA 1HCTB 2ABLA 5GJHA 3EACA 4ROJA 1O4EA 2EOBA 5AXIA 3HIZB 2LNXA 1OO3A 4F59A 2MRJA 5DC0B 2CI8A 2Y1MA 5EG3B 4OHDA 1O4AA 1CSZA 1O4JA 1A1EA 1YVHA 3PSJA 1CJ1A 1WQUA 1BF5A 1O4KA 3TL0A 5I6VA 1RQQC 1SPRA 2C9WA 2AUGA 2QMSA 3T04A 4E68A 1O4MA 1O4GA 3PLFB 3VROA 1IS0A 1O4BA 3VS6A 3BUWB
chains in the Genus database with same CATH topology
3VS7A 3VS2A 2CS0A 2ECDA 4K44A 2EYVA 1R1SA 4L1BB 1FMKA 1FHSA 1G83A 4H1OA 3CWGA 1D4TA 1AD5A 1BKMA 4OHLA 2K79B 3VS1A 1RJAA 2GSBA 4F5AA 3WA4A 1QCFA 4EY0A 3VRZA 3VRQA 4GPLB 2CI9A 3M7FA 2LCTA 1A08A 5KAZA 2C0IA 4XZ1A 3VS3A 2ETZA 1RPYA 1BHHA 1IJRA 1JU5A 2RMXA 1SKJA 1O4IA 1O4FA 2DLZA 2IUIA 2HCKA 1O41A 2C0TA 5IBSA 1AOUF 1SPSA 1TZEE 1BM2A 2MC1A 4K45A 1FBVA 1KA7A 2PLDA 3NHNA 3KFJA 2AOBA 1KSWA 1Y1UA 2OQ1A 1Y57A 2EYZA 2RORA 1O46A 3IMDA 1FBZA 3IMJA 3QWYA 2IZVA 2L3TA 1FU6A 5DC4A 4EIHA 4DGPA 1O4OA 3CD3A 1O4RA 5EHPA 1O47A 3TKZA 1ZFPE 2OZOA 1Z3KA 3VRNA 4P9VA 1BG1A 2LQWA 2H8HA 2PTKA 1JYQA 4OHHA 3US4A 3BUOB 4TZIA 1AYDA 2CBLA 1BHHB 1CWDL 5CDWA 1O4NA 3MXCA 1M27A 1OPLA 5EELA 1LKLA 1O4HA 2EU0A 2YSXA 5IBMA 3VRPA 3VRYA 2RSYA 4OHIA 2HUWA 4NWFA 2CR4A 2GE9A 1O4LA 3OP0A 1I3ZA 4GL9E 1NZVA 3S8LA 3ZNIA 1BLJA 2PLEA 3OB2B 3PS5A 1BHFA 1YVLA 2PNBA 2HMHA 4U17A 4E93A 3S8NA 1LUKA 3BKBA 3IN8A 4DGXA 3EAZA 1M61A 1A1AA 2PNAA 2DLYA 1A81A 1UUSA 1A07A 1UURA 1KC2A 2K7AB 5EEQA 2H5KA 2SRCA 3BUMB 1LUIA 3PJPA 1A1BA 1AOTF 1O4CA 1B47A 2DCRA 3N84A 3MAZA 1HCSB 2MRKA 4LUEA 2L4KA 5AULA 2FCIA 2CIAA 2XP1A 3N8MA 4U1PA 1A09A 3K2MA 2DX0A 1SHDA 4F5BA 4FL3A 1QADA 1CWEA 3QWXX 1BMBA 3OVEA 1JYRA 1OPKA 2EO3A 1GRIA 1CSYA 2HDVA 1AYCA 2H46E 1O4QA 3UYOA 1LUNA 1O4DA 2KK6A 4JE4A 2MQIA 1O44A 1F1WA 2EL8A 1JYUA 1R1QA 1K9AA 4P9ZA 3OB1B 4LUDA 1X6CA 1LCJA 1TCEA 1SHBA 1BFIA 3S9KA 1O43A 5BO4A 1AYAA 4FBNA 2RVFA 1BFJA 2FO0A 2LNWA 3S8OA 1BLKA 2CRHA 5DC9A 1SHAA 3HCKA 5J3XA 4JEGA 3GQIB 3GXXA 3PSKA 3BUXB 2EKXA 5HKYA 1JWOA 1FU5A 5HKZA 2VIFA 2Y3AB 5EHRA 2C0OA 2EO6A 1O4PA 1D1ZA 1OO4A 3C7IA 4OHEA 3N7YA 2JYQA 3OV1A 1XA6A 