2FCIA

Structural basis for the requirement of two phosphotyrosines in signaling mediated by syk tyrosine kinase
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
105
structure length
105
Chain Sequence
b'GSPGIHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEENSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Doubly phosphorylated peptide derived from Syk kinase compri
publication title Structural basis for the requirement of two phosphotyrosine residues in signaling mediated by syk tyrosine kinase
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 17
structure length 105
sequence length 105
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2005-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2fciA00
1O4NA 3ZNIA 5EG3B 5DC9A 1KA7A 4LUEA 4GPLB 3QWXX 1M61A 1CSYA 3OB1B 2GSBA 1BMBA 3PJPA 4H1OA 3TKZA 1LUNA 2IUGA 1BFJA 1MW4A 1D1ZA 2L6KA 1X6CA 5AULA 1O4RA 1AB2A 2IUHA 5AXIA 5EHRA 3VS2A 3VRPA 3WA4A 5HKYA 2DLZA 2EU0A 2AUGA 2CI9A 2MRKA 1OO4A 2DM0A 3CBLA 5HKZA 2C9WA 1QCFA 4OHDA 4FL2A 1CWDL 1O4QA 3VS7A 2IZVA 3OB2B 4U1PA 3TL0A 1BKLA 2DLYA 1KSWA 1TCEA 1O48A 1JWOA 1M27A 3UF4A 4ROJA 2EOBA 3VRRA 4QSYA 2GE9A 1BHHA 1KC2A 3IN8A 3BUMB 1O4CA 3N8MA 1NZVA 2MK2A 3VGOA 1JU5A 4JEGA 5J3XA 1UUSA 4P9ZA 1O4PA 3BUNB 1A08A 1LKLA 1FU5A 1QG1E 5EHPA 1O4DA 1HCTB 4L1BB 2DX0A 3BUOB 1AYAA 1SKJA 1HCSB 1NRVA 5BO4A 1IJRA 2CBLA 2DVJA 2Y1MA 3US4A 2HCKA 4E68A 1A09A 1X0NA 1XA6A 1BM2A 4U17A 2LCTA 1O49A 1BKMA 5CDWA 5EELA 3CD3A 3MXYA 3VRYA 1O45A 4K44A 1LUMA 3VS4A 1O4OA 1O4KA 2Y1NA 2B3OA 1A1AA 2QMSA 2BBUA 1LUIA 4A4CA 1A1BA 2EO6A 2MQIA 3NHNA 2CR4A 1G83A 1FHSA 2OQ1A 2RORA 4EIHA 1O44A 4FL3A 1BHHB 1MILA 2RMXA 1AOUF 2L3TA 3S8NA 2KNOA 3PSJA 1BG1A 5KAZA 2RVFA 2RSYA 2KK6A 1A81A 1IS0A 1O4LA 2C0OA 1CWEA 3VROA 1O43A 4FBNA 1BF5A 2HDXA 4OHEA 3HIZB 1BLJA 2PTKA 2EYYA 4OHHA 1O4HA 1O42A 2H46E 5HKWA 4A4BA 2C0TA 1LUKA 3GXWA 3S8LA 1F2FA 2FCIA 1RJAA 1RPYA 2L4KA 2AOBA 2H5KA 2LNXA 1YVHA 5I6VA 1BFIA 2AOAA 1OPKA 1NZLA 1Z3KA 3M7FA 3VS5A 1JYRA 1X27A 2ECDA 3BUWB 1F1WA 4WWQA 5GJHA 1TZEE 3VRZA 1QADA 1KA6A 4OHIA 1YVLA 2K7AB 3T04A 2LQWA 1O4EA 4XZ0A 3QWYA 1O4GA 3IMDA 2CRHA 2CIAA 4H34A 1K9AA 1O4JA 1UURA 1Y1UA 5DF6A 2PNAA 1FBVA 5IBSA 4DGXA 3S9KA 3MAZA 2JYQA 3IN7A 4E93A 1AD5A 2HDVA 5IBMA 1WQUA 3BKBA 4NWGA 1LCJA 2EL8A 4P9VA 1FMKA 2HMHA 2SRCA 4NWFA 4K11A 1PICA 1R1SA 3CXLA 3BUXB 1SHBA 1SPRA 1GHUA 1R1PA 2ETZA 