4JEGA

Crystal structure of monobody cs1/shp2 c-sh2 domain complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
114
Chain Sequence
b'LNCADPTSERWFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein phosphatase non-receptor type 11
publication title Dissection of the BCR-ABL signaling network using highly specific monobody inhibitors to the SHP2 SH2 domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/protein binding
total genus 27
structure length 114
sequence length 118
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4jegA00
1QG1E 2SHPA 1NZLA 3BUXB 1A07A 1CSZA 5HKWA 2EO6A 1LCJA 4NWFA 1UURA 2AOBA 3CWGA 4WWQA 5EELA 1QADA 2CBLA 2RVFA 1JYRA 3VS1A 3TKZA 1JWOA 5EHRA 5IBSA 4DGPA 5DC9A 2C0OA 1LKLA 1MW4A 4U17A 1HCTB 1FMKA 3OV1A 1SHAA 1OO4A 3VRZA 1O4PA 4K2RA 3QWXX 1H9OA 3IMDA 2PNBA 1O42A 2ECDA 3US4A 3BUOB 5GJHA 4H34A 1BM2A 2FO0A 1LUKA 4TZIA 1BHHB 1R1PA 2B3OA 1D4TA 1ZFPE 1O47A 3NHNA 5CDWA 2K79B 1A1AA 3IN7A 1FYRA 2H46E 4FL2A 3VS5A 4P9ZA 1O4FA 2EL8A 5J3XA 1QCFA 2PLDA 2AUGA 3PFVA 1X6CA 4EY0A 1GRIA 1BKLA 3PLFB 1TZEE 5I6VA 1O4NA 1BMBA 4DGXA 1LCKA 1HCSB 1O4IA 3OB2B 3MXYA 1YVHA 2EYVA 2L3TA 3N84A 4GWFA 2DLZA 2CI8A 1O48A 1NRVA 2XP1A 1G83A 1M61A 1O4GA 1FBVA 2C0TA 2CR4A 3S8LA 5EEQA 3S8NA 2Y1MA 1IJRA 3TL0A 3BUWB 3S9KA 1KSWA 3PS5A 4L1BB 1AYBA 2L6KA 2LNXA 2SRCA 2PTKA 1SHBA 3OVEA 4XZ1A 1R1SA 4LUEA 4JE4A 3EAZA 1F2FA 3EACA 2CRHA 2LQNA 2IUIA 2IUHA 3C7IA 4NWGA 1AOUF 3T04A 3CBLA 4K11A 5AXIA 1O4RA 1O44A 2AOAA 1MILA 2KNOA 3CXLA 4U1PA 3GQIB 1O46A 2K7AB 1A08A 3VRQA 1FHSA 1UUSA 4OHEA 2HCKA 4A4CA 2BBUA 5GJIA 2ABLA 1KC2A 1XA6A 1BFIA 1JYQA 2H8HA 1O4BA 1K9AA 4E68A 1O41A 2EOBA 2EU0A 1GHUA 1O49A 2KK6A 4OHDA 1FU6A 1F1WA 1LKKA 1O4LA 1X0NA 1BFJA 2DLYA 3MXCA 5HKYA 2MRJA 3OB1B 2CI9A 1NZVA 4OHLA 1AYCA 2C9WA 3GXXA 2EYZA 2OQ1A 1X27A 3VS2A 4GL9E 1BF5A 3VS7A 3HIZB 1IS0A 3VRPA 1WQUA 1AYAA 2EO3A 1OPLA 3PJPA 2QMSA 1FBZA 2LCTA 2MRKA 2HDXA 3N8MA 2EYYA 3HHMB 5BO4A 3VS0A 1BLJA 3BKBA 3GXWA 1Y57A 3CD3A 2GE9A 3PSKA 3VROA 2PNAA 3HCKA 1Z3KA 1AOTF 1O4QA 4GPLB 