2DVJA 1FYRA 1X0NA 1O49A 3CBLA 1LUMA 1O48A 5D0JA 1O42A 1F2FA 5HKWA 2BBUA 3UF4A 4FL2A 5DF6A 3CXLA 1NRVA 4M4ZA 1O45A 3PFVA 4K2RA 4XZ0A 3IN7A 1X27A 1MW4A 1GHUA 3BUNB 5GJIA 2KNOA 4K11A 4NWGA 2YU7A 3GXWA 2DM0A 4GWFA 1MILA 3MXYA 1R1PA 3HHMB 3VS4A 2Y1NA 3VS0A 1PICA 2SHPA 1LCKA 1A1CA 1AYBA 1KA6A 2MK2A 4QSYA 2B3OA 4A4CA 4X6SA 2AOAA 1NZLA 4JGHA 1LKKA 2IUHA 3VRRA 3VS5A 4D8KA 1BKLA 4H34A 1D4WA 2LQNA 4A4BA 2L6KA 3VGOA 2IUGA 3PQZA 1H9OA 2HDXA 1QG1E 1P13A 2EYYA 1AB2A 4WWQA 1HCTB 2ABLA 5GJHA 3EACA 4ROJA 1O4EA 2EOBA 5AXIA 3HIZB 2LNXA 1OO3A 4F59A 2MRJA 5DC0B 2CI8A 2Y1MA 5EG3B 4OHDA 1O4AA 1CSZA 1O4JA 1A1EA 1YVHA 3PSJA 1CJ1A 1WQUA 1BF5A 1O4KA 3TL0A 5I6VA 1RQQC 1SPRA 2C9WA 2AUGA 2QMSA 3T04A 4E68A 1O4MA 1O4GA 3PLFB 3VROA 1IS0A 1O4BA 3VS6A 3BUWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VS7 A;  3VS2 A;  2CS0 A;  2ECD A;  4K44 A;  2EYV A;  1R1S A;  4L1B B;  1FMK A;  1FHS A;  1G83 A;  4H1O A;  3CWG A;  1D4T A;  1AD5 A;  1BKM A;  4OHL A;  2K79 B;  3VS1 A;  1RJA A;  2GSB A;  4F5A A;  3WA4 A;  1QCF A;  4EY0 A;  3VRZ A;  3VRQ A;  4GPL B;  2CI9 A;  3M7F A;  2LCT A;  1A08 A;  5KAZ A;  2C0I A;  4XZ1 A;  3VS3 A;  2ETZ A;  1RPY A;  1BHH A;  1IJR A;  1JU5 A;  2RMX A;  1SKJ A;  1O4I A;  1O4F A;  2DLZ A;  2IUI A;  2HCK A;  1O41 A;  2C0T A;  5IBS A;  1AOU F;  1SPS A;  1TZE E;  1BM2 A;  2MC1 A;  4K45 A;  1FBV A;  1KA7 A;  2PLD A;  3NHN A;  3KFJ A;  2AOB A;  1KSW A;  1Y1U A;  2OQ1 A;  1Y57 A;  2EYZ A;  2ROR A;  1O46 A;  3IMD A;  1FBZ A;  3IMJ A;  3QWY A;  2IZV A;  2L3T A;  1FU6 A;  5DC4 A;  4EIH A;  4DGP A;  1O4O A;  3CD3 A;  1O4R A;  5EHP A;  1O47 A;  3TKZ A;  1ZFP E;  2OZO A;  1Z3K A;  3VRN A;  4P9V A;  1BG1 A;  2LQW A;  2H8H A;  2PTK A;  1JYQ A;  4OHH A;  3US4 A;  3BUO B;  4TZI A;  1AYD A;  2CBL A;  1BHH B;  1CWD L;  5CDW A;  1O4N A;  3MXC A;  1M27 A;  1OPL A;  5EEL A;  1LKL A;  1O4H A;  2EU0 A;  2YSX A;  5IBM A;  3VRP A;  3VRY A;  2RSY A;  4OHI A;  2HUW A;  4NWF A;  2CR4 