3C7IA 3VRQA 1ZFPE 4DGPA 2FO0A 3PQZA 4XZ1A 1JYQA 4M4ZA 1FYRA 3PFVA 1B47A 3PS5A 2SHPA 4K45A 1OPLA 1O47A 2EYZA 3N7YA 3GXXA 3VS3A 2PLEA 3MXCA 1O4IA 1I3ZA 1FBZA 4D8KA 2K79B 3OVEA 1R1QA 1A07A 1A1EA 1O41A 4GWFA 1SPSA 2CI8A 2H8HA 1H9OA 4X6SA 3S8OA 3HCKA 1LKKA 1SHDA 3N84A 1BLKA 4GL9E 2HUWA 2YU7A 2CS0A 3GQIB 1O4BA 2LNWA 3IMJA 1JYUA 3K2MA 3OP0A 2MC1A 2LQNA 4TZIA 2OZOA 1FU6A 3OV1A 3EAZA 2IUIA 4OHLA 3PLFB 1AOTF 2C0IA 2VIFA 3PSKA 4K2RA 5DC0B 1GRIA 5EEQA 1AYDA 3HHMB 1RQQC 2EYVA 1D4TA 1OO3A 1SHAA 3VS6A 1O4AA 1LCKA 1P13A 3EACA 2PLDA 5DC4A 1O46A 2PNBA 4F59A 4JGHA 2Y3AB 3UYOA 3KFJA 2ABLA 1CJ1A 1AYCA 2DCRA 2EKXA 2XP1A 3VS1A 1CSZA 4F5AA 4EY0A 3CWGA 2YSXA 5GJIA 1A1CA 2MRJA 4JE4A 1AYBA 4LUDA 1D4WA 3VS0A 2EO3A 1O4FA 1BHFA 5D0JA 1O4MA 3VRNA 4F5BA 1Y57A
chains in the Genus database with same CATH superfamily
1O4NA 3ZNIA 5EG3B 5DC9A 1KA7A 4LUEA 4GPLB 3QWXX 1M61A 1CSYA 3OB1B 2GSBA 1BMBA 3PJPA 4H1OA 3TKZA 1LUNA 2IUGA 1BFJA 1MW4A 1D1ZA 2L6KA 1X6CA 5AULA 1O4RA 1AB2A 2IUHA 5AXIA 5EHRA 3VS2A 3VRPA 3WA4A 5HKYA 2DLZA 2EU0A 2AUGA 2CI9A 2MRKA 1OO4A 2DM0A 3CBLA 5HKZA 2C9WA 1QCFA 4OHDA 4FL2A 1CWDL 1O4QA 3VS7A 2IZVA 3OB2B 4U1PA 3TL0A 1BKLA 2DLYA 1KSWA 1TCEA 1O48A 1JWOA 1M27A 3UF4A 4ROJA 2EOBA 3VRRA 4QSYA 2GE9A 1BHHA 1KC2A 3IN8A 3BUMB 1O4CA 3N8MA 1NZVA 2MK2A 3VGOA 1JU5A 4JEGA 5J3XA 1UUSA 4P9ZA 1O4PA 3BUNB 1A08A 2KGYA 1LKLA 1FU5A 1QG1E 5EHPA 1O4DA 1HCTB 4L1BB 2DX0A 3BUOB 1AYAA 1SKJA 1HCSB 1NRVA 5BO4A 1IJRA 2CBLA 2DVJA 2Y1MA 3US4A 2HCKA 4E68A 1A09A 1X0NA 1XA6A 1BM2A 4U17A 2LCTA 1O49A 1BKMA 5CDWA 5EELA 3CD3A 3MXYA 3VRYA 1O45A 4K44A 1LUMA 3VS4A 1O4OA 1O4KA 2Y1NA 2B3OA 1A1AA 2QMSA 2BBUA 1LUIA 4A4CA 1A1BA 2EO6A 3LYVA 2MQIA 3NHNA 2CR4A 1G83A 1FHSA 2OQ1A 2RORA 4EIHA 1O44A 4FL3A 1BHHB 1MILA 2RMXA 1AOUF 2L3TA 3S8NA 2KNOA 3PSJA 1BG1A 5KAZA 2RVFA 2RSYA 2KK6A 1A81A 1IS0A 1O4LA 2C0OA 1CWEA 3VROA 1O43A 4FBNA 1BF5A 2HDXA 4OHEA 3HIZB 1BLJA 2PTKA 2EYYA 4OHHA 1O4HA 1O42A 2H46E 5HKWA 4A4BA 3K2TA 2C0TA 3GXWA 1LUKA 3S8LA 1F2FA 2FCIA 1RJAA 1RPYA 2L4KA 2AOBA 2H5KA 2LNXA 1YVHA 5I6VA 1BFIA 2AOAA 1OPKA 1NZLA 1Z3KA 3M7FA 3VS5A 1JYRA 1X27A 2ECDA 3BUWB 1F1WA 4WWQA 5GJHA 1TZEE 3VRZA 1QADA 1KA6A 4OHIA 1YVLA 2K7AB 3T04A 2LQWA 1O4EA 4XZ0A 3QWYA 1O4GA 3IMDA 2CRHA 2CIAA 4H34A 1K9AA 1O4JA 1UURA 1Y1UA 5DF6A 2PNAA 1FBVA 5IBSA 4DGXA 3S9KA 3MAZA 2JYQA 3IN7A 4E93A 1AD5A 2HDVA 5IBMA 1WQUA 3BKBA 4NWGA 1LCJA 2EL8A 4P9VA 1FMKA 