2Y3AB 1O4AA 4E93A 3VS4A 4LUDA 5D0JA 1O45A 2H5KA 1O4JA 2L4KA 1OPKA 1A1EA 2CS0A 1O4HA 2Y1NA 4FBNA 1O4KA 4K45A 1AD5A 2LNWA 2RSYA 3UF4A 1BKMA 3VRNA 3PQZA 4K44A 2HMHA 2HUWA 1D1ZA 1RQQC 2MQIA 1LUMA 1KA6A 2C0IA 3OP0A 2DCRA 2VIFA 2HDVA 4XZ0A 1D4WA 4JEGA 3QWYA 5KAZA 1Y1UA 1SPSA 1YVLA 1O4OA 3BUMB 5DC4A 5IBMA 3ZNIA 1AB2A 1O4EA 1SPRA 3MAZA 2IZVA 4F5AA 2FCIA 1PICA 4M4ZA 1BHFA 1B47A 1JU5A 3M7FA 5EG3B 1LUNA 3PSJA 4FL3A 1CSYA 2DM0A 1O4MA 2EKXA 1O43A 5DC0B 2LQWA 1OO3A 1A1CA 4OHIA 5EHPA 3BUNB 1FU5A 1LUIA 3VS3A 5HKZA 2JYQA 1A09A 4QSYA 4EIHA 2RORA 2PLEA 4ROJA 2RMXA 1CWEA 4D8KA 4A4BA 5AULA 1RJAA 1R1QA 1SHDA 2GSBA 3K2MA 4F59A 1CWDL 1JYUA 1A81A 3VS6A 1KA7A 3VRRA 2MC1A 2CIAA 2ETZA 4H1OA 4OHHA 3VRYA 2YU7A 4X6SA 2DVJA 4P9VA 3N7YA 3KFJA 1AYDA 1P13A 1BLKA 1M27A 3WA4A 3S8OA 1CJ1A 2YSXA 2IUGA 1A1BA 3UYOA 1TCEA 5DF6A 4JGHA 2MK2A 3VGOA 1BG1A 1O4CA 1RPYA 3IN8A 3IMJA 1I3ZA 4F5BA 2DX0A 1SKJA 1BHHA 1O4DA 2OZOA
chains in the Genus database with same CATH superfamily
1QG1E 2SHPA 1NZLA 3BUXB 1A07A 1CSZA 5HKWA 2EO6A 1LCJA 4NWFA 1UURA 2AOBA 3CWGA 4WWQA 5EELA 1QADA 2CBLA 2RVFA 1JYRA 3VS1A 3TKZA 1JWOA 5EHRA 5IBSA 4DGPA 5DC9A 2C0OA 1LKLA 1MW4A 4U17A 1HCTB 1FMKA 3OV1A 1SHAA 1OO4A 3VRZA 1O4PA 4K2RA 3QWXX 1H9OA 3IMDA 2PNBA 1O42A 2ECDA 3US4A 3BUOB 5GJHA 4H34A 1BM2A 2FO0A 1LUKA 4TZIA 1BHHB 1R1PA 2B3OA 1D4TA 1ZFPE 1O47A 3NHNA 5CDWA 2K79B 1A1AA 3IN7A 1FYRA 2H46E 4FL2A 3VS5A 4P9ZA 1O4FA 2EL8A 5J3XA 1QCFA 2PLDA 2AUGA 3PFVA 1X6CA 4EY0A 1GRIA 1BKLA 3PLFB 1TZEE 5I6VA 1O4NA 1BMBA 4DGXA 1LCKA 1HCSB 1O4IA 3OB2B 3MXYA 1YVHA 2EYVA 2L3TA 3N84A 4GWFA 2DLZA 2CI8A 1O48A 1NRVA 2XP1A 1G83A 1M61A 1O4GA 1FBVA 2C0TA 2CR4A 3S8LA 5EEQA 3S8NA 2Y1MA 1IJRA 3TL0A 3BUWB 3S9KA 1KSWA 3PS5A 4L1BB 1AYBA 2L6KA 2LNXA 2SRCA 2PTKA 1SHBA 3OVEA 4XZ1A 1R1SA 4LUEA 4JE4A 3EAZA 1F2FA 3EACA 2CRHA 2LQNA 2IUIA 2IUHA 3C7IA 4NWGA 1AOUF 3T04A 3CBLA 4K11A 5AXIA 1O4RA 1O44A 2AOAA 1MILA 2KNOA 3CXLA 4U1PA 3GQIB 1O46A 2K7AB 1A08A 3VRQA 1FHSA 1UUSA 4OHEA 2HCKA 4A4CA 2BBUA 5GJIA 2ABLA 1KC2A 1XA6A 1BFIA 1JYQA 2H8HA 1O4BA 