5DF6A

Crystal structure of ptpn11 tandem sh2 domains in complex with a txnip peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
217
structure length
212
Chain Sequence
RRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESKSKVTHVMIRCQKYDVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein phosphatase non-receptor type 11
publication title Structural basis for the regulatory role of the PPxY motifs in the thioredoxin-interacting protein TXNIP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 56
structure length 212
sequence length 217
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2015-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 5df6A01
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 5df6A02
4F5AA 3US4A 2MRJA 2YSXA 1D4WA 3VROA 3MXCA 2EO6A 1JU5A 1A81A 1O48A 1O43A 1FBZA 2SRCA 1O4LA 2GE9A 3S9KA 1BFIA 1ZFPE 2XP1A 2DVJA 4F59A 1BFJA 2SHPA 1Y1UA 2MQIA 3PS5A 3OB2B 1BM2A 3CXLA 1O4CA 1F1WA 1BLJA 1O4KA 1OPKA 1QADA 2IUGA 2DLYA 4JGHA 5EHRA 1BHHA 5GJHA 1R1PA 1H9OA 1X27A 2ABLA 1O4IA 1BF5A 2IUIA 1KA6A 1NZVA 2C0OA 2KNOA 1WQUA 3ZNIA 1O41A 1JYRA 5DC9A 1BKLA 2LNWA 1RPYA 1A1CA 1FBVA 3BKBA 1CJ1A 5HKZA 4ROJA 1I3ZA 1UUSA 5IBMA 4NWGA 3PLFB 1R1SA 2L3TA 1AYCA 2JYQA 3M7FA 3CD3A 1O4FA 5KAZA 1RJAA 3PSKA 3VS7A 2H5KA 2EU0A 5DF6A 4M4ZA 2CI9A 1SPSA 3EAZA 1A1EA 3VS4A 1A1BA 1R1QA 5HKWA 3HIZB 1LKLA 3N84A 2LQWA 4E93A 1O44A 4EY0A 1BKMA 1O4BA 4OHHA 1A07A 3VRZA 1FMKA 3PQZA 2C9WA 2CR4A 1SHDA 1BMBA 1B47A 5EELA 1O46A 2PLDA 2CS0A 1AOUF 1MW4A 1LUIA 1O4AA 3GXWA 1BLKA 3OB1B 1GRIA 2BBUA 2CI8A 1O4NA 1UURA 3S8LA 1A1AA 3UF4A 3IN7A 4H34A 2PNBA 4P9VA 2YU7A 5IBSA 3CBLA 2PNAA 4WWQA 5DC0B 1SHAA 1O42A 2DCRA 5DC4A 2CBLA 2EYZA 3N8MA 1O4JA 1HCTB 2PLEA 3MAZA 1OPLA 1O4QA 1FHSA 1KSWA 2HUWA 3MXYA 5AULA 1O47A 2EL8A 2IUHA 3VRPA 1GHUA 4K2RA 1O4EA 4A4BA 1IS0A 4LUDA 2FCIA 2EO3A 2DLZA 3VGOA 1AOTF 2EKXA 1O4OA 2KK6A 3QWYA 4FL3A 1RQQC 3IMDA 4JE4A 3BUMB 3VRRA 2Y3AB 4OHDA 4F5BA 2VIFA 4K11A 3VS3A 1M27A 2HDVA 1O4HA 1AYBA 3OP0A 1XA6A 2Y1MA 1YVHA 2GSBA 1SKJA 3TKZA 3HCKA 1SPRA 4OHIA 3K2MA 1OO3A 2ECDA 4QSYA 3PFVA 1JWOA 4TZIA 3S8OA 4GPLB 3VRQA 4XZ1A 4K45A 1FU6A 3C7IA 2C0TA 2MC1A 3BUNB 1O45A 1JYUA 5CDWA 4A4CA 3UYOA 3WA4A 5EHPA 5J3XA 3PSJA 1G83A 3T04A 2L4KA 3S8NA 2K7AB 1CSYA 4EIHA 4FL2A 4U17A 3IN8A 1JYQA 1NZLA 3OVEA 3BUOB 5BO4A 3OV1A 4P9ZA 4OHEA 1PICA 1LUKA 1D1ZA 2DM0A 1P13A 2C0IA 1F2FA 