2CIAA

Human nck2 sh2-domain in complex with a decaphosphopeptide from translocated intimin receptor (tir) of epec
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
b'SEWYYGNVTRHQAECALNERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHYKKAPIFTSEHGEKLYLVRALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYTOPLASMIC PROTEIN NCK2
publication title The Phosphotyrosine Peptide Binding Specificity of Nck1 and Nck2 Src Homology 2 Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh2-domain
total genus 28
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2ciaA00
3QWXX 3BUXB 1YVHA 2MRJA 2EYYA 1A09A 1BHHB 2LQWA 3N7YA 1SPSA 1LKKA 2MQIA 4QSYA 1O4EA 3OB2B 2Y1MA 4L1BB 3BUWB 1LUIA 1LCKA 1X0NA 3MAZA 3T04A 3M7FA 4OHIA 1A07A 1R1SA 1O4IA 4EIHA 3TL0A 3VRZA 1IS0A 3NHNA 1O4MA 1BMBA 4OHDA 2AOBA 3UYOA 3S8NA 1O43A 1BLKA 1RJAA 4GWFA 2KNOA 3HHMB 1WQUA 2K7AB 1TCEA 2C0IA 1O4DA 1SHBA 2CI8A 1BKLA 3OP0A 2Y3AB 4F59A 3VRPA 4H34A 1OO3A 2CRHA 1JYQA 1O4OA 3VS7A 2FO0A 1AYDA 3VS4A 1AOTF 4FL3A 3IN8A 2CBLA 1CSZA 2DM0A 1O4HA 1O46A 2PLDA 3VS2A 4P9ZA 5DC9A 2RMXA 1KSWA 1O4RA 1FYRA 2CIAA 5IBMA 3EAZA 1H9OA 2MRKA 1Y1UA 2GE9A 2PNBA 1R1PA 2FCIA 4OHHA 1BG1A 4JGHA 1CWDL 3IN7A 3VRQA 2IZVA 1FU5A 4EY0A 1SHAA 3OV1A 1NZLA 3OVEA 2DLZA 4XZ0A 1MILA 1AD5A 1YVLA 3KFJA 1FBVA 2SHPA 2BBUA 3VS5A 2VIFA 1A1CA 2H46E 4NWGA 1BHFA 4K44A 3VGOA 1BF5A 5GJHA 1O4JA 5EELA 1O4PA 1SHDA 1Y57A 1K9AA 1O4LA 4K45A 3ZNIA 1D1ZA 2L3TA 2PLEA 2AUGA 2IUIA 4TZIA 1GRIA 1OPLA 3PJPA 4GPLB 3PFVA 1BFJA 5CDWA 3VRNA 2XP1A 2H5KA 3VS3A 1A1AA 4F5BA 3S9KA 4LUDA 1I3ZA 1SKJA 3PQZA 2DX0A 1MW4A 1CSYA 1M27A 1AOUF 3GXXA 2KK6A 2DVJA 1JYUA 2IUHA 2JYQA 2HCKA 1AYCA 4K2RA 4P9VA 1X6CA 3IMDA 2YSXA 2H8HA 2PTKA 3OB1B 1O41A 1XA6A 5DF6A 5EHRA 2CS0A 4ROJA 1KC2A 1RPYA 2EU0A 1BM2A 2B3OA 2GSBA 2C0OA 2LNXA 5D0JA 1FMKA 1A1BA 1IJRA 2CI9A 1FHSA 1BLJA 1D4WA 2DLYA 4K11A 3HIZB 1KA6A 3VS1A 2RSYA 3VS6A 2C9WA 1P13A 3GXWA 1HCSB 4OHEA 3K2MA 4F5AA 2LQNA 2IUGA 1LUNA 1NRVA 2ETZA 1OPKA 2CR4A 1QG1E 1HCTB 1O42A 3BUNB 3TKZA 3EACA 3VS0A 1LUKA 1B47A 3HCKA 3MXYA 2YU7A 5DC0B 5I6VA 2L6KA 4A4CA 3VRRA 1SPRA 3UF4A 1M61A 1NZVA 1A81A 3PSJA 2EYZA 1BHHA 5AULA 4A4BA 1O4FA 1TZEE 1O4GA 1O4KA 3QWYA 4D8KA 2EKXA 5AXIA 5DC4A 3WA4A 2C0TA 1RQQC 3CWGA 5HKWA 2MC1A 3GQIB 2MK2A 1BFIA 3N8MA 1A08A 3N84A 4DGPA 2L4KA 3S8OA 2OZOA 1X27A 4XZ1A 1AYAA 1AYBA 2RORA 1JU5A 3PS5A 