1K9AA 4E68A 2LRAA 1O41A 2EOBA 2EU0A 1GHUA 1O49A 2KK6A 4OHDA 1FU6A 1F1WA 1LKKA 1O4LA 1X0NA 1BFJA 2DLYA 3MXCA 5HKYA 2MRJA 3OB1B 2CI9A 1NZVA 4OHLA 1AYCA 2C9WA 3GXXA 2EYZA 2OQ1A 1X27A 3VS2A 4GL9E 1BF5A 3VS7A 3HIZB 1IS0A 3VRPA 1WQUA 1AYAA 2EO3A 1OPLA 3PJPA 2QMSA 1FBZA 2LCTA 2MRKA 2HDXA 3N8MA 2EYYA 3HHMB 5BO4A 3VS0A 1BLJA 3BKBA 3GXWA 1Y57A 3CD3A 2GE9A 3PSKA 3VROA 2PNAA 3HCKA 1Z3KA 1AOTF 1O4QA 4GPLB 2Y3AB 1O4AA 4E93A 3VS4A 4LUDA 5D0JA 1O45A 2H5KA 1O4JA 2L4KA 1OPKA 1A1EA 2CS0A 1O4HA 2Y1NA 4FBNA 1O4KA 4K45A 1AD5A 2LNWA 2RSYA 3UF4A 1BKMA 3VRNA 3PQZA 4K44A 2HMHA 2HUWA 1D1ZA 1RQQC 2MQIA 1LUMA 1KA6A 2C0IA 3OP0A 2DCRA 2VIFA 2HDVA 4XZ0A 1D4WA 4JEGA 3QWYA 5KAZA 1Y1UA 1SPSA 1YVLA 1O4OA 3BUMB 5DC4A 5IBMA 3ZNIA 1AB2A 1O4EA 1SPRA 3MAZA 2IZVA 4F5AA 2FCIA 1PICA 4M4ZA 1BHFA 1B47A 1JU5A 3M7FA 5EG3B 1LUNA 3PSJA 4FL3A 1CSYA 2DM0A 1O4MA 2EKXA 1O43A 5DC0B 2LQWA 1OO3A 1A1CA 4OHIA 5EHPA 3BUNB 1FU5A 1LUIA 3VS3A 5HKZA 2JYQA 1A09A 4QSYA 4EIHA 2RORA 2PLEA 4ROJA 2RMXA 1CWEA 4D8KA 4A4BA 5AULA 1RJAA 1R1QA 1SHDA 2GSBA 3K2MA 4F59A 1CWDL 1JYUA 1A81A 3VS6A 1KA7A 3VRRA 2MC1A 2CIAA 2ETZA 4H1OA 4OHHA 3VRYA 2YU7A 4X6SA 2DVJA 4P9VA 3N7YA 3KFJA 1AYDA 1P13A 1BLKA 1M27A 3WA4A 3S8OA 1CJ1A 2YSXA 2IUGA 1A1BA 3UYOA 1TCEA 5DF6A 4JGHA 2MK2A 3VGOA 1BG1A 2KGYA 1O4CA 1RPYA 3IN8A 3IMJA 1I3ZA 3K2TA 3LYVA 4F5BA 2DX0A 1SKJA 1BHHA 1O4DA 2OZOA
chains in the Genus database with same CATH topology
1QG1E 2SHPA 1NZLA 3BUXB 1A07A 1CSZA 5HKWA 2EO6A 1LCJA 4NWFA 1UURA 2AOBA 3CWGA 4WWQA 5EELA 1QADA 2CBLA 2RVFA 1JYRA 3VS1A 3TKZA 1JWOA 5EHRA 5IBSA 4DGPA 5DC9A 2C0OA 1LKLA 1MW4A 4U17A 1HCTB 1FMKA 3OV1A 1SHAA 1OO4A 3VRZA 1O4PA 4K2RA 3QWXX 1H9OA 3IMDA 2PNBA 1O42A 2ECDA 3US4A 3BUOB 5GJHA 4H34A 1BM2A 2FO0A 1LUKA 4TZIA 1BHHB 1R1PA 2B3OA 1D4TA 1ZFPE 1O47A 3NHNA 5CDWA 2K79B 1A1AA 3IN7A 1FYRA 2H46E 4FL2A 3VS5A 4P9ZA 1O4FA 2EL8A 5J3XA 1QCFA 2PLDA 2AUGA 3PFVA 1X6CA 4EY0A 1GRIA 1BKLA 3PLFB 1TZEE 5I6VA 1O4NA 1BMBA 4DGXA 1LCKA 1HCSB 1O4IA 3OB2B 3MXYA 1YVHA 2EYVA 2L3TA 3N84A 4GWFA 2DLZA 2CI8A 1O48A 1NRVA 