4LUEA 1D4TA 4DGXA 1IJRA 2EYVA 5AXIA 2MRKA 2PTKA 3PJPA 3N7YA 1HCSB 1O4RA 4DGPA 3TL0A 1AYAA 2RMXA 4K44A 4D8KA 2CIAA 3VRNA 2HMHA 1O4PA 1AB2A 1X0NA 5EEQA 3NHNA 4OHLA 4XZ0A 2EOBA 5GJIA 2LNXA 3QWXX 4X6SA 3IMJA 1O49A 1LUMA 2HDXA 1X6CA 5I6VA 1BHFA 2CRHA 2B3OA 2MK2A 1TZEE 3CWGA 4H1OA 3EACA 3GQIB 1QG1E 1TCEA 2FO0A 2RORA 2RSYA 3GXXA 1NRVA 4FBNA 3VS1A 1AD5A 5EG3B 1OO4A 2LQNA 2Y1NA 2QMSA 1SHBA 1KA7A 1AYDA 1FYRA 1KC2A 1FU5A 2AOBA 3VRYA 1BG1A 4E68A 4L1BB 2OZOA 1Y57A 1O4DA 2AOAA 3VS0A 2DX0A 3BUWB 4NWFA 1A08A 1A09A 4GWFA 2AUGA 1YVLA 1CWDL 1MILA 1LCKA 3VS5A 2ETZA 1LCJA 4U1PA 3VS2A 3BUXB 3KFJA 2L6KA 2LCTA 3HHMB 5D0JA 1QCFA 1Z3KA 5HKYA 2EYYA 1O4MA 1LKKA 1BHHB 2H46E 4GL9E 2HCKA 1LUNA 1O4GA 1CSZA 2RVFA 1CWEA 2OQ1A 1K9AA 2K79B 4JEGA 3VS6A 2IZVA 1M61A 2H8HA
chains in the Genus database with same CATH superfamily
4F5AA 3US4A 2MRJA 2YSXA 1D4WA 3VROA 3MXCA 2EO6A 1JU5A 1A81A 1O48A 1O43A 1FBZA 2SRCA 1O4LA 2GE9A 3S9KA 1BFIA 1ZFPE 2XP1A 2DVJA 4F59A 1BFJA 2SHPA 1Y1UA 2MQIA 3PS5A 3OB2B 1BM2A 3CXLA 1O4CA 1F1WA 1BLJA 1O4KA 1OPKA 1QADA 2IUGA 2DLYA 4JGHA 2LRAA 5EHRA 1BHHA 5GJHA 1R1PA 1H9OA 1X27A 2ABLA 1O4IA 1BF5A 2IUIA 1KA6A 1NZVA 2C0OA 2KNOA 1WQUA 3ZNIA 1O41A 1JYRA 5DC9A 1BKLA 2LNWA 1RPYA 1A1CA 1FBVA 3BKBA 1CJ1A 5HKZA 4ROJA 1I3ZA 1UUSA 5IBMA 4NWGA 3PLFB 1R1SA 2L3TA 1AYCA 2JYQA 3M7FA 3CD3A 2KGYA 1O4FA 5KAZA 1RJAA 3PSKA 3VS7A 2H5KA 2EU0A 5DF6A 4M4ZA 2CI9A 1SPSA 3EAZA 1A1EA 3VS4A 1A1BA 1R1QA 5HKWA 3HIZB 1LKLA 3N84A 2LQWA 4E93A 1O44A 4EY0A 1BKMA 1O4BA 4OHHA 1A07A 3VRZA 1FMKA 3PQZA 2C9WA 2CR4A 1SHDA 1BMBA 1B47A 5EELA 1O46A 2PLDA 2CS0A 1AOUF 1MW4A 1LUIA 1O4AA 3GXWA 1BLKA 3OB1B 1GRIA 2BBUA 2CI8A 1O4NA 1UURA 3S8LA 1A1AA 3UF4A 3IN7A 4H34A 2PNBA 4P9VA 2YU7A 5IBSA 3CBLA 2PNAA 4WWQA 5DC0B 1SHAA 1O42A 2DCRA 5DC4A 2CBLA 2EYZA 3N8MA 1O4JA 1HCTB 2PLEA 3MAZA 1OPLA 1O4QA 1FHSA 1KSWA 2HUWA 3MXYA 5AULA 1O47A 2EL8A 2IUHA 3VRPA 1GHUA 4K2RA 1O4EA 4A4BA 1IS0A 4LUDA 2FCIA 2EO3A 2DLZA 3VGOA 1AOTF 2EKXA 1O4OA 2KK6A 3QWYA 4FL3A 1RQQC 3IMDA 4JE4A 3BUMB 3VRRA 2Y3AB 4OHDA 4F5BA 2VIFA 4K11A 3VS3A 1M27A 2HDVA 1O4HA 1AYBA 3OP0A 1XA6A 2Y1MA 1YVHA 2GSBA 1SKJA 3TKZA 3HCKA 1SPRA 4OHIA 3K2MA 1OO3A 2ECDA 4QSYA 3PFVA 1JWOA 4TZIA 3S8OA 4GPLB 3VRQA 4XZ1A 4K45A 1FU6A 3C7IA 2C0TA 2MC1A 3BUNB 1O45A 1JYUA 5CDWA 4A4CA 3UYOA 3WA4A 5EHPA 5J3XA 3PSJA 1G83A 3T04A 2L4KA 3S8NA 2K7AB 1CSYA 4EIHA 4FL2A 4U17A 3IN8A 1JYQA 1NZLA 3OVEA 