3BUMB 2QMSA 5EEQA 3CD3A 4DGXA 1Z3KA 3S8LA 1O48A 1CJ1A 2ECDA 1O47A 3MXCA 5EHPA 2EO6A 2K79B 3CBLA 1JWOA 2DCRA 2ABLA 2HUWA 1R1QA 2HDXA 1PICA 1LKLA 1O4NA 2AOAA 5HKYA 1F2FA 4GL9E 4U1PA 2HMHA 2SRCA 2EOBA 2LCTA 1LCJA 5GJIA 3IMJA 3BUOB 2EL8A 1O4QA 5BO4A 4LUEA 3VROA 2LNWA 1G83A 2RVFA 3US4A 5HKZA 1A1EA 1F1WA 2EO3A 1O44A 3PLFB 3CXLA 1O49A 4M4ZA 1GHUA 5J3XA 1O45A 1OO4A 4JEGA 1LUMA 1UURA 3C7IA 4H1OA 1JYRA 1AB2A 4NWFA 5KAZA 3PSKA 1UUSA 1O4BA 1O4AA 4E68A 1QCFA 3VRYA 1O4CA 2PNAA 2EYVA 2HDVA 3BKBA 1BKMA 2OQ1A 2Y1NA 4OHLA 5EG3B 4U17A 4WWQA 4FL2A 1KA7A 1FU6A 1D4TA 4X6SA 1ZFPE 4JE4A 1CWEA 4E93A 5IBSA 1QADA 1FBZA 4FBNA
chains in the Genus database with same CATH superfamily
3QWXX 3BUXB 1YVHA 2MRJA 2EYYA 1A09A 1BHHB 2LQWA 3N7YA 1SPSA 1LKKA 2MQIA 4QSYA 1O4EA 3OB2B 2Y1MA 4L1BB 3BUWB 1LUIA 1LCKA 1X0NA 3MAZA 2KGYA 3T04A 3M7FA 4OHIA 1A07A 1R1SA 1O4IA 4EIHA 3TL0A 3VRZA 1IS0A 3NHNA 1O4MA 1BMBA 4OHDA 2AOBA 3UYOA 3S8NA 1O43A 1BLKA 1RJAA 4GWFA 2KNOA 3HHMB 1WQUA 2K7AB 1TCEA 2C0IA 1O4DA 1SHBA 2CI8A 1BKLA 3OP0A 2Y3AB 4F59A 3VRPA 4H34A 1OO3A 2CRHA 1JYQA 1O4OA 3VS7A 2FO0A 1AYDA 3VS4A 1AOTF 4FL3A 3IN8A 2CBLA 1CSZA 2DM0A 1O4HA 1O46A 2PLDA 3VS2A 4P9ZA 5DC9A 2RMXA 1KSWA 1O4RA 1FYRA 2CIAA 5IBMA 3EAZA 1H9OA 2MRKA 1Y1UA 2GE9A 2PNBA 1R1PA 2FCIA 4OHHA 1BG1A 4JGHA 1CWDL 3IN7A 3VRQA 2IZVA 1FU5A 4EY0A 1SHAA 3OV1A 1NZLA 3OVEA 2DLZA 4XZ0A 1MILA 1AD5A 1YVLA 3KFJA 1FBVA 2SHPA 2BBUA 3VS5A 2VIFA 1A1CA 2H46E 4NWGA 1BHFA 4K44A 3VGOA 1BF5A 5GJHA 1O4JA 5EELA 1O4PA 1SHDA 1Y57A 1K9AA 1O4LA 4K45A 3ZNIA 1D1ZA 2L3TA 2PLEA 2AUGA 2IUIA 4TZIA 1GRIA 1OPLA 3PJPA 4GPLB 3PFVA 1BFJA 5CDWA 3VRNA 2XP1A 2H5KA 3VS3A 1A1AA 4F5BA 3S9KA 4LUDA 1I3ZA 1SKJA 3PQZA 2DX0A 1MW4A 1CSYA 1M27A 1AOUF 3GXXA 2KK6A 2DVJA 1JYUA 2IUHA 2JYQA 2HCKA 1AYCA 4K2RA 4P9VA 1X6CA 3IMDA 2YSXA 2H8HA 2PTKA 3OB1B 1O41A 1XA6A 5DF6A 5EHRA 2CS0A 4ROJA 1KC2A 1RPYA 2EU0A 1BM2A 2B3OA 2GSBA 2C0OA 2LNXA 5D0JA 1FMKA 1A1BA 1IJRA 2CI9A 1FHSA 1BLJA 1D4WA 2DLYA 4K11A 3HIZB 1KA6A 3VS1A 2RSYA 3VS6A 2C9WA 1P13A 3GXWA 1HCSB 4OHEA 3K2MA 4F5AA 2LQNA 2IUGA 1LUNA 1NRVA 2ETZA 1OPKA 2CR4A 1QG1E 1HCTB 1O42A 3BUNB 3TKZA 3EACA 3VS0A 1LUKA 1B47A 3HCKA 3MXYA 2YU7A 5DC0B 5I6VA 2L6KA 4A4CA 3VRRA 1SPRA 3UF4A 1M61A 1NZVA 1A81A 3PSJA 2EYZA 1BHHA 5AULA 4A4BA 1O4FA 1TZEE 1O4GA 1O4KA 3QWYA 4D8KA 2EKXA 5AXIA 5DC4A 3WA4A 2C0TA 1RQQC 3CWGA 5HKWA 2MC1A 3GQIB 2MK2A 1BFIA 