5GJHA

Gads sh2 domain/cd28-derived peptide complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
97
structure length
97
Chain Sequence
b'GSWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTRED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRB2-related adapter protein 2
publication title Crystal Structures and Thermodynamic Analysis Reveal Distinct Mechanisms of CD28 Phosphopeptide Binding to the Src Homology 2 (SH2) Domains of Three Adaptor Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 24
structure length 97
sequence length 97
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 5gjhA00
5DC0B 2C0TA 1R1QA 1O48A 3VS3A 1LUNA 2HCKA 1A1BA 2C0OA 4OHDA 1Y57A 1KC2A 4DGXA 1K9AA 4GPLB 4U17A 3S8NA 2C0IA 2CR4A 1AYCA 4FL3A 5GJHA 1OPLA 1RQQC 1LUMA 2PNAA 3OV1A 3BUNB 1CWEA 4F5BA 3BUMB 1PICA 1X0NA 3OP0A 1FMKA 1O4KA 1QADA 3PS5A 1O44A 1RJAA 5AXIA 2CRHA 1AYDA 4FL2A 2GSBA 2FCIA 1O4GA 3VRRA 1D4WA 1O4JA 1CJ1A 4K11A 4H34A 5IBMA 3PJPA 3HCKA 2Y1MA 2HUWA 4F59A 3OB2B 5GJIA 2MRJA 1BF5A 2MC1A 3PSJA 4QSYA 1LUIA 4LUDA 4OHEA 3VS7A 1O4EA 3N84A 3TL0A 1O4IA 1R1PA 2DCRA 2YSXA 3OVEA 2RSYA 2H8HA 3K2MA 3MXCA 1O4BA 2MK2A 2RMXA 3VGOA 1AOTF 2B3OA 2IZVA 3VS6A 1YVLA 1O46A 2AOAA 4K44A 1IS0A 1BFIA 1X6CA 2CI8A 3QWYA 5HKZA 2DLYA 2H5KA 5DC4A 3IN8A 1CSZA 1BM2A 2EYZA 2CS0A 5BO4A 3BUWB 1YVHA 3HHMB 4K2RA 4NWFA 4D8KA 4OHHA 5J3XA 3S9KA 5CDWA 2CBLA 1BLKA 3BKBA 3C7IA 1IJRA 4GWFA 3M7FA 2IUIA 4GL9E 1O42A 4E93A 3VRYA 3CXLA 3N8MA 1LCJA 1SPSA 2SHPA 4U1PA 3CBLA 5EG3B 1BLJA 2OQ1A 1A09A 2Y3AB 4ROJA 2K79B 2PLEA 1UUSA 1BHHB 2EU0A 2LQWA 2OZOA 1OPKA 2C9WA 2L4KA 3BUOB 1O4LA 4OHLA 3VRNA 1O41A 4H1OA 1JU5A 2IUGA 2PTKA 3VRZA 1O4FA 2CIAA 4NWGA 1BHFA 1I3ZA 2CI9A 3VS2A 3GXWA 1O4AA 2SRCA 4EY0A 3OB1B 1GRIA 1TCEA 1F2FA 2BBUA 1FBZA 1M27A 3VROA 2EYYA 1O47A 1H9OA 4X6SA 3ZNIA 5HKYA 3EACA 1Y1UA 2PLDA 1NRVA 1O4NA 1KA7A 1XA6A 2AOBA 1Z3KA 2MQIA 1O45A 3CD3A 1HCSB 1O4RA 4FBNA 1FU5A 2DM0A 1SHDA 1RPYA 2HDXA 3WA4A 3UYOA 1NZLA 1MILA 4WWQA 2PNBA 2L3TA 2DLZA 5AULA 1FU6A 4P9VA 1A81A 2GE9A 3PSKA 1LUKA 5EHPA 4JEGA 1CWDL 4DGPA 1GHUA 2K7AB 1O4HA 3KFJA 1CSYA 1AYAA 1UURA 1JYUA 1O4DA 1D1ZA 1AOUF 3VS5A 4K45A 5DF6A 2HDVA 2EO3A 1BG1A 3TKZA 2RVFA 3BUXB 1A08A 1TZEE 3VS1A 3EAZA 1LKKA 5DC9A 1B47A 1MW4A 1BHHA 1BMBA 1KA6A 1D4TA 1LCKA 1BKMA 2QMSA 3NHNA 1P13A 4EIHA 1SPRA 2Y1NA 4L1BB 1QCFA 1X27A 1OO4A 4A4BA 1KSWA 1LKLA 