A;  2GE9 A;  1O4L A;  3OP0 A;  1I3Z A;  4GL9 E;  1NZV A;  3S8L A;  3ZNI A;  1BLJ A;  2PLE A;  3OB2 B;  3PS5 A;  1BHF A;  1YVL A;  2PNB A;  2HMH A;  4U17 A;  4E93 A;  3S8N A;  1LUK A;  3BKB A;  3IN8 A;  4DGX A;  3EAZ A;  1M61 A;  1A1A A;  2PNA A;  2DLY A;  1A81 A;  1UUS A;  1A07 A;  1UUR A;  1KC2 A;  2K7A B;  5EEQ A;  2H5K A;  2SRC A;  3BUM B;  1LUI A;  3PJP A;  1A1B A;  1AOT F;  1O4C A;  1B47 A;  2DCR A;  3N84 A;  3MAZ A;  1HCS B;  2MRK A;  4LUE A;  2L4K A;  5AUL A;  2FCI A;  2CIA A;  2XP1 A;  3N8M A;  4U1P A;  1A09 A;  3K2M A;  2DX0 A;  1SHD A;  4F5B A;  4FL3 A;  1QAD A;  1CWE A;  3QWX X;  1BMB A;  3OVE A;  1JYR A;  1OPK A;  2EO3 A;  1GRI A;  1CSY A;  2HDV A;  1AYC A;  2H46 E;  1O4Q A;  3UYO A;  1LUN A;  1O4D A;  2KK6 A;  4JE4 A;  2MQI A;  1O44 A;  1F1W A;  2EL8 A;  1JYU A;  1R1Q A;  1K9A A;  4P9Z A;  3OB1 B;  4LUD A;  1X6C A;  1LCJ A;  1TCE A;  1SHB A;  1BFI A;  3S9K A;  1O43 A;  5BO4 A;  1AYA A;  4FBN A;  2RVF A;  1BFJ A;  2FO0 A;  2LNW A;  3S8O A;  1BLK A;  2CRH A;  5DC9 A;  1SHA A;  3HCK A;  5J3X A;  4JEG A;  3GQI B;  3GXX A;  3PSK A;  3BUX B;  2EKX A;  5HKY A;  1JWO A;  1FU5 A;  5HKZ A;  2VIF A;  2Y3A B;  5EHR A;  2C0O A;  2EO6 A;  1O4P A;  1D1Z A;  1OO4 A;  3C7I A;  4OHE A;  3N7Y A;  2JYQ A;  3OV1 A;  1XA6 A;  2DVJ A;  1FYR A;  1X0N A;  1O49 A;  3CBL A;  1LUM A;  1O48 A;  5D0J A;  1O42 A;  1F2F A;  5HKW A;  2BBU A;  3UF4 A;  4FL2 A;  5DF6 A;  3CXL A;  1NRV A;  4M4Z A;  1O45 A;  3PFV A;  4K2R A;  4XZ0 A;  3IN7 A;  1X27 A;  1MW4 A;  1GHU A;  3BUN B;  5GJI A;  2KNO A;  4K11 A;  4NWG A;  2YU7 A;  3GXW A;  2DM0 A;  4GWF A;  1MIL A;  3MXY A;  1R1P A;  3HHM B;  3VS4 A;  2Y1N A;  3VS0 A;  1PIC A;  2SHP A;  1LCK A;  1A1C A;  1AYB A;  1KA6 A;  2MK2 A;  4QSY A;  2B3O A;  4A4C A;  4X6S A;  2AOA A;  1NZL A;  4JGH A;  1LKK A;  2IUH A;  3VRR A;  3VS5 A;  4D8K A;  1BKL A;  4H34 A;  1D4W A;  2LQN A;  4A4B A;  2L6K A;  3VGO A;  2IUG A;  3PQZ A;  1H9O A;  2HDX