2HMHA 2SRCA 4NWFA 4K11A 1PICA 1R1SA 3CXLA 3BUXB 1SHBA 1SPRA 1GHUA 1R1PA 2ETZA 3C7IA 3VRQA 1ZFPE 4DGPA 2FO0A 3PQZA 4XZ1A 1JYQA 4M4ZA 1FYRA 3PFVA 1B47A 3PS5A 2SHPA 4K45A 1OPLA 1O47A 2EYZA 3N7YA 3GXXA 3VS3A 2PLEA 3MXCA 1O4IA 1I3ZA 1FBZA 4D8KA 2K79B 3OVEA 1R1QA 1A07A 1A1EA 1O41A 4GWFA 1SPSA 2CI8A 2H8HA 1H9OA 4X6SA 3S8OA 3HCKA 1LKKA 1SHDA 3N84A 1BLKA 4GL9E 2HUWA 2YU7A 2CS0A 3GQIB 1O4BA 2LNWA 3IMJA 1JYUA 3K2MA 3OP0A 2MC1A 2LQNA 4TZIA 2OZOA 1FU6A 3OV1A 3EAZA 2IUIA 4OHLA 3PLFB 1AOTF 2C0IA 2VIFA 3PSKA 4K2RA 5DC0B 1GRIA 5EEQA 1AYDA 3HHMB 1RQQC 2EYVA 1D4TA 1OO3A 1SHAA 3VS6A 1O4AA 1LCKA 1P13A 3EACA 2PLDA 5DC4A 1O46A 2PNBA 4F59A 4JGHA 2Y3AB 3UYOA 3KFJA 2ABLA 1CJ1A 1AYCA 2DCRA 2EKXA 2XP1A 3VS1A 1CSZA 4F5AA 4EY0A 3CWGA 2YSXA 5GJIA 1A1CA 2MRJA 4JE4A 1AYBA 4LUDA 1D4WA 3VS0A 2EO3A 1O4FA 1BHFA 5D0JA 1O4MA 3VRNA 2LRAA 4F5BA 1Y57A
chains in the Genus database with same CATH topology
1O4NA 3ZNIA 5EG3B 5DC9A 1KA7A 4LUEA 4GPLB 3QWXX 1M61A 1CSYA 3OB1B 2GSBA 1BMBA 3PJPA 4H1OA 3TKZA 1LUNA 2IUGA 1BFJA 1MW4A 1D1ZA 2L6KA 1X6CA 5AULA 1O4RA 1AB2A 2IUHA 5AXIA 5EHRA 3VS2A 3VRPA 3WA4A 5HKYA 2DLZA 2EU0A 2AUGA 2CI9A 2MRKA 1OO4A 2DM0A 3CBLA 5HKZA 2C9WA 1QCFA 4OHDA 4FL2A 1CWDL 1O4QA 3VS7A 2IZVA 3OB2B 4U1PA 3TL0A 1BKLA 2DLYA 1KSWA 1TCEA 1O48A 1JWOA 1M27A 3UF4A 4ROJA 2EOBA 3VRRA 4QSYA 2GE9A 1BHHA 1KC2A 3IN8A 3BUMB 1O4CA 3N8MA 1NZVA 2MK2A 3VGOA 1JU5A 4JEGA 5J3XA 1UUSA 4P9ZA 1O4PA 3BUNB 1A08A 1LKLA 1FU5A 1QG1E 5EHPA 1O4DA 1HCTB 4L1BB 2DX0A 3BUOB 1AYAA 1SKJA 1HCSB 1NRVA 5BO4A 1IJRA 2CBLA 2DVJA 2Y1MA 3US4A 2HCKA 4E68A 1A09A 1X0NA 1XA6A 1BM2A 4U17A 2LCTA 1O49A 1BKMA 5CDWA 5EELA 3CD3A 3MXYA 3VRYA 1O45A 4K44A 1LUMA 3VS4A 1O4OA 1O4KA 2Y1NA 2B3OA 1A1AA 2QMSA 2BBUA 1LUIA 4A4CA 1A1BA 2EO6A 2MQIA 3NHNA 2CR4A 1G83A 1FHSA 2OQ1A 2RORA 4EIHA 1O44A 4FL3A 1BHHB 1MILA 2RMXA 1AOUF 2L3TA 3S8NA 2KNOA 3PSJA 1BG1A 5KAZA 2RVFA 2RSYA 2KK6A 1A81A 1IS0A 1O4LA 2C0OA 1CWEA 3VROA 1O43A 4FBNA 1BF5A 2HDXA 4OHEA 3HIZB 1BLJA 2PTKA 2EYYA 4OHHA 1O4HA 1O42A 2H46E 5HKWA 4A4BA 2C0TA 1LUKA 3GXWA 3S8LA 1F2FA 2FCIA 1RJAA 1RPYA 2L4KA 2AOBA 2H5KA 2LNXA 1YVHA 5I6VA 1BFIA 2AOAA 1OPKA 1NZLA 1Z3KA 3M7FA 3VS5A 1JYRA 1X27A 2ECDA 3BUWB 1F1WA 4WWQA 5GJHA 1TZEE 3VRZA 1QADA 1KA6A 4OHIA 1YVLA 2K7AB 3T04A 2LQWA 1O4EA 4XZ0A 3QWYA 1O4GA 3IMDA 2CRHA 2CIAA 4H34A 1K9AA 1O4JA 1UURA 1Y1UA 5DF6A 2PNAA 1FBVA 5IBSA 4DGXA 3S9KA 3MAZA 2JYQA 3IN7A 4E93A 