3N8MA 1A08A 3N84A 4DGPA 2L4KA 3S8OA 2OZOA 1X27A 4XZ1A 1AYAA 1AYBA 2RORA 1JU5A 3PS5A 3BUMB 2QMSA 5EEQA 3CD3A 4DGXA 1Z3KA 3S8LA 1O48A 1CJ1A 2ECDA 3LYVA 1O47A 3MXCA 5EHPA 2EO6A 2K79B 3CBLA 1JWOA 2DCRA 2ABLA 2HUWA 1R1QA 2HDXA 1PICA 1LKLA 1O4NA 2AOAA 5HKYA 1F2FA 4GL9E 4U1PA 2HMHA 2SRCA 2EOBA 2LCTA 1LCJA 5GJIA 3IMJA 3BUOB 2EL8A 1O4QA 5BO4A 4LUEA 3VROA 2LNWA 1G83A 2RVFA 3US4A 5HKZA 1A1EA 1F1WA 2EO3A 1O44A 3PLFB 3CXLA 1O49A 4M4ZA 1GHUA 5J3XA 1O45A 1OO4A 4JEGA 1LUMA 1UURA 3C7IA 4H1OA 1JYRA 1AB2A 4NWFA 5KAZA 3PSKA 1UUSA 1O4BA 1O4AA 4E68A 1QCFA 3VRYA 1O4CA 2PNAA 2EYVA 2HDVA 3BKBA 1BKMA 2LRAA 2OQ1A 2Y1NA 4OHLA 5EG3B 4U17A 4WWQA 4FL2A 1KA7A 1FU6A 1D4TA 4X6SA 1ZFPE 4JE4A 1CWEA 4E93A 3K2TA 5IBSA 1QADA 1FBZA 4FBNA
chains in the Genus database with same CATH topology
3QWXX 3BUXB 1YVHA 2MRJA 2EYYA 1A09A 1BHHB 2LQWA 3N7YA 1SPSA 1LKKA 2MQIA 4QSYA 1O4EA 3OB2B 2Y1MA 4L1BB 3BUWB 1LUIA 1LCKA 1X0NA 3MAZA 3T04A 3M7FA 4OHIA 1A07A 1R1SA 1O4IA 4EIHA 3TL0A 3VRZA 1IS0A 3NHNA 1O4MA 1BMBA 4OHDA 2AOBA 3UYOA 3S8NA 1O43A 1BLKA 1RJAA 4GWFA 2KNOA 3HHMB 1WQUA 2K7AB 1TCEA 2C0IA 1O4DA 1SHBA 2CI8A 1BKLA 3OP0A 2Y3AB 4F59A 3VRPA 4H34A 1OO3A 2CRHA 1JYQA 1O4OA 3VS7A 2FO0A 1AYDA 3VS4A 1AOTF 4FL3A 3IN8A 2CBLA 1CSZA 2DM0A 1O4HA 1O46A 2PLDA 3VS2A 4P9ZA 5DC9A 2RMXA 1KSWA 1O4RA 1FYRA 2CIAA 5IBMA 3EAZA 1H9OA 2MRKA 1Y1UA 2GE9A 2PNBA 1R1PA 2FCIA 4OHHA 1BG1A 4JGHA 1CWDL 3IN7A 3VRQA 2IZVA 1FU5A 4EY0A 1SHAA 3OV1A 1NZLA 3OVEA 2DLZA 4XZ0A 1MILA 1AD5A 1YVLA 3KFJA 1FBVA 2SHPA 2BBUA 3VS5A 2VIFA 1A1CA 2H46E 4NWGA 1BHFA 4K44A 3VGOA 1BF5A 5GJHA 1O4JA 5EELA 1O4PA 1SHDA 1Y57A 1K9AA 1O4LA 4K45A 3ZNIA 1D1ZA 2L3TA 2PLEA 2AUGA 2IUIA 4TZIA 1GRIA 1OPLA 3PJPA 4GPLB 3PFVA 1BFJA 5CDWA 3VRNA 2XP1A 2H5KA 3VS3A 1A1AA 4F5BA 3S9KA 4LUDA 1I3ZA 1SKJA 3PQZA 2DX0A 1MW4A 1CSYA 1M27A 1AOUF 3GXXA 2KK6A 2DVJA 1JYUA 2IUHA 2JYQA 2HCKA 1AYCA 4K2RA 4P9VA 1X6CA 3IMDA 2YSXA 2H8HA 2PTKA 3OB1B 1O41A 1XA6A 5DF6A 5EHRA 2CS0A 4ROJA 1KC2A 1RPYA 2EU0A 1BM2A 2B3OA 2GSBA 2C0OA 2LNXA 5D0JA 1FMKA 1A1BA 1IJRA 2CI9A 1FHSA 1BLJA 1D4WA 2DLYA 4K11A 3HIZB 1KA6A 3VS1A 2RSYA 3VS6A 2C9WA 1P13A 3GXWA 1HCSB 4OHEA 3K2MA 4F5AA 2LQNA 2IUGA 1LUNA 1NRVA 2ETZA 1OPKA 2CR4A 1QG1E 1HCTB 1O42A 3BUNB 3TKZA 3EACA 3VS0A 1LUKA 1B47A 3HCKA 3MXYA 2YU7A 5DC0B 5I6VA 2L6KA 4A4CA 3VRRA 1SPRA 3UF4A 1M61A 1NZVA 1A81A 3PSJA 2EYZA 1BHHA 5AULA 4A4BA 1O4FA 1TZEE 1O4GA 