1SKJA 1SHAA 3VRQA 1HCTB 1O49A 2LNWA 3IMDA 3VS4A 3N7YA 1QG1E 2EKXA 5IBSA 5I6VA 3IMJA 1O4PA 3HIZB 2EL8A 2IUHA 5HKWA 3PFVA 2H46E 4F5AA 1O4OA 1SHBA 2FO0A 1F1WA 2MRKA 1AYBA 3S8LA 4XZ1A 2EOBA 1A1AA 3MAZA 1A07A 3GQIB 1OO3A 2EO6A 1JYQA 3IN7A 1O4CA 3PQZA 3MXYA 3UF4A 1ZFPE 5KAZA 1O4MA 3GXXA 3CWGA 4E68A 1G83A 2AUGA 5EELA 4M4ZA 1FYRA 2KK6A 1NZVA 1O4QA 2L6KA 1FBVA 4OHIA 3PLFB 1AD5A 2DX0A 4XZ0A 2JYQA 2HMHA 4TZIA 4JE4A 2ECDA 3T04A 5D0JA 2VIFA 3S8OA 1A1CA 3VRPA 2YU7A 1O43A 1AB2A 2KNOA 1A1EA 5EHRA 3VS0A 1WQUA 1R1SA 1M61A 2ETZA 4JGHA 1FHSA 1BKLA 2LQNA 1BFJA 2ABLA 5EEQA 3US4A 2XP1A 2RORA 3QWXX 1JYRA 2LCTA 4P9ZA 2EYVA 4A4CA 1JWOA 2LNXA 4LUEA 2DVJA
chains in the Genus database with same CATH superfamily
5DC0B 2C0TA 2LRAA 1R1QA 1O48A 3VS3A 1LUNA 2HCKA 1A1BA 2C0OA 4OHDA 1Y57A 1KC2A 4DGXA 1K9AA 4GPLB 4U17A 3S8NA 2C0IA 2CR4A 1AYCA 4FL3A 5GJHA 1OPLA 3K2TA 1RQQC 1LUMA 2PNAA 3OV1A 3BUNB 1CWEA 4F5BA 3BUMB 1PICA 1X0NA 3OP0A 1FMKA 1O4KA 1QADA 3PS5A 1O44A 1RJAA 5AXIA 2CRHA 1AYDA 4FL2A 2GSBA 2FCIA 1O4GA 3VRRA 1D4WA 1O4JA 1CJ1A 4K11A 4H34A 5IBMA 3PJPA 3HCKA 2Y1MA 2HUWA 4F59A 3OB2B 5GJIA 2MRJA 1BF5A 2MC1A 3PSJA 4QSYA 1LUIA 4LUDA 4OHEA 3VS7A 1O4EA 3N84A 3TL0A 1O4IA 1R1PA 2DCRA 2YSXA 3OVEA 2RSYA 2H8HA 3K2MA 3MXCA 1O4BA 2MK2A 2RMXA 3VGOA 1AOTF 2B3OA 2IZVA 3VS6A 1YVLA 1O46A 2AOAA 4K44A 1IS0A 1BFIA 1X6CA 2CI8A 3QWYA 5HKZA 2DLYA 2H5KA 5DC4A 3IN8A 1CSZA 1BM2A 2EYZA 2CS0A 5BO4A 3BUWB 1YVHA 3HHMB 4K2RA 4NWFA 4D8KA 4OHHA 5J3XA 3S9KA 5CDWA 2CBLA 1BLKA 3BKBA 3C7IA 1IJRA 4GWFA 3M7FA 2IUIA 4GL9E 1O42A 4E93A 3VRYA 3CXLA 3N8MA 1LCJA 1SPSA 2SHPA 4U1PA 3CBLA 5EG3B 1BLJA 2OQ1A 1A09A 2Y3AB 4ROJA 2K79B 2PLEA 1UUSA 1BHHB 2EU0A 2LQWA 2OZOA 1OPKA 2C9WA 2L4KA 3BUOB 1O4LA 4OHLA 3VRNA 1O41A 4H1OA 1JU5A 2IUGA 2PTKA 3VRZA 1O4FA 2CIAA 4NWGA 1BHFA 1I3ZA 2CI9A 3VS2A 3GXWA 1O4AA 2SRCA 4EY0A 3OB1B 1GRIA 1TCEA 1F2FA 2BBUA 1FBZA 1M27A 3VROA 2EYYA 1O47A 1H9OA 4X6SA 3ZNIA 5HKYA 3EACA 1Y1UA 2PLDA 2KGYA 1NRVA 1O4NA 1KA7A 1XA6A 2AOBA 1Z3KA 2MQIA 1O45A 3CD3A 1HCSB 1O4RA 4FBNA 1FU5A 2DM0A 1SHDA 1RPYA 2HDXA 3WA4A 3UYOA 1NZLA 1MILA 4WWQA 2PNBA 2L3TA 2DLZA 5AULA 1FU6A 4P9VA 1A81A 2GE9A 3PSKA 1LUKA 5EHPA 4JEGA 1CWDL 4DGPA 1GHUA 2K7AB 1O4HA 3KFJA 1CSYA 1AYAA 1UURA 1JYUA 1O4DA 1D1ZA 1AOUF 3VS5A 4K45A 5DF6A 2HDVA 2EO3A 1BG1A 3TKZA 2RVFA 3BUXB 1A08A 1TZEE 3VS1A 3EAZA 1LKKA 5DC9A 1B47A 1MW4A 1BHHA 1BMBA 1KA6A 1D4TA 