1AD5A 2HDVA 5IBMA 1WQUA 3BKBA 4NWGA 1LCJA 2EL8A 4P9VA 1FMKA 2HMHA 2SRCA 4NWFA 4K11A 1PICA 1R1SA 3CXLA 3BUXB 1SHBA 1SPRA 1GHUA 1R1PA 2ETZA 3C7IA 3VRQA 1ZFPE 4DGPA 2FO0A 3PQZA 4XZ1A 1JYQA 4M4ZA 1FYRA 3PFVA 1B47A 3PS5A 2SHPA 4K45A 1OPLA 1O47A 2EYZA 3N7YA 3GXXA 3VS3A 2PLEA 3MXCA 1O4IA 1I3ZA 1FBZA 4D8KA 2K79B 3OVEA 1R1QA 1A07A 1A1EA 1O41A 4GWFA 1SPSA 2CI8A 2H8HA 1H9OA 4X6SA 3S8OA 3HCKA 1LKKA 1SHDA 3N84A 1BLKA 4GL9E 2HUWA 2YU7A 2CS0A 3GQIB 1O4BA 2LNWA 3IMJA 1JYUA 3K2MA 3OP0A 2MC1A 2LQNA 4TZIA 2OZOA 1FU6A 3OV1A 3EAZA 2IUIA 4OHLA 3PLFB 1AOTF 2C0IA 2VIFA 3PSKA 4K2RA 5DC0B 1GRIA 5EEQA 1AYDA 3HHMB 1RQQC 2EYVA 1D4TA 1OO3A 1SHAA 3VS6A 1O4AA 1LCKA 1P13A 3EACA 2PLDA 5DC4A 1O46A 2PNBA 4F59A 4JGHA 2Y3AB 3UYOA 3KFJA 2ABLA 1CJ1A 1AYCA 2DCRA 2EKXA 2XP1A 3VS1A 1CSZA 4F5AA 4EY0A 3CWGA 2YSXA 5GJIA 1A1CA 2MRJA 4JE4A 1AYBA 4LUDA 1D4WA 3VS0A 2EO3A 1O4FA 1BHFA 5D0JA 1O4MA 3VRNA 4F5BA 1Y57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O4N A;  3ZNI A;  5EG3 B;  5DC9 A;  1KA7 A;  4LUE A;  4GPL B;  3QWX X;  1M61 A;  1CSY A;  3OB1 B;  2GSB A;  1BMB A;  3PJP A;  4H1O A;  3TKZ A;  1LUN A;  2IUG A;  1BFJ A;  1MW4 A;  1D1Z A;  2L6K A;  1X6C A;  5AUL A;  1O4R A;  1AB2 A;  2IUH A;  5AXI A;  5EHR A;  3VS2 A;  3VRP A;  3WA4 A;  5HKY A;  2DLZ A;  2EU0 A;  2AUG A;  2CI9 A;  2MRK A;  1OO4 A;  2DM0 A;  3CBL A;  5HKZ A;  2C9W A;  1QCF A;  4OHD A;  4FL2 A;  1CWD L;  1O4Q A;  3VS7 A;  2IZV A;  3OB2 B;  4U1P A;  3TL0 A;  1BKL A;  2DLY A;  1KSW A;  1TCE A;  1O48 A;  1JWO A;  1M27 A;  3UF4 A;  4ROJ A;  2EOB A;  3VRR A;  4QSY A;  2GE9 A;  1BHH A;  1KC2 A;  3IN8 A;  3BUM B;  1O4C A;  3N8M A;  1NZV A;  2MK2 A;  3VGO A;  1JU5 A;  4JEG A;  5J3X A;  1UUS A;  4P9Z A;  1O4P A;  3BUN B;  1A08 A;  1LKL A;  1FU5 A;  1QG1 E;  5EHP A;  1O4D A;  1HCT B;  4L1B B;  2DX0 A;  3BUO B;  1AYA A;  1SKJ A;  1HCS B;  1NRV A;  5BO4 A;  1IJR A;  2CBL A;  2DVJ A;  2Y1M A;  3US4 A;  2HCK A;  4E68 A;  1A09 A;  1X0N A;  1XA6 A;  1BM2 A;  4U17 A;  2LCT A;  1O49 A;  1BKM A;  5CDW A;  5EEL A;  3CD3 A;  3MXY A;  3VRY A;  1O45 A;  4K44 A;  1LUM A;  3VS4 A;  1O4O A;  1O4K A;  2Y1N A;  2B3O A;  1A1A A;  2QMS A;  2BBU A;  1LUI A;  4A4C A;  1A1B A;  2EO6 A;  2MQI A;  3NHN A;  2CR4 A;  1G83 A;  1FHS A;  2OQ1 A;  2ROR A;  4EIH A;  1O44 A;  4FL3 A;  1BHH B;  1MIL A;  2RMX A;  1AOU F;  2L3T A;  3S8N A;  2KNO A;  3PSJ A;  1BG1 