3BUOB 5BO4A 3OV1A 4P9ZA 4OHEA 1PICA 1LUKA 1D1ZA 2DM0A 1P13A 2C0IA 1F2FA 4LUEA 1D4TA 4DGXA 1IJRA 2EYVA 5AXIA 2MRKA 2PTKA 3PJPA 3N7YA 1HCSB 1O4RA 4DGPA 3K2TA 3TL0A 1AYAA 2RMXA 4K44A 4D8KA 2CIAA 3VRNA 2HMHA 1O4PA 1AB2A 1X0NA 5EEQA 3NHNA 4OHLA 4XZ0A 2EOBA 5GJIA 2LNXA 3QWXX 4X6SA 3IMJA 1O49A 1LUMA 2HDXA 1X6CA 5I6VA 1BHFA 2CRHA 2B3OA 2MK2A 1TZEE 3CWGA 4H1OA 3EACA 3GQIB 1QG1E 1TCEA 2FO0A 2RORA 2RSYA 3GXXA 1NRVA 4FBNA 3LYVA 3VS1A 1AD5A 5EG3B 1OO4A 2LQNA 2Y1NA 2QMSA 1SHBA 1KA7A 1AYDA 1FYRA 1KC2A 1FU5A 2AOBA 3VRYA 1BG1A 4E68A 4L1BB 2OZOA 1Y57A 1O4DA 2AOAA 3VS0A 2DX0A 3BUWB 4NWFA 1A08A 1A09A 4GWFA 2AUGA 1YVLA 1CWDL 1MILA 1LCKA 3VS5A 2ETZA 1LCJA 4U1PA 3VS2A 3BUXB 3KFJA 2L6KA 2LCTA 3HHMB 5D0JA 1QCFA 1Z3KA 5HKYA 2EYYA 1O4MA 1LKKA 1BHHB 2H46E 4GL9E 2HCKA 1LUNA 1O4GA 1CSZA 2RVFA 1CWEA 2OQ1A 1K9AA 2K79B 4JEGA 3VS6A 2IZVA 1M61A 2H8HA
chains in the Genus database with same CATH topology
4F5AA 3US4A 2MRJA 2YSXA 1D4WA 3VROA 3MXCA 2EO6A 1JU5A 1A81A 1O48A 1O43A 1FBZA 2SRCA 1O4LA 2GE9A 3S9KA 1BFIA 1ZFPE 2XP1A 2DVJA 4F59A 1BFJA 2SHPA 1Y1UA 2MQIA 3PS5A 3OB2B 1BM2A 3CXLA 1O4CA 1F1WA 1BLJA 1O4KA 1OPKA 1QADA 2IUGA 2DLYA 4JGHA 5EHRA 1BHHA 5GJHA 1R1PA 1H9OA 1X27A 2ABLA 1O4IA 1BF5A 2IUIA 1KA6A 1NZVA 2C0OA 2KNOA 1WQUA 3ZNIA 1O41A 1JYRA 5DC9A 1BKLA 2LNWA 1RPYA 1A1CA 1FBVA 3BKBA 1CJ1A 5HKZA 4ROJA 1I3ZA 1UUSA 5IBMA 4NWGA 3PLFB 1R1SA 2L3TA 1AYCA 2JYQA 3M7FA 3CD3A 1O4FA 5KAZA 1RJAA 3PSKA 3VS7A 2H5KA 2EU0A 5DF6A 4M4ZA 2CI9A 1SPSA 3EAZA 1A1EA 3VS4A 1A1BA 1R1QA 5HKWA 3HIZB 1LKLA 3N84A 2LQWA 4E93A 1O44A 4EY0A 1BKMA 1O4BA 4OHHA 1A07A 3VRZA 1FMKA 3PQZA 2C9WA 2CR4A 1SHDA 1BMBA 1B47A 5EELA 1O46A 2PLDA 2CS0A 1AOUF 1MW4A 1LUIA 1O4AA 3GXWA 1BLKA 3OB1B 1GRIA 2BBUA 2CI8A 1O4NA 1UURA 3S8LA 1A1AA 3UF4A 3IN7A 4H34A 2PNBA 4P9VA 2YU7A 5IBSA 3CBLA 2PNAA 4WWQA 5DC0B 1SHAA 1O42A 2DCRA 5DC4A 2CBLA 2EYZA 3N8MA 1O4JA 1HCTB 2PLEA 3MAZA 1OPLA 1O4QA 1FHSA 1KSWA 2HUWA 3MXYA 5AULA 1O47A 2EL8A 2IUHA 3VRPA 1GHUA 4K2RA 1O4EA 4A4BA 1IS0A 4LUDA 2FCIA 2EO3A 2DLZA 3VGOA 1AOTF 2EKXA 1O4OA 2KK6A 3QWYA 4FL3A 1RQQC 3IMDA 4JE4A 3BUMB 3VRRA 2Y3AB 4OHDA 4F5BA 2VIFA 4K11A 3VS3A 1M27A 2HDVA 1O4HA 1AYBA 3OP0A 1XA6A 2Y1MA 1YVHA 2GSBA 1SKJA 3TKZA 3HCKA 1SPRA 4OHIA 3K2MA 1OO3A 2ECDA 4QSYA 3PFVA 1JWOA 4TZIA 3S8OA 4GPLB 3VRQA 4XZ1A 4K45A 1FU6A 3C7IA 2C0TA 2MC1A 3BUNB 1O45A 1JYUA 5CDWA 4A4CA 3UYOA 3WA4A 5EHPA 5J3XA 3PSJA 1G83A 3T04A 