1O4KA 3QWYA 4D8KA 2EKXA 5AXIA 5DC4A 3WA4A 2C0TA 1RQQC 3CWGA 5HKWA 2MC1A 3GQIB 2MK2A 1BFIA 3N8MA 1A08A 3N84A 4DGPA 2L4KA 3S8OA 2OZOA 1X27A 4XZ1A 1AYAA 1AYBA 2RORA 1JU5A 3PS5A 3BUMB 2QMSA 5EEQA 3CD3A 4DGXA 1Z3KA 3S8LA 1O48A 1CJ1A 2ECDA 1O47A 3MXCA 5EHPA 2EO6A 2K79B 3CBLA 1JWOA 2DCRA 2ABLA 2HUWA 1R1QA 2HDXA 1PICA 1LKLA 1O4NA 2AOAA 5HKYA 1F2FA 4GL9E 4U1PA 2HMHA 2SRCA 2EOBA 2LCTA 1LCJA 5GJIA 3IMJA 3BUOB 2EL8A 1O4QA 5BO4A 4LUEA 3VROA 2LNWA 1G83A 2RVFA 3US4A 5HKZA 1A1EA 1F1WA 2EO3A 1O44A 3PLFB 3CXLA 1O49A 4M4ZA 1GHUA 5J3XA 1O45A 1OO4A 4JEGA 1LUMA 1UURA 3C7IA 4H1OA 1JYRA 1AB2A 4NWFA 5KAZA 3PSKA 1UUSA 1O4BA 1O4AA 4E68A 1QCFA 3VRYA 1O4CA 2PNAA 2EYVA 2HDVA 3BKBA 1BKMA 2OQ1A 2Y1NA 4OHLA 5EG3B 4U17A 4WWQA 4FL2A 1KA7A 1FU6A 1D4TA 4X6SA 1ZFPE 4JE4A 1CWEA 4E93A 5IBSA 1QADA 1FBZA 4FBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWX X;  3BUX B;  1YVH A;  2MRJ A;  2EYY A;  1A09 A;  1BHH B;  2LQW A;  3N7Y A;  1SPS A;  1LKK A;  2MQI A;  4QSY A;  1O4E A;  3OB2 B;  2Y1M A;  4L1B B;  3BUW B;  1LUI A;  1LCK A;  1X0N A;  3MAZ A;  3T04 A;  3M7F A;  4OHI A;  1A07 A;  1R1S A;  1O4I A;  4EIH A;  3TL0 A;  3VRZ A;  1IS0 A;  3NHN A;  1O4M A;  1BMB A;  4OHD A;  2AOB A;  3UYO A;  3S8N A;  1O43 A;  1BLK A;  1RJA A;  4GWF A;  2KNO A;  3HHM B;  1WQU A;  2K7A B;  1TCE A;  2C0I A;  1O4D A;  1SHB A;  2CI8 A;  1BKL A;  3OP0 A;  2Y3A B;  4F59 A;  3VRP A;  4H34 A;  1OO3 A;  2CRH A;  1JYQ A;  1O4O A;  3VS7 A;  2FO0 A;  1AYD A;  3VS4 A;  1AOT F;  4FL3 A;  3IN8 A;  2CBL A;  1CSZ A;  2DM0 A;  1O4H A;  1O46 A;  2PLD A;  3VS2 A;  4P9Z A;  5DC9 A;  2RMX A;  1KSW A;  1O4R A;  1FYR A;  2CIA A;  5IBM A;  3EAZ A;  1H9O A;  2MRK A;  1Y1U A;  2GE9 A;  2PNB A;  1R1P A;  2FCI A;  4OHH A;  1BG1 A;  4JGH A;  1CWD L;  3IN7 A;  3VRQ A;  2IZV A;  1FU5 A;  4EY0 A;  1SHA A;  3OV1 A;  1NZL A;  3OVE A;  2DLZ A;  4XZ0 A;  1MIL A;  1AD5 A;  1YVL A;  3KFJ A;  1FBV A;  2SHP A;  2BBU A;  3VS5 A;  2VIF A;  1A1C A;  2H46 E;  4NWG A;  1BHF A;  4K44 A;  3VGO A;  1BF5 A;  5GJH A;  1O4J A;  5EEL A;  1O4P A;  1SHD A;  1Y57 A;  1K9A A;  1O4L A;  4K45 A;  3ZNI A;  1D1Z A;  2L3T A;  2PLE A;  2AUG A;  2IUI A;  4TZI A;  1GRI A;  1OPL A;  3PJP A;  4GPL B;  3PFV A;  1BFJ A;  5CDW A;  3VRN A;  2XP1 A;  2H5K A;  3VS3 A;  1A1A A;  4F5B A;  3S9K A;  4LUD A;  1I3Z A;  1SKJ A;  3PQZ A;  2DX0 A;  1MW4 A;  