2XP1A 1G83A 1M61A 1O4GA 1FBVA 2C0TA 2CR4A 3S8LA 5EEQA 3S8NA 2Y1MA 1IJRA 3TL0A 3BUWB 3S9KA 1KSWA 3PS5A 4L1BB 1AYBA 2L6KA 2LNXA 2SRCA 2PTKA 1SHBA 3OVEA 4XZ1A 1R1SA 4LUEA 4JE4A 3EAZA 1F2FA 3EACA 2CRHA 2LQNA 2IUIA 2IUHA 3C7IA 4NWGA 1AOUF 3T04A 3CBLA 4K11A 5AXIA 1O4RA 1O44A 2AOAA 1MILA 2KNOA 3CXLA 4U1PA 3GQIB 1O46A 2K7AB 1A08A 3VRQA 1FHSA 1UUSA 4OHEA 2HCKA 4A4CA 2BBUA 5GJIA 2ABLA 1KC2A 1XA6A 1BFIA 1JYQA 2H8HA 1O4BA 1K9AA 4E68A 1O41A 2EOBA 2EU0A 1GHUA 1O49A 2KK6A 4OHDA 1FU6A 1F1WA 1LKKA 1O4LA 1X0NA 1BFJA 2DLYA 3MXCA 5HKYA 2MRJA 3OB1B 2CI9A 1NZVA 4OHLA 1AYCA 2C9WA 3GXXA 2EYZA 2OQ1A 1X27A 3VS2A 4GL9E 1BF5A 3VS7A 3HIZB 1IS0A 3VRPA 1WQUA 1AYAA 2EO3A 1OPLA 3PJPA 2QMSA 1FBZA 2LCTA 2MRKA 2HDXA 3N8MA 2EYYA 3HHMB 5BO4A 3VS0A 1BLJA 3BKBA 3GXWA 1Y57A 3CD3A 2GE9A 3PSKA 3VROA 2PNAA 3HCKA 1Z3KA 1AOTF 1O4QA 4GPLB 2Y3AB 1O4AA 4E93A 3VS4A 4LUDA 5D0JA 1O45A 2H5KA 1O4JA 2L4KA 1OPKA 1A1EA 2CS0A 1O4HA 2Y1NA 4FBNA 1O4KA 4K45A 1AD5A 2LNWA 2RSYA 3UF4A 1BKMA 3VRNA 3PQZA 4K44A 2HMHA 2HUWA 1D1ZA 1RQQC 2MQIA 1LUMA 1KA6A 2C0IA 3OP0A 2DCRA 2VIFA 2HDVA 4XZ0A 1D4WA 4JEGA 3QWYA 5KAZA 1Y1UA 1SPSA 1YVLA 1O4OA 3BUMB 5DC4A 5IBMA 3ZNIA 1AB2A 1O4EA 1SPRA 3MAZA 2IZVA 4F5AA 2FCIA 1PICA 4M4ZA 1BHFA 1B47A 1JU5A 3M7FA 5EG3B 1LUNA 3PSJA 4FL3A 1CSYA 2DM0A 1O4MA 2EKXA 1O43A 5DC0B 2LQWA 1OO3A 1A1CA 4OHIA 5EHPA 3BUNB 1FU5A 1LUIA 3VS3A 5HKZA 2JYQA 1A09A 4QSYA 4EIHA 2RORA 2PLEA 4ROJA 2RMXA 1CWEA 4D8KA 4A4BA 5AULA 1RJAA 1R1QA 1SHDA 2GSBA 3K2MA 4F59A 1CWDL 1JYUA 1A81A 3VS6A 1KA7A 3VRRA 2MC1A 2CIAA 2ETZA 4H1OA 4OHHA 3VRYA 2YU7A 4X6SA 2DVJA 4P9VA 3N7YA 3KFJA 1AYDA 1P13A 1BLKA 1M27A 3WA4A 3S8OA 1CJ1A 2YSXA 2IUGA 1A1BA 3UYOA 1TCEA 5DF6A 4JGHA 2MK2A 3VGOA 1BG1A 1O4CA 1RPYA 3IN8A 3IMJA 1I3ZA 4F5BA 2DX0A 1SKJA 1BHHA 1O4DA 2OZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QG1 E;  2SHP A;  1NZL A;  3BUX B;  1A07 A;  1CSZ A;  5HKW A;  2EO6 A;  1LCJ A;  4NWF A;  1UUR A;  2AOB A;  3CWG A;  4WWQ A;  5EEL A;  1QAD A;  2CBL A;  2RVF A;  1JYR A;  3VS1 A;  3TKZ A;  1JWO A;  5EHR A;  5IBS