2L4KA 3S8NA 2K7AB 1CSYA 4EIHA 4FL2A 4U17A 3IN8A 1JYQA 1NZLA 3OVEA 3BUOB 5BO4A 3OV1A 4P9ZA 4OHEA 1PICA 1LUKA 1D1ZA 2DM0A 1P13A 2C0IA 1F2FA 4LUEA 1D4TA 4DGXA 1IJRA 2EYVA 5AXIA 2MRKA 2PTKA 3PJPA 3N7YA 1HCSB 1O4RA 4DGPA 3TL0A 1AYAA 2RMXA 4K44A 4D8KA 2CIAA 3VRNA 2HMHA 1O4PA 1AB2A 1X0NA 5EEQA 3NHNA 4OHLA 4XZ0A 2EOBA 5GJIA 2LNXA 3QWXX 4X6SA 3IMJA 1O49A 1LUMA 2HDXA 1X6CA 5I6VA 1BHFA 2CRHA 2B3OA 2MK2A 1TZEE 3CWGA 4H1OA 3EACA 3GQIB 1QG1E 1TCEA 2FO0A 2RORA 2RSYA 3GXXA 1NRVA 4FBNA 3VS1A 1AD5A 5EG3B 1OO4A 2LQNA 2Y1NA 2QMSA 1SHBA 1KA7A 1AYDA 1FYRA 1KC2A 1FU5A 2AOBA 3VRYA 1BG1A 4E68A 4L1BB 2OZOA 1Y57A 1O4DA 2AOAA 3VS0A 2DX0A 3BUWB 4NWFA 1A08A 1A09A 4GWFA 2AUGA 1YVLA 1CWDL 1MILA 1LCKA 3VS5A 2ETZA 1LCJA 4U1PA 3VS2A 3BUXB 3KFJA 2L6KA 2LCTA 3HHMB 5D0JA 1QCFA 1Z3KA 5HKYA 2EYYA 1O4MA 1LKKA 1BHHB 2H46E 4GL9E 2HCKA 1LUNA 1O4GA 1CSZA 2RVFA 1CWEA 2OQ1A 1K9AA 2K79B 4JEGA 3VS6A 2IZVA 1M61A 2H8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F5A A;  3US4 A;  2MRJ A;  2YSX A;  1D4W A;  3VRO A;  3MXC A;  2EO6 A;  1JU5 A;  1A81 A;  1O48 A;  1O43 A;  1FBZ A;  2SRC A;  1O4L A;  2GE9 A;  3S9K A;  1BFI A;  1ZFP E;  2XP1 A;  2DVJ A;  4F59 A;  1BFJ A;  2SHP A;  1Y1U A;  2MQI A;  3PS5 A;  3OB2 B;  1BM2 A;  3CXL A;  1O4C A;  1F1W A;  1BLJ A;  1O4K A;  1OPK A;  1QAD A;  2IUG A;  2DLY A;  4JGH A;  5EHR A;  1BHH A;  5GJH A;  1R1P A;  1H9O A;  1X27 A;  2ABL A;  1O4I A;  1BF5 A;  2IUI A;  1KA6 A;  1NZV A;  2C0O A;  2KNO A;  1WQU A;  3ZNI A;  1O41 A;  1JYR A;  5DC9 A;  1BKL A;  2LNW A;  1RPY A;  1A1C A;  1FBV A;  3BKB A;  1CJ1 A;  5HKZ A;  4ROJ A;  1I3Z A;  1UUS A;  5IBM A;  4NWG A;  3PLF B;  1R1S A;  2L3T A;  1AYC A;  2JYQ A;  3M7F A;  3CD3 A;  1O4F A;  5KAZ A;  1RJA A;  3PSK A;  3VS7 A;  2H5K A;  2EU0 A;  5DF6 A;  4M4Z A;  2CI9 A;  1SPS A;  3EAZ A;  1A1E A;  3VS4 A;  1A1B A;  1R1Q A;  5HKW A;  3HIZ B;  1LKL A;  3N84 A;  2LQW A;  4E93 A;  1O44 A;  4EY0 A;  1BKM A;  1O4B A;  4OHH A;  1A07 A;  3VRZ A;  1FMK A;  3PQZ A;  2C9W A;  2CR4 A;  1SHD A;  1BMB A;  1B47 A;  5EEL A;  1O46 A;  2PLD A;  2CS0 A;  1AOU F;  1MW4 A;  1LUI A;  1O4A A;  3GXW A;  1BLK A;  3OB1 B;  1GRI A;  2BBU A;  2CI8 A;  1O4N A;  1UUR A;  3S8L A;  1A1A A;  3UF4 A;  3IN7 A;  4H34 A;  2PNB A;  4P9V A;  2YU7 A;  5IBS A;  3CBL A;  2PNA A;  4WWQ A;  5DC0 B;  1SHA A;  1O42 A;  2DCR A;  5DC4 A;  2CBL A;  2EYZ A;  3N8M A;  