A;  5KAZ A;  2RVF A;  2RSY A;  2KK6 A;  1A81 A;  1IS0 A;  1O4L A;  2C0O A;  1CWE A;  3VRO A;  1O43 A;  4FBN A;  1BF5 A;  2HDX A;  4OHE A;  3HIZ B;  1BLJ A;  2PTK A;  2EYY A;  4OHH A;  1O4H A;  1O42 A;  2H46 E;  5HKW A;  4A4B A;  2C0T A;  1LUK A;  3GXW A;  3S8L A;  1F2F A;  2FCI A;  1RJA A;  1RPY A;  2L4K A;  2AOB A;  2H5K A;  2LNX A;  1YVH A;  5I6V A;  1BFI A;  2AOA A;  1OPK A;  1NZL A;  1Z3K A;  3M7F A;  3VS5 A;  1JYR A;  1X27 A;  2ECD A;  3BUW B;  1F1W A;  4WWQ A;  5GJH A;  1TZE E;  3VRZ A;  1QAD A;  1KA6 A;  4OHI A;  1YVL A;  2K7A B;  3T04 A;  2LQW A;  1O4E A;  4XZ0 A;  3QWY A;  1O4G A;  3IMD A;  2CRH A;  2CIA A;  4H34 A;  1K9A A;  1O4J A;  1UUR A;  1Y1U A;  5DF6 A;  2PNA A;  1FBV A;  5IBS A;  4DGX A;  3S9K A;  3MAZ A;  2JYQ A;  3IN7 A;  4E93 A;  1AD5 A;  2HDV A;  5IBM A;  1WQU A;  3BKB A;  4NWG A;  1LCJ A;  2EL8 A;  4P9V A;  1FMK A;  2HMH A;  2SRC A;  4NWF A;  4K11 A;  1PIC A;  1R1S A;  3CXL A;  3BUX B;  1SHB A;  1SPR A;  1GHU A;  1R1P A;  2ETZ A;  3C7I A;  3VRQ A;  1ZFP E;  4DGP A;  2FO0 A;  3PQZ A;  4XZ1 A;  1JYQ A;  4M4Z A;  1FYR A;  3PFV A;  1B47 A;  3PS5 A;  2SHP A;  4K45 A;  1OPL A;  1O47 A;  2EYZ A;  3N7Y A;  3GXX A;  3VS3 A;  2PLE A;  3MXC A;  1O4I A;  1I3Z A;  1FBZ A;  4D8K A;  2K79 B;  3OVE A;  1R1Q A;  1A07 A;  1A1E A;  1O41 A;  4GWF A;  1SPS A;  2CI8 A;  2H8H A;  1H9O A;  4X6S A;  3S8O A;  3HCK A;  1LKK A;  1SHD A;  3N84 A;  1BLK A;  4GL9 E;  2HUW A;  2YU7 A;  2CS0 A;  3GQI B;  1O4B A;  2LNW A;  3IMJ A;  1JYU A;  3K2M A;  3OP0 A;  2MC1 A;  2LQN A;  4TZI A;  2OZO A;  1FU6 A;  3OV1 A;  3EAZ A;  2IUI A;  4OHL A;  3PLF B;  1AOT F;  2C0I A;  2VIF A;  3PSK A;  4K2R A;  5DC0 B;  1GRI A;  5EEQ A;  1AYD A;  3HHM B;  1RQQ C;  2EYV A;  1D4T A;  1OO3 A;  1SHA A;  3VS6 A;  1O4A A;  1LCK A;  1P13 A;  3EAC A;  2PLD A;  5DC4 A;  1O46 A;  2PNB A;  4F59 A;  4JGH A;  2Y3A B;  3UYO A;  3KFJ A;  2ABL A;  1CJ1 A;  1AYC A;  2DCR A;  2EKX A;  2XP1 A;  3VS1 A;  1CSZ A;  4F5A A;  4EY0 A;  3CWG A;  2YSX A;  5GJI A;  1A1C A;  2MRJ A;  4JE4 A;  1AYB A;  4LUD A;  1D4W A;  3VS0 A;  2EO3 A;  1O4F A;  1BHF A;  5D0J A;  1O4M A;  3VRN A;  4F5B A;  1Y57 A; 
#chains in the Genus database with same CATH topology