1LCKA 1BKMA 3LYVA 2QMSA 3NHNA 1P13A 4EIHA 1SPRA 2Y1NA 4L1BB 1QCFA 1X27A 1OO4A 4A4BA 1KSWA 1LKLA 1SKJA 1SHAA 3VRQA 1HCTB 1O49A 2LNWA 3IMDA 3VS4A 3N7YA 1QG1E 2EKXA 5IBSA 5I6VA 3IMJA 1O4PA 3HIZB 2EL8A 2IUHA 5HKWA 3PFVA 2H46E 4F5AA 1O4OA 1SHBA 2FO0A 1F1WA 2MRKA 1AYBA 3S8LA 4XZ1A 2EOBA 1A1AA 3MAZA 1A07A 3GQIB 1OO3A 2EO6A 1JYQA 3IN7A 1O4CA 3PQZA 3MXYA 3UF4A 1ZFPE 5KAZA 1O4MA 3GXXA 3CWGA 4E68A 1G83A 2AUGA 5EELA 4M4ZA 1FYRA 2KK6A 1NZVA 1O4QA 2L6KA 1FBVA 4OHIA 3PLFB 1AD5A 2DX0A 4XZ0A 2JYQA 2HMHA 4TZIA 4JE4A 2ECDA 3T04A 5D0JA 2VIFA 3S8OA 1A1CA 3VRPA 2YU7A 1O43A 1AB2A 2KNOA 1A1EA 5EHRA 3VS0A 1WQUA 1R1SA 1M61A 2ETZA 4JGHA 1FHSA 1BKLA 2LQNA 1BFJA 2ABLA 5EEQA 3US4A 2XP1A 2RORA 3QWXX 1JYRA 2LCTA 4P9ZA 2EYVA 4A4CA 1JWOA 2LNXA 4LUEA 2DVJA
chains in the Genus database with same CATH topology
5DC0B 2C0TA 1R1QA 1O48A 3VS3A 1LUNA 2HCKA 1A1BA 2C0OA 4OHDA 1Y57A 1KC2A 4DGXA 1K9AA 4GPLB 4U17A 3S8NA 2C0IA 2CR4A 1AYCA 4FL3A 5GJHA 1OPLA 1RQQC 1LUMA 2PNAA 3OV1A 3BUNB 1CWEA 4F5BA 3BUMB 1PICA 1X0NA 3OP0A 1FMKA 1O4KA 1QADA 3PS5A 1O44A 1RJAA 5AXIA 2CRHA 1AYDA 4FL2A 2GSBA 2FCIA 1O4GA 3VRRA 1D4WA 1O4JA 1CJ1A 4K11A 4H34A 5IBMA 3PJPA 3HCKA 2Y1MA 2HUWA 4F59A 3OB2B 5GJIA 2MRJA 1BF5A 2MC1A 3PSJA 4QSYA 1LUIA 4LUDA 4OHEA 3VS7A 1O4EA 3N84A 3TL0A 1O4IA 1R1PA 2DCRA 2YSXA 3OVEA 2RSYA 2H8HA 3K2MA 3MXCA 1O4BA 2MK2A 2RMXA 3VGOA 1AOTF 2B3OA 2IZVA 3VS6A 1YVLA 1O46A 2AOAA 4K44A 1IS0A 1BFIA 1X6CA 2CI8A 3QWYA 5HKZA 2DLYA 2H5KA 5DC4A 3IN8A 1CSZA 1BM2A 2EYZA 2CS0A 5BO4A 3BUWB 1YVHA 3HHMB 4K2RA 4NWFA 4D8KA 4OHHA 5J3XA 3S9KA 5CDWA 2CBLA 1BLKA 3BKBA 3C7IA 1IJRA 4GWFA 3M7FA 2IUIA 4GL9E 1O42A 4E93A 3VRYA 3CXLA 3N8MA 1LCJA 1SPSA 2SHPA 4U1PA 3CBLA 5EG3B 1BLJA 2OQ1A 1A09A 2Y3AB 4ROJA 2K79B 2PLEA 1UUSA 1BHHB 2EU0A 2LQWA 2OZOA 1OPKA 2C9WA 2L4KA 3BUOB 1O4LA 4OHLA 3VRNA 1O41A 4H1OA 1JU5A 2IUGA 2PTKA 3VRZA 1O4FA 2CIAA 4NWGA 1BHFA 1I3ZA 2CI9A 3VS2A 3GXWA 1O4AA 2SRCA 4EY0A 3OB1B 1GRIA 1TCEA 1F2FA 2BBUA 1FBZA 1M27A 3VROA 2EYYA 1O47A 1H9OA 4X6SA 3ZNIA 5HKYA 3EACA 1Y1UA 2PLDA 1NRVA 1O4NA 1KA7A 1XA6A 2AOBA 1Z3KA 2MQIA 1O45A 3CD3A 1HCSB 1O4RA 4FBNA 1FU5A 2DM0A 1SHDA 1RPYA 2HDXA 3WA4A 3UYOA 1NZLA 1MILA 4WWQA 2PNBA 2L3TA 2DLZA 5AULA 1FU6A 4P9VA 1A81A 2GE9A 3PSKA 1LUKA 5EHPA 4JEGA 1CWDL 4DGPA 1GHUA 2K7AB 1O4HA 3KFJA 1CSYA 1AYAA 1UURA 1JYUA 1O4DA 1D1ZA 1AOUF 3VS5A 4K45A 5DF6A 2HDVA 2EO3A 1BG1A 3TKZA 2RVFA 