1O4J A;  1HCT B;  2PLE A;  3MAZ A;  1OPL A;  1O4Q A;  1FHS A;  1KSW A;  2HUW A;  3MXY A;  5AUL A;  1O47 A;  2EL8 A;  2IUH A;  3VRP A;  1GHU A;  4K2R A;  1O4E A;  4A4B A;  1IS0 A;  4LUD A;  2FCI A;  2EO3 A;  2DLZ A;  3VGO A;  1AOT F;  2EKX A;  1O4O A;  2KK6 A;  3QWY A;  4FL3 A;  1RQQ C;  3IMD A;  4JE4 A;  3BUM B;  3VRR A;  2Y3A B;  4OHD A;  4F5B A;  2VIF A;  4K11 A;  3VS3 A;  1M27 A;  2HDV A;  1O4H A;  1AYB A;  3OP0 A;  1XA6 A;  2Y1M A;  1YVH A;  2GSB A;  1SKJ A;  3TKZ A;  3HCK A;  1SPR A;  4OHI A;  3K2M A;  1OO3 A;  2ECD A;  4QSY A;  3PFV A;  1JWO A;  4TZI A;  3S8O A;  4GPL B;  3VRQ A;  4XZ1 A;  4K45 A;  1FU6 A;  3C7I A;  2C0T A;  2MC1 A;  3BUN B;  1O45 A;  1JYU A;  5CDW A;  4A4C A;  3UYO A;  3WA4 A;  5EHP A;  5J3X A;  3PSJ A;  1G83 A;  3T04 A;  2L4K A;  3S8N A;  2K7A B;  1CSY A;  4EIH A;  4FL2 A;  4U17 A;  3IN8 A;  1JYQ A;  1NZL A;  3OVE A;  3BUO B;  5BO4 A;  3OV1 A;  4P9Z A;  4OHE A;  1PIC A;  1LUK A;  1D1Z A;  2DM0 A;  1P13 A;  2C0I A;  1F2F A;  4LUE A;  1D4T A;  4DGX A;  1IJR A;  2EYV A;  5AXI A;  2MRK A;  2PTK A;  3PJP A;  3N7Y A;  1HCS B;  1O4R A;  4DGP A;  3TL0 A;  1AYA A;  2RMX A;  4K44 A;  4D8K A;  2CIA A;  3VRN A;  2HMH A;  1O4P A;  1AB2 A;  1X0N A;  5EEQ A;  3NHN A;  4OHL A;  4XZ0 A;  2EOB A;  5GJI A;  2LNX A;  3QWX X;  4X6S A;  3IMJ A;  1O49 A;  1LUM A;  2HDX A;  1X6C A;  5I6V A;  1BHF A;  2CRH A;  2B3O A;  2MK2 A;  1TZE E;  3CWG A;  4H1O A;  3EAC A;  3GQI B;  1QG1 E;  1TCE A;  2FO0 A;  2ROR A;  2RSY A;  3GXX A;  1NRV A;  4FBN A;  3VS1 A;  1AD5 A;  5EG3 B;  1OO4 A;  2LQN A;  2Y1N A;  2QMS A;  1SHB A;  1KA7 A;  1AYD A;  1FYR A;  1KC2 A;  1FU5 A;  2AOB A;  3VRY A;  1BG1 A;  4E68 A;  4L1B B;  2OZO A;  1Y57 A;  1O4D A;  2AOA A;  3VS0 A;  2DX0 A;  3BUW B;  4NWF A;  1A08 A;  1A09 A;  4GWF A;  2AUG A;  1YVL A;  1CWD L;  1MIL A;  1LCK A;  3VS5 A;  2ETZ A;  1LCJ A;  4U1P A;  3VS2 A;  3BUX B;  3KFJ A;  2L6K A;  2LCT A;  3HHM B;  5D0J A;  1QCF A;  1Z3K A;  5HKY A;  2EYY A;  1O4M A;  1LKK A;  1BHH B;  2H46 E;  4GL9 E;  2HCK A;  1LUN A;  1O4G A;  1CSZ A;  2RVF A;  1CWE A;  2OQ1 A;  1K9A A;  2K79 B;  4JEG A;  3VS6 A;  2IZV A;  1M61 A;  2H8H A; 
#chains in the Genus database with same CATH topology