A;  1QG1 E;  1P13 A;  2EYY A;  1AB2 A;  4WWQ A;  1HCT B;  2ABL A;  5GJH A;  3EAC A;  4ROJ A;  1O4E A;  2EOB A;  5AXI A;  3HIZ B;  2LNX A;  1OO3 A;  4F59 A;  2MRJ A;  5DC0 B;  2CI8 A;  2Y1M A;  5EG3 B;  4OHD A;  1O4A A;  1CSZ A;  1O4J A;  1A1E A;  1YVH A;  3PSJ A;  1CJ1 A;  1WQU A;  1BF5 A;  1O4K A;  3TL0 A;  5I6V A;  1RQQ C;  1SPR A;  2C9W A;  2AUG A;  2QMS A;  3T04 A;  4E68 A;  1O4M A;  1O4G A;  3PLF B;  3VRO A;  1IS0 A;  1O4B A;  3VS6 A;  3BUW B; 
#chains in the Genus database with same CATH topology
 3VS7 A;  3VS2 A;  2CS0 A;  2ECD A;  4K44 A;  2KGY A;  2EYV A;  1R1S A;  4L1B B;  1FMK A;  1FHS A;  1G83 A;  4H1O A;  3CWG A;  1D4T A;  1AD5 A;  1BKM A;  4OHL A;  2K79 B;  3VS1 A;  1RJA A;  2GSB A;  4F5A A;  3WA4 A;  1QCF A;  4EY0 A;  3VRZ A;  3VRQ A;  4GPL B;  2CI9 A;  3M7F A;  2LCT A;  1A08 A;  5KAZ A;  2C0I A;  4XZ1 A;  3VS3 A;  2ETZ A;  1RPY A;  1BHH A;  1IJR A;  1JU5 A;  2RMX A;  1SKJ A;  1O4I A;  1O4F A;  2DLZ A;  2IUI A;  2HCK A;  1O41 A;  2C0T A;  5IBS A;  1AOU F;  1SPS A;  1TZE E;  1BM2 A;  2MC1 A;  4K45 A;  1FBV A;  1KA7 A;  2PLD A;  3NHN A;  3KFJ A;  2AOB A;  1KSW A;  1Y1U A;  2OQ1 A;  1Y57 A;  2EYZ A;  2ROR A;  1O46 A;  3IMD A;  1FBZ A;  3IMJ A;  3QWY A;  2IZV A;  2L3T A;  1FU6 A;  5DC4 A;  4EIH A;  4DGP A;  1O4O A;  3CD3 A;  1O4R A;  5EHP A;  1O47 A;  3TKZ A;  1ZFP E;  2OZO A;  1Z3K A;  3VRN A;  4P9V A;  1BG1 A;  2LQW A;  2H8H A;  2PTK A;  1JYQ A;  4OHH A;  3US4 A;  3BUO B;  4TZI A;  1AYD A;  2CBL A;  1BHH B;  1CWD L;  5CDW A;  1O4N A;  3MXC A;  1M27 A;  1OPL A;  5EEL A;  1LKL A;  1O4H A;  2EU0 A;  2YSX A;  5IBM A;  3VRP A;  3VRY A;  2RSY A;  4OHI A;  2HUW A;  4NWF A;  2CR4 A;  2GE9 A;  1O4L A;  3OP0 A;  1I3Z A;  4GL9 E;  1NZV A;  3S8L A;  3ZNI A;  1BLJ A;  2PLE A;  3OB2 B;  3PS5 A;  1BHF A;  3K2T A;  2LRA A;  1YVL A;  2PNB A;  2HMH A;  4U17 A;  4E93 A;  3S8N A;  1LUK A;  3BKB A;  3IN8 A;  4DGX A;  3EAZ A;  1M61 A;  1A1A A;  2PNA A;  