1CSY A;  1M27 A;  1AOU F;  3GXX A;  2KK6 A;  2DVJ A;  1JYU A;  2IUH A;  2JYQ A;  2HCK A;  1AYC A;  4K2R A;  4P9V A;  1X6C A;  3IMD A;  2YSX A;  2H8H A;  2PTK A;  3OB1 B;  1O41 A;  1XA6 A;  5DF6 A;  5EHR A;  2CS0 A;  4ROJ A;  1KC2 A;  1RPY A;  2EU0 A;  1BM2 A;  2B3O A;  2GSB A;  2C0O A;  2LNX A;  5D0J A;  1FMK A;  1A1B A;  1IJR A;  2CI9 A;  1FHS A;  1BLJ A;  1D4W A;  2DLY A;  4K11 A;  3HIZ B;  1KA6 A;  3VS1 A;  2RSY A;  3VS6 A;  2C9W A;  1P13 A;  3GXW A;  1HCS B;  4OHE A;  3K2M A;  4F5A A;  2LQN A;  2IUG A;  1LUN A;  1NRV A;  2ETZ A;  1OPK A;  2CR4 A;  1QG1 E;  1HCT B;  1O42 A;  3BUN B;  3TKZ A;  3EAC A;  3VS0 A;  1LUK A;  1B47 A;  3HCK A;  3MXY A;  2YU7 A;  5DC0 B;  5I6V A;  2L6K A;  4A4C A;  3VRR A;  1SPR A;  3UF4 A;  1M61 A;  1NZV A;  1A81 A;  3PSJ A;  2EYZ A;  1BHH A;  5AUL A;  4A4B A;  1O4F A;  1TZE E;  1O4G A;  1O4K A;  3QWY A;  4D8K A;  2EKX A;  5AXI A;  5DC4 A;  3WA4 A;  2C0T A;  1RQQ C;  3CWG A;  5HKW A;  2MC1 A;  3GQI B;  2MK2 A;  1BFI A;  3N8M A;  1A08 A;  3N84 A;  4DGP A;  2L4K A;  3S8O A;  2OZO A;  1X27 A;  4XZ1 A;  1AYA A;  1AYB A;  2ROR A;  1JU5 A;  3PS5 A;  3BUM B;  2QMS A;  5EEQ A;  3CD3 A;  4DGX A;  1Z3K A;  3S8L A;  1O48 A;  1CJ1 A;  2ECD A;  1O47 A;  3MXC A;  5EHP A;  2EO6 A;  2K79 B;  3CBL A;  1JWO A;  2DCR A;  2ABL A;  2HUW A;  1R1Q A;  2HDX A;  1PIC A;  1LKL A;  1O4N A;  2AOA A;  5HKY A;  1F2F A;  4GL9 E;  4U1P A;  2HMH A;  2SRC A;  2EOB A;  2LCT A;  1LCJ A;  5GJI A;  3IMJ A;  3BUO B;  2EL8 A;  1O4Q A;  5BO4 A;  4LUE A;  3VRO A;  2LNW A;  1G83 A;  2RVF A;  3US4 A;  5HKZ A;  1A1E A;  1F1W A;  2EO3 A;  1O44 A;  3PLF B;  3CXL A;  1O49 A;  4M4Z A;  1GHU A;  5J3X A;  1O45 A;  1OO4 A;  4JEG A;  1LUM A;  1UUR A;  3C7I A;  4H1O A;  1JYR A;  1AB2 A;  4NWF A;  5KAZ A;  3PSK A;  1UUS A;  1O4B A;  1O4A A;  4E68 A;  1QCF A;  3VRY A;  1O4C A;  2PNA A;  2EYV A;  2HDV A;  3BKB A;  1BKM A;  2OQ1 A;  2Y1N A;  4OHL A;  5EG3 B;  4U17 A;  4WWQ A;  4FL2 A;  1KA7 A;  1FU6 A;  1D4T A;  4X6S A;  1ZFP E;  4JE4 A;  1CWE A;  4E93 A;  5IBS A;  1QAD A;  1FBZ A;  4FBN A; 
#chains in the Genus database with same CATH topology