 4F5A A;  3US4 A;  2MRJ A;  2YSX A;  1D4W A;  3VRO A;  3MXC A;  2EO6 A;  1JU5 A;  1A81 A;  1O48 A;  1O43 A;  1FBZ A;  2SRC A;  1O4L A;  2GE9 A;  3S9K A;  1BFI A;  1ZFP E;  2XP1 A;  2DVJ A;  4F59 A;  1BFJ A;  2SHP A;  1Y1U A;  2MQI A;  3PS5 A;  3OB2 B;  1BM2 A;  3CXL A;  1O4C A;  1F1W A;  1BLJ A;  1O4K A;  1OPK A;  1QAD A;  2IUG A;  2DLY A;  4JGH A;  2LRA A;  5EHR A;  1BHH A;  5GJH A;  1R1P A;  1H9O A;  1X27 A;  2ABL A;  1O4I A;  1BF5 A;  2IUI A;  1KA6 A;  1NZV A;  2C0O A;  2KNO A;  1WQU A;  3ZNI A;  1O41 A;  1JYR A;  5DC9 A;  1BKL A;  2LNW A;  1RPY A;  1A1C A;  1FBV A;  3BKB A;  1CJ1 A;  5HKZ A;  4ROJ A;  1I3Z A;  1UUS A;  5IBM A;  4NWG A;  3PLF B;  1R1S A;  2L3T A;  1AYC A;  2JYQ A;  3M7F A;  3CD3 A;  2KGY A;  1O4F A;  5KAZ A;  1RJA A;  3PSK A;  3VS7 A;  2H5K A;  2EU0 A;  5DF6 A;  4M4Z A;  2CI9 A;  1SPS A;  3EAZ A;  1A1E A;  3VS4 A;  1A1B A;  1R1Q A;  5HKW A;  3HIZ B;  1LKL A;  3N84 A;  2LQW A;  4E93 A;  1O44 A;  4EY0 A;  1BKM A;  1O4B A;  4OHH A;  1A07 A;  3VRZ A;  1FMK A;  3PQZ A;  2C9W A;  2CR4 A;  1SHD A;  1BMB A;  1B47 A;  5EEL A;  1O46 A;  2PLD A;  2CS0 A;  1AOU F;  1MW4 A;  1LUI A;  1O4A A;  3GXW A;  1BLK A;  3OB1 B;  1GRI A;  2BBU A;  2CI8 A;  1O4N A;  1UUR A;  3S8L A;  1A1A A;  3UF4 A;  3IN7 A;  4H34 A;  2PNB A;  4P9V A;  2YU7 A;  5IBS A;  3CBL A;  2PNA A;  4WWQ A;  5DC0 B;  1SHA A;  1O42 A;  2DCR A;  5DC4 A;  2CBL A;  2EYZ A;  3N8M A;  1O4J A;  1HCT B;  2PLE A;  3MAZ A;  1OPL A;  1O4Q A;  1FHS A;  1KSW A;  2HUW A;  3MXY A;  5AUL A;  1O47 A;  2EL8 A;  2IUH A;  3VRP A;  1GHU A;  4K2R A;  1O4E A;  4A4B A;  1IS0 A;  4LUD A;  2FCI A;  2EO3 A;  2DLZ A;  3VGO A;  1AOT F;  2EKX A;  1O4O A;  2KK6 A;  3QWY A;  4FL3 A;  1RQQ C;  3IMD A;  4JE4 A;  3BUM B;  3VRR A;  2Y3A B;  4OHD A;  4F5B A;  2VIF A;  4K11 A;  3VS3 A;  1M27 A;  2HDV A;  1O4H A;  1AYB A;  3OP0 A;  1XA6 A;  2Y1M A;  1YVH A;  2GSB A;  1SKJ A;  3TKZ A;  3HCK A;  1SPR A;  4OHI A;  3K2M A;  1OO3 A;  2ECD A;  4QSY A;  3PFV A;  1JWO A;  4TZI A;  3S8O A;  4GPL B;  3VRQ A;  4XZ1 A;  4K45 A;  1FU6 A;  3C7I A;  2C0T A;  2MC1 A;  3BUN B;  1O45 A;  1JYU A;  5CDW A;  4A4C A;  3UYO A;  3WA4 A;  5EHP A;  5J3X A;  3PSJ A;  1G83 A;  3T04 A;  2L4K A;  3S8N A;  2K7A B;  1CSY A;  4EIH A;  4FL2 A;  4U17 A;  3IN8 A;  1JYQ A;  1NZL A;  3OVE A;  3BUO B;  5BO4 A;  3OV1 A;  4P9Z A;  4OHE A;  1PIC A;  1LUK A;  1D1Z A;  2DM0 A;  1P13 A;  2C0I A;  1F2F A;  4LUE A;  1D4T A;  4DGX A;  1IJR A;  2EYV A;  5AXI A;  2MRK A;  2PTK A;  3PJP A;  3N7Y A;  1HCS B;  1O4R