3BUXB 1A08A 1TZEE 3VS1A 3EAZA 1LKKA 5DC9A 1B47A 1MW4A 1BHHA 1BMBA 1KA6A 1D4TA 1LCKA 1BKMA 2QMSA 3NHNA 1P13A 4EIHA 1SPRA 2Y1NA 4L1BB 1QCFA 1X27A 1OO4A 4A4BA 1KSWA 1LKLA 1SKJA 1SHAA 3VRQA 1HCTB 1O49A 2LNWA 3IMDA 3VS4A 3N7YA 1QG1E 2EKXA 5IBSA 5I6VA 3IMJA 1O4PA 3HIZB 2EL8A 2IUHA 5HKWA 3PFVA 2H46E 4F5AA 1O4OA 1SHBA 2FO0A 1F1WA 2MRKA 1AYBA 3S8LA 4XZ1A 2EOBA 1A1AA 3MAZA 1A07A 3GQIB 1OO3A 2EO6A 1JYQA 3IN7A 1O4CA 3PQZA 3MXYA 3UF4A 1ZFPE 5KAZA 1O4MA 3GXXA 3CWGA 4E68A 1G83A 2AUGA 5EELA 4M4ZA 1FYRA 2KK6A 1NZVA 1O4QA 2L6KA 1FBVA 4OHIA 3PLFB 1AD5A 2DX0A 4XZ0A 2JYQA 2HMHA 4TZIA 4JE4A 2ECDA 3T04A 5D0JA 2VIFA 3S8OA 1A1CA 3VRPA 2YU7A 1O43A 1AB2A 2KNOA 1A1EA 5EHRA 3VS0A 1WQUA 1R1SA 1M61A 2ETZA 4JGHA 1FHSA 1BKLA 2LQNA 1BFJA 2ABLA 5EEQA 3US4A 2XP1A 2RORA 3QWXX 1JYRA 2LCTA 4P9ZA 2EYVA 4A4CA 1JWOA 2LNXA 4LUEA 2DVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DC0 B;  2C0T A;  1R1Q A;  1O48 A;  3VS3 A;  1LUN A;  2HCK A;  1A1B A;  2C0O A;  4OHD A;  1Y57 A;  1KC2 A;  4DGX A;  1K9A A;  4GPL B;  4U17 A;  3S8N A;  2C0I A;  2CR4 A;  1AYC A;  4FL3 A;  5GJH A;  1OPL A;  1RQQ C;  1LUM A;  2PNA A;  3OV1 A;  3BUN B;  1CWE A;  4F5B A;  3BUM B;  1PIC A;  1X0N A;  3OP0 A;  1FMK A;  1O4K A;  1QAD A;  3PS5 A;  1O44 A;  1RJA A;  5AXI A;  2CRH A;  1AYD A;  4FL2 A;  2GSB A;  2FCI A;  1O4G A;  3VRR A;  1D4W A;  1O4J A;  1CJ1 A;  4K11 A;  4H34 A;  5IBM A;  3PJP A;  3HCK A;  2Y1M A;  2HUW A;  4F59 A;  3OB2 B;  5GJI A;  2MRJ A;  1BF5 A;  2MC1 A;  3PSJ A;  4QSY A;  1LUI A;  4LUD A;  4OHE A;  3VS7 A;  1O4E A;  3N84 A;  3TL0 A;  1O4I A;  1R1P A;  2DCR A;  2YSX A;  3OVE A;  2RSY A;  2H8H A;  3K2M A;  3MXC A;  1O4B A;  2MK2 A;  2RMX A;  3VGO A;  1AOT F;  2B3O A;  2IZV A;  3VS6 A;  1YVL A;  1O46 A;  2AOA A;  4K44 A;  1IS0 A;  1BFI A;  1X6C A;  2CI8 A;  3QWY A;  5HKZ A;  2DLY A;  2H5K A;  5DC4 A;  3IN8 A;  1CSZ A;  1BM2 A;  2EYZ A;  2CS0 A;  5BO4 A;  3BUW B;  1YVH A;  3HHM B;  4K2R A;  4NWF A;  4D8K A;  4OHH A;  5J3X A;  3S9K A;  5CDW A;  2CBL A;  1BLK A;  3BKB A;  3C7I A;  1IJR A;  4GWF A;  3M7F A;  2IUI A;  4GL9 E;  1O42 A;  4E93 A;  3VRY A;  3CXL A;  3N8M A;  1LCJ A;  1SPS A;  2SHP A;  4U1P A;  3CBL A;  5EG3 B;  1BLJ A;  2OQ1 A;  1A09 A;  2Y3A B;  4ROJ A;  2K79 B;  2PLE A;  1UUS A;  1BHH B;  2EU0 A;  2LQW A;  2OZO A;  1OPK A;  2C9W A;  2L4K A;  3BUO B;  1O4L A;  4OHL A;  