 1O4N A;  3ZNI A;  5EG3 B;  5DC9 A;  1KA7 A;  4LUE A;  4GPL B;  3QWX X;  1M61 A;  1CSY A;  3OB1 B;  2GSB A;  1BMB A;  3PJP A;  4H1O A;  3TKZ A;  1LUN A;  2IUG A;  1BFJ A;  1MW4 A;  1D1Z A;  2L6K A;  1X6C A;  5AUL A;  1O4R A;  1AB2 A;  2IUH A;  5AXI A;  5EHR A;  3VS2 A;  3VRP A;  3WA4 A;  5HKY A;  2DLZ A;  2EU0 A;  2AUG A;  2CI9 A;  2MRK A;  1OO4 A;  2DM0 A;  3CBL A;  5HKZ A;  2C9W A;  1QCF A;  4OHD A;  4FL2 A;  1CWD L;  1O4Q A;  3VS7 A;  2IZV A;  3OB2 B;  4U1P A;  3TL0 A;  1BKL A;  2DLY A;  1KSW A;  1TCE A;  1O48 A;  1JWO A;  1M27 A;  3UF4 A;  4ROJ A;  2EOB A;  3VRR A;  4QSY A;  2GE9 A;  1BHH A;  1KC2 A;  3IN8 A;  3BUM B;  1O4C A;  3N8M A;  1NZV A;  2MK2 A;  3VGO A;  1JU5 A;  4JEG A;  5J3X A;  1UUS A;  4P9Z A;  1O4P A;  3BUN B;  1A08 A;  2KGY A;  1LKL A;  1FU5 A;  1QG1 E;  5EHP A;  1O4D A;  1HCT B;  4L1B B;  2DX0 A;  3BUO B;  1AYA A;  1SKJ A;  1HCS B;  1NRV A;  5BO4 A;  1IJR A;  2CBL A;  2DVJ A;  2Y1M A;  3US4 A;  2HCK A;  4E68 A;  1A09 A;  1X0N A;  1XA6 A;  1BM2 A;  4U17 A;  2LCT A;  1O49 A;  1BKM A;  5CDW A;  5EEL A;  3CD3 A;  3MXY A;  3VRY A;  1O45 A;  4K44 A;  1LUM A;  3VS4 A;  1O4O A;  1O4K A;  2Y1N A;  2B3O A;  1A1A A;  2QMS A;  2BBU A;  1LUI A;  4A4C A;  1A1B A;  2EO6 A;  3LYV A;  2MQI A;  3NHN A;  2CR4 A;  1G83 A;  1FHS A;  2OQ1 A;  2ROR A;  4EIH A;  1O44 A;  4FL3 A;  1BHH B;  1MIL A;  2RMX A;  1AOU F;  2L3T A;  3S8N A;  2KNO A;  3PSJ A;  1BG1 A;  5KAZ A;  2RVF A;  2RSY A;  2KK6 A;  1A81 A;  1IS0 A;  1O4L A;  2C0O A;  1CWE A;  3VRO A;  1O43 A;  4FBN A;  1BF5 A;  2HDX A;  4OHE A;  3HIZ B;  1BLJ A;  2PTK A;  2EYY A;  4OHH A;  1O4H A;  1O42 A;  2H46 E;  5HKW A;  4A4B A;  3K2T A;  2C0T A;  3GXW A;  1LUK A;  3S8L A;  1F2F A;  2FCI A;  1RJA A;  1RPY A;  2L4K A;  2AOB A;  2H5K A;  2LNX A;  1YVH A;  5I6V A;  1BFI A;  2AOA A;  1OPK A;  1NZL A;  1Z3K A;  3M7F A;  3VS5 A;  1JYR A;  1X27 A;  2ECD A;  3BUW B;  1F1W A;  4WWQ A;  5GJH A;  1TZE E;  3VRZ A;  1QAD A;  1KA6 A;  4OHI A;  1YVL A;  2K7A B;  3T04 A;  2LQW A;  1O4E A;  4XZ0 A;  3QWY A;  1O4G A;  3IMD A;  2CRH A;  2CIA A;  4H34 A;  1K9A A;  1O4J A;  1UUR A;  1Y1U A;  5DF6 A;  2PNA A;  1FBV A;  5IBS A;  4DGX A;  3S9K A;  3MAZ A;  2JYQ A;  3IN7 A;  4E93 A;  1AD5 A;  2HDV A;  5IBM A;  1WQU A;  3BKB A;  4NWG A;  1LCJ A;  2EL8 A;  4P9V A;  1FMK A;  2HMH A;  2SRC A;  4NWF A;  4K11 A;  1PIC A;  1R1S A;  3CXL A;  3BUX B;  1SHB A;  1SPR A;  1GHU A;  1R1P A;  2ETZ A;  3C7I A;  3VRQ A;  1ZFP E;  4DGP A;  2FO0 A;  3PQZ A;  4XZ1 A;  1JYQ A;  4M4Z A;  1FYR