A;  4DGP A;  3K2T A;  3TL0 A;  1AYA A;  2RMX A;  4K44 A;  4D8K A;  2CIA A;  3VRN A;  2HMH A;  1O4P A;  1AB2 A;  1X0N A;  5EEQ A;  3NHN A;  4OHL A;  4XZ0 A;  2EOB A;  5GJI A;  2LNX A;  3QWX X;  4X6S A;  3IMJ A;  1O49 A;  1LUM A;  2HDX A;  1X6C A;  5I6V A;  1BHF A;  2CRH A;  2B3O A;  2MK2 A;  1TZE E;  3CWG A;  4H1O A;  3EAC A;  3GQI B;  1QG1 E;  1TCE A;  2FO0 A;  2ROR A;  2RSY A;  3GXX A;  1NRV A;  4FBN A;  3LYV A;  3VS1 A;  1AD5 A;  5EG3 B;  1OO4 A;  2LQN A;  2Y1N A;  2QMS A;  1SHB A;  1KA7 A;  1AYD A;  1FYR A;  1KC2 A;  1FU5 A;  2AOB A;  3VRY A;  1BG1 A;  4E68 A;  4L1B B;  2OZO A;  1Y57 A;  1O4D A;  2AOA A;  3VS0 A;  2DX0 A;  3BUW B;  4NWF A;  1A08 A;  1A09 A;  4GWF A;  2AUG A;  1YVL A;  1CWD L;  1MIL A;  1LCK A;  3VS5 A;  2ETZ A;  1LCJ A;  4U1P A;  3VS2 A;  3BUX B;  3KFJ A;  2L6K A;  2LCT A;  3HHM B;  5D0J A;  1QCF A;  1Z3K A;  5HKY A;  2EYY A;  1O4M A;  1LKK A;  1BHH B;  2H46 E;  4GL9 E;  2HCK A;  1LUN A;  1O4G A;  1CSZ A;  2RVF A;  1CWE A;  2OQ1 A;  1K9A A;  2K79 B;  4JEG A;  3VS6 A;  2IZV A;  1M61 A;  2H8H A; 
#chains in the Genus database with same CATH homology
 4F5A A;  3US4 A;  2MRJ A;  2YSX A;  1D4W A;  3VRO A;  3MXC A;  2EO6 A;  1JU5 A;  1A81 A;  1O48 A;  1O43 A;  1FBZ A;  2SRC A;  1O4L A;  2GE9 A;  3S9K A;  1BFI A;  1ZFP E;  2XP1 A;  2DVJ A;  4F59 A;  1BFJ A;  2SHP A;  1Y1U A;  2MQI A;  3PS5 A;  3OB2 B;  1BM2 A;  3CXL A;  1O4C A;  1F1W A;  1BLJ A;  1O4K A;  1OPK A;  1QAD A;  2IUG A;  2DLY A;  4JGH A;  5EHR A;  1BHH A;  5GJH A;  1R1P A;  1H9O A;  1X27 A;  2ABL A;  1O4I A;  1BF5 A;  2IUI A;  1KA6 A;  1NZV A;  2C0O A;  2KNO A;  1WQU A;  3ZNI A;  1O41 A;  1JYR A;  5DC9 A;  1BKL A;  2LNW A;  1RPY A;  1A1C A;  1FBV A;  3BKB A;  1CJ1 A;  5HKZ A;  4ROJ A;  1I3Z A;  1UUS A;  5IBM A;  4NWG A;  3PLF B;  1R1S A;  2L3T A;  1AYC A;  2JYQ A;  3M7F A;  3CD3 A;  1O4F A;  5KAZ A;  1RJA A;  3PSK A;  3VS7 A;  2H5K A;  2EU0 A;  5DF6 A;  4M4Z A;  2CI9 A;  1SPS A;  3EAZ A;  1A1E A;  3VS4 A;  1A1B A;  1R1Q A;  5HKW A;  3HIZ B;  1LKL A;  3N84 A;  2LQW A;  4E93 A;  1O44 A;  4EY0 A;  1BKM A;  1O4B A;  4OHH A;  1A07 A;  3VRZ A;  1FMK A;  3PQZ A;  2C9W A;  2CR4 A;  1SHD A;  1BMB A;  1B47 A;  5EEL A;  1O46 A;  2PLD A;  2CS0 A;  1AOU F;  1MW4 A;  1LUI A;  1O4A A;  3GXW A;  1BLK A;  3OB1 B;  1GRI A;  2BBU A;  2CI8 A;  1O4N A;  1UUR A;  3S8L A;  1A1A A;  3UF4 A;  