2DLY A;  1A81 A;  1UUS A;  1A07 A;  1UUR A;  1KC2 A;  2K7A B;  5EEQ A;  2H5K A;  3LYV A;  2SRC A;  3BUM B;  1LUI A;  3PJP A;  1A1B A;  1AOT F;  1O4C A;  1B47 A;  2DCR A;  3N84 A;  3MAZ A;  1HCS B;  2MRK A;  4LUE A;  2L4K A;  5AUL A;  2FCI A;  2CIA A;  2XP1 A;  3N8M A;  4U1P A;  1A09 A;  3K2M A;  2DX0 A;  1SHD A;  4F5B A;  4FL3 A;  1QAD A;  1CWE A;  3QWX X;  1BMB A;  3OVE A;  1JYR A;  1OPK A;  2EO3 A;  1GRI A;  1CSY A;  2HDV A;  1AYC A;  2H46 E;  1O4Q A;  3UYO A;  1LUN A;  1O4D A;  2KK6 A;  4JE4 A;  2MQI A;  1O44 A;  1F1W A;  2EL8 A;  1JYU A;  1R1Q A;  1K9A A;  4P9Z A;  3OB1 B;  4LUD A;  1X6C A;  1LCJ A;  1TCE A;  1SHB A;  1BFI A;  3S9K A;  1O43 A;  5BO4 A;  1AYA A;  4FBN A;  2RVF A;  1BFJ A;  2FO0 A;  2LNW A;  3S8O A;  1BLK A;  2CRH A;  5DC9 A;  1SHA A;  3HCK A;  5J3X A;  4JEG A;  3GQI B;  3GXX A;  3PSK A;  3BUX B;  2EKX A;  5HKY A;  1JWO A;  1FU5 A;  5HKZ A;  2VIF A;  2Y3A B;  5EHR A;  2C0O A;  2EO6 A;  1O4P A;  1D1Z A;  1OO4 A;  3C7I A;  4OHE A;  3N7Y A;  2JYQ A;  3OV1 A;  1XA6 A;  2DVJ A;  1FYR A;  1X0N A;  1O49 A;  3CBL A;  1LUM A;  1O48 A;  5D0J A;  1O42 A;  1F2F A;  5HKW A;  2BBU A;  3UF4 A;  4FL2 A;  5DF6 A;  3CXL A;  1NRV A;  4M4Z A;  1O45 A;  3PFV A;  4K2R A;  4XZ0 A;  3IN7 A;  1X27 A;  1MW4 A;  1GHU A;  3BUN B;  5GJI A;  2KNO A;  4K11 A;  4NWG A;  2YU7 A;  3GXW A;  2DM0 A;  4GWF A;  1MIL A;  3MXY A;  1R1P A;  3HHM B;  3VS4 A;  2Y1N A;  3VS0 A;  1PIC A;  2SHP A;  1LCK A;  1A1C A;  1AYB A;  1KA6 A;  2MK2 A;  4QSY A;  2B3O A;  4A4C A;  4X6S A;  2AOA A;  1NZL A;  4JGH A;  1LKK A;  2IUH A;  3VRR A;  3VS5 A;  4D8K A;  1BKL A;  4H34 A;  1D4W A;  2LQN A;  4A4B A;  2L6K A;  3VGO A;  2IUG A;  3PQZ A;  1H9O A;  2HDX A;  1QG1 E;  1P13 A;  2EYY A;  1AB2 A;  4WWQ A;  1HCT B;  2ABL A;  5GJH A;  3EAC A;  4ROJ A;  1O4E A;  2EOB A;  5AXI A;  3HIZ B;  2LNX A;  1OO3 A;  4F59 A;  2MRJ A;  5DC0 B;  2CI8 A;  2Y1M A;  5EG3 B;  4OHD A;  1O4A A;  1CSZ A;  1O4J A;  1A1E A;  1YVH A;  3PSJ A;  1CJ1 A;  1WQU A;  1BF5 A;  1O4K A;  3TL0 A;  5I6V A;  1RQQ C;  1SPR A;  2C9W A;  2AUG A;  2QMS A;  3T04 A;  4E68 A;  1O4M A;  1O4G A;  3PLF B;  3VRO A;  1IS0 A;  1O4B A;  3VS6 A;  3BUW B; 