 3QWX X;  3BUX B;  1YVH A;  2MRJ A;  2EYY A;  1A09 A;  1BHH B;  2LQW A;  3N7Y A;  1SPS A;  1LKK A;  2MQI A;  4QSY A;  1O4E A;  3OB2 B;  2Y1M A;  4L1B B;  3BUW B;  1LUI A;  1LCK A;  1X0N A;  3MAZ A;  2KGY A;  3T04 A;  3M7F A;  4OHI A;  1A07 A;  1R1S A;  1O4I A;  4EIH A;  3TL0 A;  3VRZ A;  1IS0 A;  3NHN A;  1O4M A;  1BMB A;  4OHD A;  2AOB A;  3UYO A;  3S8N A;  1O43 A;  1BLK A;  1RJA A;  4GWF A;  2KNO A;  3HHM B;  1WQU A;  2K7A B;  1TCE A;  2C0I A;  1O4D A;  1SHB A;  2CI8 A;  1BKL A;  3OP0 A;  2Y3A B;  4F59 A;  3VRP A;  4H34 A;  1OO3 A;  2CRH A;  1JYQ A;  1O4O A;  3VS7 A;  2FO0 A;  1AYD A;  3VS4 A;  1AOT F;  4FL3 A;  3IN8 A;  2CBL A;  1CSZ A;  2DM0 A;  1O4H A;  1O46 A;  2PLD A;  3VS2 A;  4P9Z A;  5DC9 A;  2RMX A;  1KSW A;  1O4R A;  1FYR A;  2CIA A;  5IBM A;  3EAZ A;  1H9O A;  2MRK A;  1Y1U A;  2GE9 A;  2PNB A;  1R1P A;  2FCI A;  4OHH A;  1BG1 A;  4JGH A;  1CWD L;  3IN7 A;  3VRQ A;  2IZV A;  1FU5 A;  4EY0 A;  1SHA A;  3OV1 A;  1NZL A;  3OVE A;  2DLZ A;  4XZ0 A;  1MIL A;  1AD5 A;  1YVL A;  3KFJ A;  1FBV A;  2SHP A;  2BBU A;  3VS5 A;  2VIF A;  1A1C A;  2H46 E;  4NWG A;  1BHF A;  4K44 A;  3VGO A;  1BF5 A;  5GJH A;  1O4J A;  5EEL A;  1O4P A;  1SHD A;  1Y57 A;  1K9A A;  1O4L A;  4K45 A;  3ZNI A;  1D1Z A;  2L3T A;  2PLE A;  2AUG A;  2IUI A;  4TZI A;  1GRI A;  1OPL A;  3PJP A;  4GPL B;  3PFV A;  1BFJ A;  5CDW A;  3VRN A;  2XP1 A;  2H5K A;  3VS3 A;  1A1A A;  4F5B A;  3S9K A;  4LUD A;  1I3Z A;  1SKJ A;  3PQZ A;  2DX0 A;  1MW4 A;  1CSY A;  1M27 A;  1AOU F;  3GXX A;  2KK6 A;  2DVJ A;  1JYU A;  2IUH A;  2JYQ A;  2HCK A;  1AYC A;  4K2R A;  4P9V A;  1X6C A;  3IMD A;  2YSX A;  2H8H A;  2PTK A;  3OB1 B;  1O41 A;  1XA6 A;  5DF6 A;  5EHR A;  2CS0 A;  4ROJ A;  1KC2 A;  1RPY A;  2EU0 A;  1BM2 A;  2B3O A;  2GSB A;  2C0O A;  2LNX A;  5D0J A;  1FMK A;  1A1B A;  1IJR A;  2CI9 A;  1FHS A;  1BLJ A;  1D4W A;  2DLY A;  4K11 A;  3HIZ B;  1KA6 A;  3VS1 A;  2RSY A;  3VS6 A;  2C9W A;  1P13 A;  3GXW A;  1HCS B;  4OHE A;  3K2M A;  4F5A A;  2LQN A;  2IUG A;  1LUN A;  1NRV A;  2ETZ A;  1OPK A;  2CR4 A;  1QG1 E;  1HCT B;  1O42 A;  3BUN B;  3TKZ A;  3EAC A;  3VS0 A;  1LUK A;  1B47 A;  3HCK A;  3MXY A;  2YU7 A;  5DC0 B;  5I6V A;  2L6K A;  4A4C A;  3VRR A;  1SPR A;  3UF4 A;  1M61 A;  1NZV A;  1A81 A;  3PSJ A;  2EYZ A;  1BHH A;  5AUL A;  4A4B A;  1O4F A;  1TZE E;  1O4G A;  1O4K A;  3QWY A;  4D8K A;  2EKX A;  5AXI A;  5DC4 A;  3WA4 A;  2C0T A;  1RQQ C;  3CWG A;  5HKW A;  2MC1 A;  3GQI B;  2MK2 A;  1BFI A;  3N8M A;  1A08 A;  3N84 A;  4DGP A;  2L4K A;  3S8O A;  2OZO A;  1X27 A;  