A;  3PFV A;  1B47 A;  3PS5 A;  2SHP A;  4K45 A;  1OPL A;  1O47 A;  2EYZ A;  3N7Y A;  3GXX A;  3VS3 A;  2PLE A;  3MXC A;  1O4I A;  1I3Z A;  1FBZ A;  4D8K A;  2K79 B;  3OVE A;  1R1Q A;  1A07 A;  1A1E A;  1O41 A;  4GWF A;  1SPS A;  2CI8 A;  2H8H A;  1H9O A;  4X6S A;  3S8O A;  3HCK A;  1LKK A;  1SHD A;  3N84 A;  1BLK A;  4GL9 E;  2HUW A;  2YU7 A;  2CS0 A;  3GQI B;  1O4B A;  2LNW A;  3IMJ A;  1JYU A;  3K2M A;  3OP0 A;  2MC1 A;  2LQN A;  4TZI A;  2OZO A;  1FU6 A;  3OV1 A;  3EAZ A;  2IUI A;  4OHL A;  3PLF B;  1AOT F;  2C0I A;  2VIF A;  3PSK A;  4K2R A;  5DC0 B;  1GRI A;  5EEQ A;  1AYD A;  3HHM B;  1RQQ C;  2EYV A;  1D4T A;  1OO3 A;  1SHA A;  3VS6 A;  1O4A A;  1LCK A;  1P13 A;  3EAC A;  2PLD A;  5DC4 A;  1O46 A;  2PNB A;  4F59 A;  4JGH A;  2Y3A B;  3UYO A;  3KFJ A;  2ABL A;  1CJ1 A;  1AYC A;  2DCR A;  2EKX A;  2XP1 A;  3VS1 A;  1CSZ A;  4F5A A;  4EY0 A;  3CWG A;  2YSX A;  5GJI A;  1A1C A;  2MRJ A;  4JE4 A;  1AYB A;  4LUD A;  1D4W A;  3VS0 A;  2EO3 A;  1O4F A;  1BHF A;  5D0J A;  1O4M A;  3VRN A;  2LRA A;  4F5B A;  1Y57 A; 
#chains in the Genus database with same CATH homology
 1O4N A;  3ZNI A;  5EG3 B;  5DC9 A;  1KA7 A;  4LUE A;  4GPL B;  3QWX X;  1M61 A;  1CSY A;  3OB1 B;  2GSB A;  1BMB A;  3PJP A;  4H1O A;  3TKZ A;  1LUN A;  2IUG A;  1BFJ A;  1MW4 A;  1D1Z A;  2L6K A;  1X6C A;  5AUL A;  1O4R A;  1AB2 A;  2IUH A;  5AXI A;  5EHR A;  3VS2 A;  3VRP A;  3WA4 A;  5HKY A;  2DLZ A;  2EU0 A;  2AUG A;  2CI9 A;  2MRK A;  1OO4 A;  2DM0 A;  3CBL A;  5HKZ A;  2C9W A;  1QCF A;  4OHD A;  4FL2 A;  1CWD L;  1O4Q A;  3VS7 A;  2IZV A;  3OB2 B;  4U1P A;  3TL0 A;  1BKL A;  2DLY A;  1KSW A;  1TCE A;  1O48 A;  1JWO A;  1M27 A;  3UF4 A;  4ROJ A;  2EOB A;  3VRR A;  4QSY A;  2GE9 A;  1BHH A;  1KC2 A;  3IN8 A;  3BUM B;  1O4C A;  3N8M A;  1NZV A;  2MK2 A;  3VGO A;  1JU5 A;  4JEG A;  5J3X A;  1UUS A;  4P9Z A;  1O4P A;  3BUN B;  1A08 A;  1LKL A;  1FU5 A;  1QG1 E;  5EHP A;  1O4D A;  1HCT B;  4L1B B;  2DX0 A;  3BUO B;  1AYA A;  1SKJ A;  1HCS B;  1NRV A;  5BO4 A;  1IJR A;  2CBL A;  2DVJ A;  2Y1M A;  3US4 A;  2HCK A;  4E68 A;  1A09 A;  1X0N A;  1XA6 A;  1BM2 A;  4U17 A;  2LCT A;  1O49 A;  1BKM A;  5CDW A;  5EEL A;  3CD3 A;  3MXY A;  3VRY A;  1O45 A;  4K44 A;  1LUM A;  3VS4 A;  1O4O A;  1O4K A;  2Y1N A;  2B3O A;  1A1A A;  2QMS A;  2BBU A;  1LUI A;  4A4C A;  1A1B A;  2EO6 A;  2MQI A;  