3VRN A;  1O41 A;  4H1O A;  1JU5 A;  2IUG A;  2PTK A;  3VRZ A;  1O4F A;  2CIA A;  4NWG A;  1BHF A;  1I3Z A;  2CI9 A;  3VS2 A;  3GXW A;  1O4A A;  2SRC A;  4EY0 A;  3OB1 B;  1GRI A;  1TCE A;  1F2F A;  2BBU A;  1FBZ A;  1M27 A;  3VRO A;  2EYY A;  1O47 A;  1H9O A;  4X6S A;  3ZNI A;  5HKY A;  3EAC A;  1Y1U A;  2PLD A;  1NRV A;  1O4N A;  1KA7 A;  1XA6 A;  2AOB A;  1Z3K A;  2MQI A;  1O45 A;  3CD3 A;  1HCS B;  1O4R A;  4FBN A;  1FU5 A;  2DM0 A;  1SHD A;  1RPY A;  2HDX A;  3WA4 A;  3UYO A;  1NZL A;  1MIL A;  4WWQ A;  2PNB A;  2L3T A;  2DLZ A;  5AUL A;  1FU6 A;  4P9V A;  1A81 A;  2GE9 A;  3PSK A;  1LUK A;  5EHP A;  4JEG A;  1CWD L;  4DGP A;  1GHU A;  2K7A B;  1O4H A;  3KFJ A;  1CSY A;  1AYA A;  1UUR A;  1JYU A;  1O4D A;  1D1Z A;  1AOU F;  3VS5 A;  4K45 A;  5DF6 A;  2HDV A;  2EO3 A;  1BG1 A;  3TKZ A;  2RVF A;  3BUX B;  1A08 A;  1TZE E;  3VS1 A;  3EAZ A;  1LKK A;  5DC9 A;  1B47 A;  1MW4 A;  1BHH A;  1BMB A;  1KA6 A;  1D4T A;  1LCK A;  1BKM A;  2QMS A;  3NHN A;  1P13 A;  4EIH A;  1SPR A;  2Y1N A;  4L1B B;  1QCF A;  1X27 A;  1OO4 A;  4A4B A;  1KSW A;  1LKL A;  1SKJ A;  1SHA A;  3VRQ A;  1HCT B;  1O49 A;  2LNW A;  3IMD A;  3VS4 A;  3N7Y A;  1QG1 E;  2EKX A;  5IBS A;  5I6V A;  3IMJ A;  1O4P A;  3HIZ B;  2EL8 A;  2IUH A;  5HKW A;  3PFV A;  2H46 E;  4F5A A;  1O4O A;  1SHB A;  2FO0 A;  1F1W A;  2MRK A;  1AYB A;  3S8L A;  4XZ1 A;  2EOB A;  1A1A A;  3MAZ A;  1A07 A;  3GQI B;  1OO3 A;  2EO6 A;  1JYQ A;  3IN7 A;  1O4C A;  3PQZ A;  3MXY A;  3UF4 A;  1ZFP E;  5KAZ A;  1O4M A;  3GXX A;  3CWG A;  4E68 A;  1G83 A;  2AUG A;  5EEL A;  4M4Z A;  1FYR A;  2KK6 A;  1NZV A;  1O4Q A;  2L6K A;  1FBV A;  4OHI A;  3PLF B;  1AD5 A;  2DX0 A;  4XZ0 A;  2JYQ A;  2HMH A;  4TZI A;  4JE4 A;  2ECD A;  3T04 A;  5D0J A;  2VIF A;  3S8O A;  1A1C A;  3VRP A;  2YU7 A;  1O43 A;  1AB2 A;  2KNO A;  1A1E A;  5EHR A;  3VS0 A;  1WQU A;  1R1S A;  1M61 A;  2ETZ A;  4JGH A;  1FHS A;  1BKL A;  2LQN A;  1BFJ A;  2ABL A;  5EEQ A;  3US4 A;  2XP1 A;  2ROR A;  3QWX X;  1JYR A;  2LCT A;  4P9Z A;  2EYV A;  4A4C A;  1JWO A;  2LNX A;  4LUE A;  2DVJ A; 
#chains in the Genus database with same CATH topology