#chains in the Genus database with same CATH homology
 3VS7 A;  3VS2 A;  2CS0 A;  2ECD A;  4K44 A;  2EYV A;  1R1S A;  4L1B B;  1FMK A;  1FHS A;  1G83 A;  4H1O A;  3CWG A;  1D4T A;  1AD5 A;  1BKM A;  4OHL A;  2K79 B;  3VS1 A;  1RJA A;  2GSB A;  4F5A A;  3WA4 A;  1QCF A;  4EY0 A;  3VRZ A;  3VRQ A;  4GPL B;  2CI9 A;  3M7F A;  2LCT A;  1A08 A;  5KAZ A;  2C0I A;  4XZ1 A;  3VS3 A;  2ETZ A;  1RPY A;  1BHH A;  1IJR A;  1JU5 A;  2RMX A;  1SKJ A;  1O4I A;  1O4F A;  2DLZ A;  2IUI A;  2HCK A;  1O41 A;  2C0T A;  5IBS A;  1AOU F;  1SPS A;  1TZE E;  1BM2 A;  2MC1 A;  4K45 A;  1FBV A;  1KA7 A;  2PLD A;  3NHN A;  3KFJ A;  2AOB A;  1KSW A;  1Y1U A;  2OQ1 A;  1Y57 A;  2EYZ A;  2ROR A;  1O46 A;  3IMD A;  1FBZ A;  3IMJ A;  3QWY A;  2IZV A;  2L3T A;  1FU6 A;  5DC4 A;  4EIH A;  4DGP A;  1O4O A;  3CD3 A;  1O4R A;  5EHP A;  1O47 A;  3TKZ A;  1ZFP E;  2OZO A;  1Z3K A;  3VRN A;  4P9V A;  1BG1 A;  2LQW A;  2H8H A;  2PTK A;  1JYQ A;  4OHH A;  3US4 A;  3BUO B;  4TZI A;  1AYD A;  2CBL A;  1BHH B;  1CWD L;  5CDW A;  1O4N A;  3MXC A;  1M27 A;  1OPL A;  5EEL A;  1LKL A;  1O4H A;  2EU0 A;  2YSX A;  5IBM A;  3VRP A;  3VRY A;  2RSY A;  4OHI A;  2HUW A;  4NWF A;  2CR4 A;  2GE9 A;  1O4L A;  3OP0 A;  1I3Z A;  4GL9 E;  1NZV A;  3S8L A;  3ZNI A;  1BLJ A;  2PLE A;  3OB2 B;  3PS5 A;  1BHF A;  1YVL A;  2PNB A;  2HMH A;  4U17 A;  4E93 A;  3S8N A;  1LUK A;  3BKB A;  3IN8 A;  4DGX A;  3EAZ A;  1M61 A;  1A1A A;  2PNA A;  2DLY A;  1A81 A;  1UUS A;  1A07 A;  1UUR A;  1KC2 A;  2K7A B;  5EEQ A;  2H5K A;  2SRC A;  3BUM B;  1LUI A;  3PJP A;  1A1B A;  1AOT F;  1O4C A;  1B47 A;  2DCR A;  3N84 A;  3MAZ A;  1HCS B;  2MRK A;  4LUE A;  2L4K A;  5AUL A;  2FCI A;  2CIA A;  2XP1 A;  3N8M A;  