3NHN A;  2CR4 A;  1G83 A;  1FHS A;  2OQ1 A;  2ROR A;  4EIH A;  1O44 A;  4FL3 A;  1BHH B;  1MIL A;  2RMX A;  1AOU F;  2L3T A;  3S8N A;  2KNO A;  3PSJ A;  1BG1 A;  5KAZ A;  2RVF A;  2RSY A;  2KK6 A;  1A81 A;  1IS0 A;  1O4L A;  2C0O A;  1CWE A;  3VRO A;  1O43 A;  4FBN A;  1BF5 A;  2HDX A;  4OHE A;  3HIZ B;  1BLJ A;  2PTK A;  2EYY A;  4OHH A;  1O4H A;  1O42 A;  2H46 E;  5HKW A;  4A4B A;  2C0T A;  1LUK A;  3GXW A;  3S8L A;  1F2F A;  2FCI A;  1RJA A;  1RPY A;  2L4K A;  2AOB A;  2H5K A;  2LNX A;  1YVH A;  5I6V A;  1BFI A;  2AOA A;  1OPK A;  1NZL A;  1Z3K A;  3M7F A;  3VS5 A;  1JYR A;  1X27 A;  2ECD A;  3BUW B;  1F1W A;  4WWQ A;  5GJH A;  1TZE E;  3VRZ A;  1QAD A;  1KA6 A;  4OHI A;  1YVL A;  2K7A B;  3T04 A;  2LQW A;  1O4E A;  4XZ0 A;  3QWY A;  1O4G A;  3IMD A;  2CRH A;  2CIA A;  4H34 A;  1K9A A;  1O4J A;  1UUR A;  1Y1U A;  5DF6 A;  2PNA A;  1FBV A;  5IBS A;  4DGX A;  3S9K A;  3MAZ A;  2JYQ A;  3IN7 A;  4E93 A;  1AD5 A;  2HDV A;  5IBM A;  1WQU A;  3BKB A;  4NWG A;  1LCJ A;  2EL8 A;  4P9V A;  1FMK A;  2HMH A;  2SRC A;  4NWF A;  4K11 A;  1PIC A;  1R1S A;  3CXL A;  3BUX B;  1SHB A;  1SPR A;  1GHU A;  1R1P A;  2ETZ A;  3C7I A;  3VRQ A;  1ZFP E;  4DGP A;  2FO0 A;  3PQZ A;  4XZ1 A;  1JYQ A;  4M4Z A;  1FYR A;  3PFV A;  1B47 A;  3PS5 A;  2SHP A;  4K45 A;  1OPL A;  1O47 A;  2EYZ A;  3N7Y A;  3GXX A;  3VS3 A;  2PLE A;  3MXC A;  1O4I A;  1I3Z A;  1FBZ A;  4D8K A;  2K79 B;  3OVE A;  1R1Q A;  1A07 A;  1A1E A;  1O41 A;  4GWF A;  1SPS A;  2CI8 A;  2H8H A;  1H9O A;  4X6S A;  3S8O A;  3HCK A;  1LKK A;  1SHD A;  3N84 A;  1BLK A;  4GL9 E;  2HUW A;  2YU7 A;  2CS0 A;  3GQI B;  1O4B A;  2LNW A;  3IMJ A;  1JYU A;  3K2M A;  3OP0 A;  2MC1 A;  2LQN A;  4TZI A;  2OZO A;  1FU6 A;  3OV1 A;  3EAZ A;  2IUI A;  4OHL A;  3PLF B;  1AOT F;  2C0I A;  2VIF A;  3PSK A;  4K2R A;  5DC0 B;  1GRI A;  5EEQ A;  1AYD A;  3HHM B;  1RQQ C;  2EYV A;  1D4T A;  1OO3 A;  1SHA A;  3VS6 A;  1O4A A;  1LCK A;  1P13 A;  3EAC A;  2PLD A;  5DC4 A;  1O46 A;  2PNB A;  4F59 A;  4JGH A;  2Y3A B;  3UYO A;  3KFJ A;  2ABL A;  1CJ1 A;  1AYC A;  2DCR A;  2EKX A;  2XP1 A;  3VS1 A;  1CSZ A;  4F5A A;  4EY0 A;  3CWG A;  2YSX A;  5GJI A;  1A1C A;  2MRJ A;  4JE4 A;  1AYB A;  4LUD A;  1D4W A;  3VS0 A;  2EO3 A;  1O4F A;  1BHF A;  5D0J A;  1O4M A;  3VRN A;  4F5B A;  1Y57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...