4XZ1 A;  1AYA A;  1AYB A;  2ROR A;  1JU5 A;  3PS5 A;  3BUM B;  2QMS A;  5EEQ A;  3CD3 A;  4DGX A;  1Z3K A;  3S8L A;  1O48 A;  1CJ1 A;  2ECD A;  3LYV A;  1O47 A;  3MXC A;  5EHP A;  2EO6 A;  2K79 B;  3CBL A;  1JWO A;  2DCR A;  2ABL A;  2HUW A;  1R1Q A;  2HDX A;  1PIC A;  1LKL A;  1O4N A;  2AOA A;  5HKY A;  1F2F A;  4GL9 E;  4U1P A;  2HMH A;  2SRC A;  2EOB A;  2LCT A;  1LCJ A;  5GJI A;  3IMJ A;  3BUO B;  2EL8 A;  1O4Q A;  5BO4 A;  4LUE A;  3VRO A;  2LNW A;  1G83 A;  2RVF A;  3US4 A;  5HKZ A;  1A1E A;  1F1W A;  2EO3 A;  1O44 A;  3PLF B;  3CXL A;  1O49 A;  4M4Z A;  1GHU A;  5J3X A;  1O45 A;  1OO4 A;  4JEG A;  1LUM A;  1UUR A;  3C7I A;  4H1O A;  1JYR A;  1AB2 A;  4NWF A;  5KAZ A;  3PSK A;  1UUS A;  1O4B A;  1O4A A;  4E68 A;  1QCF A;  3VRY A;  1O4C A;  2PNA A;  2EYV A;  2HDV A;  3BKB A;  1BKM A;  2LRA A;  2OQ1 A;  2Y1N A;  4OHL A;  5EG3 B;  4U17 A;  4WWQ A;  4FL2 A;  1KA7 A;  1FU6 A;  1D4T A;  4X6S A;  1ZFP E;  4JE4 A;  1CWE A;  4E93 A;  3K2T A;  5IBS A;  1QAD A;  1FBZ A;  4FBN A; 
#chains in the Genus database with same CATH homology
 3QWX X;  3BUX B;  1YVH A;  2MRJ A;  2EYY A;  1A09 A;  1BHH B;  2LQW A;  3N7Y A;  1SPS A;  1LKK A;  2MQI A;  4QSY A;  1O4E A;  3OB2 B;  2Y1M A;  4L1B B;  3BUW B;  1LUI A;  1LCK A;  1X0N A;  3MAZ A;  3T04 A;  3M7F A;  4OHI A;  1A07 A;  1R1S A;  1O4I A;  4EIH A;  3TL0 A;  3VRZ A;  1IS0 A;  3NHN A;  1O4M A;  1BMB A;  4OHD A;  2AOB A;  3UYO A;  3S8N A;  1O43 A;  1BLK A;  1RJA A;  4GWF A;  2KNO A;  3HHM B;  1WQU A;  2K7A B;  1TCE A;  2C0I A;  1O4D A;  1SHB A;  2CI8 A;  1BKL A;  3OP0 A;  2Y3A B;  4F59 A;  3VRP A;  4H34 A;  1OO3 A;  2CRH A;  1JYQ A;  1O4O A;  3VS7 A;  2FO0 A;  1AYD A;  3VS4 A;  1AOT F;  4FL3 A;  3IN8 A;  2CBL A;  1CSZ A;  2DM0 A;  1O4H A;  1O46 A;  2PLD A;  3VS2 A;  4P9Z A;  5DC9 A;  2RMX A;  1KSW A;  1O4R A;  1FYR A;  2CIA A;  5IBM A;  3EAZ A;  1H9O A;  2MRK A;  1Y1U A;  2GE9 A;  2PNB A;  1R1P A;  2FCI A;  4OHH A;  1BG1 A;  4JGH A;  1CWD L;  3IN7 A;  3VRQ A;  2IZV A;  1FU5 A;  4EY0 A;  1SHA A;  3OV1 A;  1NZL A;  3OVE A;  2DLZ A;  4XZ0 A;  1MIL A;  1AD5 A;  1YVL A;  3KFJ A;  1FBV A;  2SHP A;  2BBU A;  3VS5 A;  2VIF A;  1A1C A;  2H46 E;  4NWG A;  1BHF A;  4K44 A;  3VGO A;  1BF5 A;  5GJH A;  1O4J A;  5EEL A;  1O4P A;  1SHD A;  1Y57 A;  1K9A A;  1O4L A;  4K45 A;  3ZNI A;  1D1Z A;  2L3T A;  