 5DC0 B;  2C0T A;  2LRA A;  1R1Q A;  1O48 A;  3VS3 A;  1LUN A;  2HCK A;  1A1B A;  2C0O A;  4OHD A;  1Y57 A;  1KC2 A;  4DGX A;  1K9A A;  4GPL B;  4U17 A;  3S8N A;  2C0I A;  2CR4 A;  1AYC A;  4FL3 A;  5GJH A;  1OPL A;  3K2T A;  1RQQ C;  1LUM A;  2PNA A;  3OV1 A;  3BUN B;  1CWE A;  4F5B A;  3BUM B;  1PIC A;  1X0N A;  3OP0 A;  1FMK A;  1O4K A;  1QAD A;  3PS5 A;  1O44 A;  1RJA A;  5AXI A;  2CRH A;  1AYD A;  4FL2 A;  2GSB A;  2FCI A;  1O4G A;  3VRR A;  1D4W A;  1O4J A;  1CJ1 A;  4K11 A;  4H34 A;  5IBM A;  3PJP A;  3HCK A;  2Y1M A;  2HUW A;  4F59 A;  3OB2 B;  5GJI A;  2MRJ A;  1BF5 A;  2MC1 A;  3PSJ A;  4QSY A;  1LUI A;  4LUD A;  4OHE A;  3VS7 A;  1O4E A;  3N84 A;  3TL0 A;  1O4I A;  1R1P A;  2DCR A;  2YSX A;  3OVE A;  2RSY A;  2H8H A;  3K2M A;  3MXC A;  1O4B A;  2MK2 A;  2RMX A;  3VGO A;  1AOT F;  2B3O A;  2IZV A;  3VS6 A;  1YVL A;  1O46 A;  2AOA A;  4K44 A;  1IS0 A;  1BFI A;  1X6C A;  2CI8 A;  3QWY A;  5HKZ A;  2DLY A;  2H5K A;  5DC4 A;  3IN8 A;  1CSZ A;  1BM2 A;  2EYZ A;  2CS0 A;  5BO4 A;  3BUW B;  1YVH A;  3HHM B;  4K2R A;  4NWF A;  4D8K A;  4OHH A;  5J3X A;  3S9K A;  5CDW A;  2CBL A;  1BLK A;  3BKB A;  3C7I A;  1IJR A;  4GWF A;  3M7F A;  2IUI A;  4GL9 E;  1O42 A;  4E93 A;  3VRY A;  3CXL A;  3N8M A;  1LCJ A;  1SPS A;  2SHP A;  4U1P A;  3CBL A;  5EG3 B;  1BLJ A;  2OQ1 A;  1A09 A;  2Y3A B;  4ROJ A;  2K79 B;  2PLE A;  1UUS A;  1BHH B;  2EU0 A;  2LQW A;  2OZO A;  1OPK A;  2C9W A;  2L4K A;  3BUO B;  1O4L A;  4OHL A;  3VRN A;  1O41 A;  4H1O A;  1JU5 A;  2IUG A;  2PTK A;  3VRZ A;  1O4F A;  2CIA A;  4NWG A;  1BHF A;  1I3Z A;  2CI9 A;  3VS2 A;  3GXW A;  1O4A A;  2SRC A;  4EY0 A;  3OB1 B;  1GRI A;  1TCE A;  1F2F A;  2BBU A;  1FBZ A;  1M27 A;  3VRO A;  2EYY A;  1O47 A;  1H9O A;  4X6S A;  3ZNI A;  5HKY A;  3EAC A;  1Y1U A;  2PLD A;  2KGY A;  1NRV A;  1O4N A;  1KA7 A;  1XA6 A;  2AOB A;  1Z3K A;  2MQI A;  1O45 A;  3CD3 A;  1HCS B;  1O4R A;  4FBN A;  1FU5 A;  2DM0 A;  1SHD A;  1RPY A;  2HDX A;  3WA4 A;  3UYO A;  1NZL A;  1MIL A;  4WWQ A;  2PNB A;  2L3T A;  2DLZ A;  5AUL A;  1FU6 A;  4P9V A;  1A81 A;  2GE9 A;  3PSK A;  1LUK A;  5EHP A;  4JEG A;  1CWD L;  4DGP A;  1GHU A;  2K7A B;  1O4H A;  3KFJ A;  1CSY A;  1AYA A;  1UUR A;  1JYU A;  1O4D A;  1D1Z A;  1AOU F;  3VS5 A;  4K45 A;  5DF6 A;  2HDV A;  2EO3 A;  1BG1 A;  3TKZ A;  2RVF A;  3BUX B;  1A08 A;  1TZE E;  3VS1 A;  3EAZ A;  1LKK A;  5DC9 A;  1B47 A;  1MW4 A;  1BHH A;  1BMB A;  1KA6 A;  1D4T A;  1LCK A;  1BKM A;  3LYV A;  2QMS A;  3NHN A;  1P13 A;  4EIH A;  1SPR A;  2Y1N A;  4L1B B;  1QCF