3IN7 A;  4H34 A;  2PNB A;  4P9V A;  2YU7 A;  5IBS A;  3CBL A;  2PNA A;  4WWQ A;  5DC0 B;  1SHA A;  1O42 A;  2DCR A;  5DC4 A;  2CBL A;  2EYZ A;  3N8M A;  1O4J A;  1HCT B;  2PLE A;  3MAZ A;  1OPL A;  1O4Q A;  1FHS A;  1KSW A;  2HUW A;  3MXY A;  5AUL A;  1O47 A;  2EL8 A;  2IUH A;  3VRP A;  1GHU A;  4K2R A;  1O4E A;  4A4B A;  1IS0 A;  4LUD A;  2FCI A;  2EO3 A;  2DLZ A;  3VGO A;  1AOT F;  2EKX A;  1O4O A;  2KK6 A;  3QWY A;  4FL3 A;  1RQQ C;  3IMD A;  4JE4 A;  3BUM B;  3VRR A;  2Y3A B;  4OHD A;  4F5B A;  2VIF A;  4K11 A;  3VS3 A;  1M27 A;  2HDV A;  1O4H A;  1AYB A;  3OP0 A;  1XA6 A;  2Y1M A;  1YVH A;  2GSB A;  1SKJ A;  3TKZ A;  3HCK A;  1SPR A;  4OHI A;  3K2M A;  1OO3 A;  2ECD A;  4QSY A;  3PFV A;  1JWO A;  4TZI A;  3S8O A;  4GPL B;  3VRQ A;  4XZ1 A;  4K45 A;  1FU6 A;  3C7I A;  2C0T A;  2MC1 A;  3BUN B;  1O45 A;  1JYU A;  5CDW A;  4A4C A;  3UYO A;  3WA4 A;  5EHP A;  5J3X A;  3PSJ A;  1G83 A;  3T04 A;  2L4K A;  3S8N A;  2K7A B;  1CSY A;  4EIH A;  4FL2 A;  4U17 A;  3IN8 A;  1JYQ A;  1NZL A;  3OVE A;  3BUO B;  5BO4 A;  3OV1 A;  4P9Z A;  4OHE A;  1PIC A;  1LUK A;  1D1Z A;  2DM0 A;  1P13 A;  2C0I A;  1F2F A;  4LUE A;  1D4T A;  4DGX A;  1IJR A;  2EYV A;  5AXI A;  2MRK A;  2PTK A;  3PJP A;  3N7Y A;  1HCS B;  1O4R A;  4DGP A;  3TL0 A;  1AYA A;  2RMX A;  4K44 A;  4D8K A;  2CIA A;  3VRN A;  2HMH A;  1O4P A;  1AB2 A;  1X0N A;  5EEQ A;  3NHN A;  4OHL A;  4XZ0 A;  2EOB A;  5GJI A;  2LNX A;  3QWX X;  4X6S A;  3IMJ A;  1O49 A;  1LUM A;  2HDX A;  1X6C A;  5I6V A;  1BHF A;  2CRH A;  2B3O A;  2MK2 A;  1TZE E;  3CWG A;  4H1O A;  3EAC A;  3GQI B;  1QG1 E;  1TCE A;  2FO0 A;  2ROR A;  2RSY A;  3GXX A;  1NRV A;  4FBN A;  3VS1 A;  1AD5 A;  5EG3 B;  1OO4 A;  2LQN A;  2Y1N A;  2QMS A;  1SHB A;  1KA7 A;  1AYD A;  1FYR A;  1KC2 A;  1FU5 A;  2AOB A;  3VRY A;  1BG1 A;  4E68 A;  4L1B B;  2OZO A;  1Y57 A;  1O4D A;  2AOA A;  3VS0 A;  2DX0 A;  3BUW B;  4NWF A;  1A08 A;  1A09 A;  4GWF A;  2AUG A;  1YVL A;  1CWD L;  1MIL A;  1LCK A;  3VS5 A;  2ETZ A;  1LCJ A;  4U1P A;  3VS2 A;  3BUX B;  3KFJ A;  2L6K A;  2LCT A;  3HHM B;  5D0J A;  1QCF A;  1Z3K A;  5HKY A;  2EYY A;  1O4M A;  1LKK A;  1BHH B;  2H46 E;  4GL9 E;  2HCK A;  1LUN A;  1O4G A;  1CSZ A;  2RVF A;  1CWE A;  2OQ1 A;  1K9A A;  2K79 B;  4JEG A;  3VS6 A;  2IZV A;  1M61 A;  2H8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...