2PLE A;  2AUG A;  2IUI A;  4TZI A;  1GRI A;  1OPL A;  3PJP A;  4GPL B;  3PFV A;  1BFJ A;  5CDW A;  3VRN A;  2XP1 A;  2H5K A;  3VS3 A;  1A1A A;  4F5B A;  3S9K A;  4LUD A;  1I3Z A;  1SKJ A;  3PQZ A;  2DX0 A;  1MW4 A;  1CSY A;  1M27 A;  1AOU F;  3GXX A;  2KK6 A;  2DVJ A;  1JYU A;  2IUH A;  2JYQ A;  2HCK A;  1AYC A;  4K2R A;  4P9V A;  1X6C A;  3IMD A;  2YSX A;  2H8H A;  2PTK A;  3OB1 B;  1O41 A;  1XA6 A;  5DF6 A;  5EHR A;  2CS0 A;  4ROJ A;  1KC2 A;  1RPY A;  2EU0 A;  1BM2 A;  2B3O A;  2GSB A;  2C0O A;  2LNX A;  5D0J A;  1FMK A;  1A1B A;  1IJR A;  2CI9 A;  1FHS A;  1BLJ A;  1D4W A;  2DLY A;  4K11 A;  3HIZ B;  1KA6 A;  3VS1 A;  2RSY A;  3VS6 A;  2C9W A;  1P13 A;  3GXW A;  1HCS B;  4OHE A;  3K2M A;  4F5A A;  2LQN A;  2IUG A;  1LUN A;  1NRV A;  2ETZ A;  1OPK A;  2CR4 A;  1QG1 E;  1HCT B;  1O42 A;  3BUN B;  3TKZ A;  3EAC A;  3VS0 A;  1LUK A;  1B47 A;  3HCK A;  3MXY A;  2YU7 A;  5DC0 B;  5I6V A;  2L6K A;  4A4C A;  3VRR A;  1SPR A;  3UF4 A;  1M61 A;  1NZV A;  1A81 A;  3PSJ A;  2EYZ A;  1BHH A;  5AUL A;  4A4B A;  1O4F A;  1TZE E;  1O4G A;  1O4K A;  3QWY A;  4D8K A;  2EKX A;  5AXI A;  5DC4 A;  3WA4 A;  2C0T A;  1RQQ C;  3CWG A;  5HKW A;  2MC1 A;  3GQI B;  2MK2 A;  1BFI A;  3N8M A;  1A08 A;  3N84 A;  4DGP A;  2L4K A;  3S8O A;  2OZO A;  1X27 A;  4XZ1 A;  1AYA A;  1AYB A;  2ROR A;  1JU5 A;  3PS5 A;  3BUM B;  2QMS A;  5EEQ A;  3CD3 A;  4DGX A;  1Z3K A;  3S8L A;  1O48 A;  1CJ1 A;  2ECD A;  1O47 A;  3MXC A;  5EHP A;  2EO6 A;  2K79 B;  3CBL A;  1JWO A;  2DCR A;  2ABL A;  2HUW A;  1R1Q A;  2HDX A;  1PIC A;  1LKL A;  1O4N A;  2AOA A;  5HKY A;  1F2F A;  4GL9 E;  4U1P A;  2HMH A;  2SRC A;  2EOB A;  2LCT A;  1LCJ A;  5GJI A;  3IMJ A;  3BUO B;  2EL8 A;  1O4Q A;  5BO4 A;  4LUE A;  3VRO A;  2LNW A;  1G83 A;  2RVF A;  3US4 A;  5HKZ A;  1A1E A;  1F1W A;  2EO3 A;  1O44 A;  3PLF B;  3CXL A;  1O49 A;  4M4Z A;  1GHU A;  5J3X A;  1O45 A;  1OO4 A;  4JEG A;  1LUM A;  1UUR A;  3C7I A;  4H1O A;  1JYR A;  1AB2 A;  4NWF A;  5KAZ A;  3PSK A;  1UUS A;  1O4B A;  1O4A A;  4E68 A;  1QCF A;  3VRY A;  1O4C A;  2PNA A;  2EYV A;  2HDV A;  3BKB A;  1BKM A;  2OQ1 A;  2Y1N A;  4OHL A;  5EG3 B;  4U17 A;  4WWQ A;  4FL2 A;  1KA7 A;  1FU6 A;  1D4T A;  4X6S A;  1ZFP E;  4JE4 A;  1CWE A;  4E93 A;  5IBS A;  1QAD A;  1FBZ A;  4FBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...