A;  1X27 A;  1OO4 A;  4A4B A;  1KSW A;  1LKL A;  1SKJ A;  1SHA A;  3VRQ A;  1HCT B;  1O49 A;  2LNW A;  3IMD A;  3VS4 A;  3N7Y A;  1QG1 E;  2EKX A;  5IBS A;  5I6V A;  3IMJ A;  1O4P A;  3HIZ B;  2EL8 A;  2IUH A;  5HKW A;  3PFV A;  2H46 E;  4F5A A;  1O4O A;  1SHB A;  2FO0 A;  1F1W A;  2MRK A;  1AYB A;  3S8L A;  4XZ1 A;  2EOB A;  1A1A A;  3MAZ A;  1A07 A;  3GQI B;  1OO3 A;  2EO6 A;  1JYQ A;  3IN7 A;  1O4C A;  3PQZ A;  3MXY A;  3UF4 A;  1ZFP E;  5KAZ A;  1O4M A;  3GXX A;  3CWG A;  4E68 A;  1G83 A;  2AUG A;  5EEL A;  4M4Z A;  1FYR A;  2KK6 A;  1NZV A;  1O4Q A;  2L6K A;  1FBV A;  4OHI A;  3PLF B;  1AD5 A;  2DX0 A;  4XZ0 A;  2JYQ A;  2HMH A;  4TZI A;  4JE4 A;  2ECD A;  3T04 A;  5D0J A;  2VIF A;  3S8O A;  1A1C A;  3VRP A;  2YU7 A;  1O43 A;  1AB2 A;  2KNO A;  1A1E A;  5EHR A;  3VS0 A;  1WQU A;  1R1S A;  1M61 A;  2ETZ A;  4JGH A;  1FHS A;  1BKL A;  2LQN A;  1BFJ A;  2ABL A;  5EEQ A;  3US4 A;  2XP1 A;  2ROR A;  3QWX X;  1JYR A;  2LCT A;  4P9Z A;  2EYV A;  4A4C A;  1JWO A;  2LNX A;  4LUE A;  2DVJ A; 
#chains in the Genus database with same CATH homology
 5DC0 B;  2C0T A;  1R1Q A;  1O48 A;  3VS3 A;  1LUN A;  2HCK A;  1A1B A;  2C0O A;  4OHD A;  1Y57 A;  1KC2 A;  4DGX A;  1K9A A;  4GPL B;  4U17 A;  3S8N A;  2C0I A;  2CR4 A;  1AYC A;  4FL3 A;  5GJH A;  1OPL A;  1RQQ C;  1LUM A;  2PNA A;  3OV1 A;  3BUN B;  1CWE A;  4F5B A;  3BUM B;  1PIC A;  1X0N A;  3OP0 A;  1FMK A;  1O4K A;  1QAD A;  3PS5 A;  1O44 A;  1RJA A;  5AXI A;  2CRH A;  1AYD A;  4FL2 A;  2GSB A;  2FCI A;  1O4G A;  3VRR A;  1D4W A;  1O4J A;  1CJ1 A;  4K11 A;  4H34 A;  5IBM A;  3PJP A;  3HCK A;  2Y1M A;  2HUW A;  4F59 A;  3OB2 B;  5GJI A;  2MRJ A;  1BF5 A;  2MC1 A;  3PSJ A;  4QSY A;  1LUI A;  4LUD A;  4OHE A;  3VS7 A;  1O4E A;  3N84 A;  3TL0 A;  1O4I A;  1R1P A;  2DCR A;  2YSX A;  3OVE A;  2RSY A;  2H8H A;  3K2M A;  3MXC A;  1O4B A;  2MK2 A;  2RMX A;  3VGO A;  1AOT F;  2B3O A;  2IZV A;  3VS6 A;  1YVL A;  1O46 A;  2AOA A;  4K44 A;  1IS0 A;  1BFI A;  1X6C A;  2CI8 A;  3QWY A;  5HKZ A;  2DLY A;  2H5K A;  5DC4 A;  3IN8 A;  1CSZ A;  1BM2 A;  2EYZ A;  2CS0 A;  5BO4 A;  3BUW B;  1YVH A;  3HHM B;  4K2R A;  4NWF A;  4D8K A;  4OHH A;  5J3X A;  3S9K A;  5CDW A;  2CBL A;  1BLK A;  3BKB A;  3C7I A;  1IJR A;  4GWF A;  3M7F A;  2IUI A;  4GL9 E;  1O42 A;  4E93 A;  3VRY A;  3CXL A;  3N8M A;  1LCJ A;  1SPS