4U1P A;  1A09 A;  3K2M A;  2DX0 A;  1SHD A;  4F5B A;  4FL3 A;  1QAD A;  1CWE A;  3QWX X;  1BMB A;  3OVE A;  1JYR A;  1OPK A;  2EO3 A;  1GRI A;  1CSY A;  2HDV A;  1AYC A;  2H46 E;  1O4Q A;  3UYO A;  1LUN A;  1O4D A;  2KK6 A;  4JE4 A;  2MQI A;  1O44 A;  1F1W A;  2EL8 A;  1JYU A;  1R1Q A;  1K9A A;  4P9Z A;  3OB1 B;  4LUD A;  1X6C A;  1LCJ A;  1TCE A;  1SHB A;  1BFI A;  3S9K A;  1O43 A;  5BO4 A;  1AYA A;  4FBN A;  2RVF A;  1BFJ A;  2FO0 A;  2LNW A;  3S8O A;  1BLK A;  2CRH A;  5DC9 A;  1SHA A;  3HCK A;  5J3X A;  4JEG A;  3GQI B;  3GXX A;  3PSK A;  3BUX B;  2EKX A;  5HKY A;  1JWO A;  1FU5 A;  5HKZ A;  2VIF A;  2Y3A B;  5EHR A;  2C0O A;  2EO6 A;  1O4P A;  1D1Z A;  1OO4 A;  3C7I A;  4OHE A;  3N7Y A;  2JYQ A;  3OV1 A;  1XA6 A;  2DVJ A;  1FYR A;  1X0N A;  1O49 A;  3CBL A;  1LUM A;  1O48 A;  5D0J A;  1O42 A;  1F2F A;  5HKW A;  2BBU A;  3UF4 A;  4FL2 A;  5DF6 A;  3CXL A;  1NRV A;  4M4Z A;  1O45 A;  3PFV A;  4K2R A;  4XZ0 A;  3IN7 A;  1X27 A;  1MW4 A;  1GHU A;  3BUN B;  5GJI A;  2KNO A;  4K11 A;  4NWG A;  2YU7 A;  3GXW A;  2DM0 A;  4GWF A;  1MIL A;  3MXY A;  1R1P A;  3HHM B;  3VS4 A;  2Y1N A;  3VS0 A;  1PIC A;  2SHP A;  1LCK A;  1A1C A;  1AYB A;  1KA6 A;  2MK2 A;  4QSY A;  2B3O A;  4A4C A;  4X6S A;  2AOA A;  1NZL A;  4JGH A;  1LKK A;  2IUH A;  3VRR A;  3VS5 A;  4D8K A;  1BKL A;  4H34 A;  1D4W A;  2LQN A;  4A4B A;  2L6K A;  3VGO A;  2IUG A;  3PQZ A;  1H9O A;  2HDX A;  1QG1 E;  1P13 A;  2EYY A;  1AB2 A;  4WWQ A;  1HCT B;  2ABL A;  5GJH A;  3EAC A;  4ROJ A;  1O4E A;  2EOB A;  5AXI A;  3HIZ B;  2LNX A;  1OO3 A;  4F59 A;  2MRJ A;  5DC0 B;  2CI8 A;  2Y1M A;  5EG3 B;  4OHD A;  1O4A A;  1CSZ A;  1O4J A;  1A1E A;  1YVH A;  3PSJ A;  1CJ1 A;  1WQU A;  1BF5 A;  1O4K A;  3TL0 A;  5I6V A;  1RQQ C;  1SPR A;  2C9W A;  2AUG A;  2QMS A;  3T04 A;  4E68 A;  1O4M A;  1O4G A;  3PLF B;  3VRO A;  1IS0 A;  1O4B A;  3VS6 A;  3BUW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...