A;  2SHP A;  4U1P A;  3CBL A;  5EG3 B;  1BLJ A;  2OQ1 A;  1A09 A;  2Y3A B;  4ROJ A;  2K79 B;  2PLE A;  1UUS A;  1BHH B;  2EU0 A;  2LQW A;  2OZO A;  1OPK A;  2C9W A;  2L4K A;  3BUO B;  1O4L A;  4OHL A;  3VRN A;  1O41 A;  4H1O A;  1JU5 A;  2IUG A;  2PTK A;  3VRZ A;  1O4F A;  2CIA A;  4NWG A;  1BHF A;  1I3Z A;  2CI9 A;  3VS2 A;  3GXW A;  1O4A A;  2SRC A;  4EY0 A;  3OB1 B;  1GRI A;  1TCE A;  1F2F A;  2BBU A;  1FBZ A;  1M27 A;  3VRO A;  2EYY A;  1O47 A;  1H9O A;  4X6S A;  3ZNI A;  5HKY A;  3EAC A;  1Y1U A;  2PLD A;  1NRV A;  1O4N A;  1KA7 A;  1XA6 A;  2AOB A;  1Z3K A;  2MQI A;  1O45 A;  3CD3 A;  1HCS B;  1O4R A;  4FBN A;  1FU5 A;  2DM0 A;  1SHD A;  1RPY A;  2HDX A;  3WA4 A;  3UYO A;  1NZL A;  1MIL A;  4WWQ A;  2PNB A;  2L3T A;  2DLZ A;  5AUL A;  1FU6 A;  4P9V A;  1A81 A;  2GE9 A;  3PSK A;  1LUK A;  5EHP A;  4JEG A;  1CWD L;  4DGP A;  1GHU A;  2K7A B;  1O4H A;  3KFJ A;  1CSY A;  1AYA A;  1UUR A;  1JYU A;  1O4D A;  1D1Z A;  1AOU F;  3VS5 A;  4K45 A;  5DF6 A;  2HDV A;  2EO3 A;  1BG1 A;  3TKZ A;  2RVF A;  3BUX B;  1A08 A;  1TZE E;  3VS1 A;  3EAZ A;  1LKK A;  5DC9 A;  1B47 A;  1MW4 A;  1BHH A;  1BMB A;  1KA6 A;  1D4T A;  1LCK A;  1BKM A;  2QMS A;  3NHN A;  1P13 A;  4EIH A;  1SPR A;  2Y1N A;  4L1B B;  1QCF A;  1X27 A;  1OO4 A;  4A4B A;  1KSW A;  1LKL A;  1SKJ A;  1SHA A;  3VRQ A;  1HCT B;  1O49 A;  2LNW A;  3IMD A;  3VS4 A;  3N7Y A;  1QG1 E;  2EKX A;  5IBS A;  5I6V A;  3IMJ A;  1O4P A;  3HIZ B;  2EL8 A;  2IUH A;  5HKW A;  3PFV A;  2H46 E;  4F5A A;  1O4O A;  1SHB A;  2FO0 A;  1F1W A;  2MRK A;  1AYB A;  3S8L A;  4XZ1 A;  2EOB A;  1A1A A;  3MAZ A;  1A07 A;  3GQI B;  1OO3 A;  2EO6 A;  1JYQ A;  3IN7 A;  1O4C A;  3PQZ A;  3MXY A;  3UF4 A;  1ZFP E;  5KAZ A;  1O4M A;  3GXX A;  3CWG A;  4E68 A;  1G83 A;  2AUG A;  5EEL A;  4M4Z A;  1FYR A;  2KK6 A;  1NZV A;  1O4Q A;  2L6K A;  1FBV A;  4OHI A;  3PLF B;  1AD5 A;  2DX0 A;  4XZ0 A;  2JYQ A;  2HMH A;  4TZI A;  4JE4 A;  2ECD A;  3T04 A;  5D0J A;  2VIF A;  3S8O A;  1A1C A;  3VRP A;  2YU7 A;  1O43 A;  1AB2 A;  2KNO A;  1A1E A;  5EHR A;  3VS0 A;  1WQU A;  1R1S A;  1M61 A;  2ETZ A;  4JGH A;  1FHS A;  1BKL A;  2LQN A;  1BFJ A;  2ABL A;  5EEQ A;  3US4 A;  2XP1 A;  2ROR A;  3QWX X;  1JYR A;  2LCT A;  4P9Z A;  2EYV A;  4A4C A;  1JWO A;  2LNX A;  4LUE A;  2DVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...