A;  4DGP A;  5DC9 A;  2C0O A;  1LKL A;  1MW4 A;  4U17 A;  1HCT B;  1FMK A;  3OV1 A;  1SHA A;  1OO4 A;  3VRZ A;  1O4P A;  4K2R A;  3QWX X;  1H9O A;  3IMD A;  2PNB A;  1O42 A;  2ECD A;  3US4 A;  3BUO B;  5GJH A;  4H34 A;  1BM2 A;  2FO0 A;  1LUK A;  4TZI A;  1BHH B;  1R1P A;  2B3O A;  1D4T A;  1ZFP E;  1O47 A;  3NHN A;  5CDW A;  2K79 B;  1A1A A;  3IN7 A;  1FYR A;  2H46 E;  4FL2 A;  3VS5 A;  4P9Z A;  1O4F A;  2EL8 A;  5J3X A;  1QCF A;  2PLD A;  2AUG A;  3PFV A;  1X6C A;  4EY0 A;  1GRI A;  1BKL A;  3PLF B;  1TZE E;  5I6V A;  1O4N A;  1BMB A;  4DGX A;  1LCK A;  1HCS B;  1O4I A;  3OB2 B;  3MXY A;  1YVH A;  2EYV A;  2L3T A;  3N84 A;  4GWF A;  2DLZ A;  2CI8 A;  1O48 A;  1NRV A;  2XP1 A;  1G83 A;  1M61 A;  1O4G A;  1FBV A;  2C0T A;  2CR4 A;  3S8L A;  5EEQ A;  3S8N A;  2Y1M A;  1IJR A;  3TL0 A;  3BUW B;  3S9K A;  1KSW A;  3PS5 A;  4L1B B;  1AYB A;  2L6K A;  2LNX A;  2SRC A;  2PTK A;  1SHB A;  3OVE A;  4XZ1 A;  1R1S A;  4LUE A;  4JE4 A;  3EAZ A;  1F2F A;  3EAC A;  2CRH A;  2LQN A;  2IUI A;  2IUH A;  3C7I A;  4NWG A;  1AOU F;  3T04 A;  3CBL A;  4K11 A;  5AXI A;  1O4R A;  1O44 A;  2AOA A;  1MIL A;  2KNO A;  3CXL A;  4U1P A;  3GQI B;  1O46 A;  2K7A B;  1A08 A;  3VRQ A;  1FHS A;  1UUS A;  4OHE A;  2HCK A;  4A4C A;  2BBU A;  5GJI A;  2ABL A;  1KC2 A;  1XA6 A;  1BFI A;  1JYQ A;  2H8H A;  1O4B A;  1K9A A;  4E68 A;  1O41 A;  2EOB A;  2EU0 A;  1GHU A;  1O49 A;  2KK6 A;  4OHD A;  1FU6 A;  1F1W A;  1LKK A;  1O4L A;  1X0N A;  1BFJ A;  2DLY A;  3MXC A;  5HKY A;  2MRJ A;  3OB1 B;  2CI9 A;  1NZV A;  4OHL A;  1AYC A;  2C9W A;  3GXX A;  2EYZ A;  2OQ1 A;  1X27 A;  3VS2 A;  4GL9 E;  1BF5 A;  3VS7 A;  3HIZ B;  1IS0 A;  3VRP A;  1WQU A;  1AYA A;  2EO3 A;  1OPL A;  3PJP A;  2QMS A;  1FBZ A;  2LCT A;  2MRK A;  2HDX A;  3N8M A;  2EYY A;  3HHM B;  5BO4 A;  3VS0 A;  1BLJ A;  3BKB A;  3GXW A;  1Y57 A;  3CD3 A;  2GE9 A;  3PSK A;  3VRO A;  2PNA A;  3HCK A;  1Z3K A;  1AOT F;  1O4Q A;  4GPL B;  2Y3A B;  1O4A A;  4E93 A;  3VS4 A;  4LUD A;  5D0J A;  1O45 A;  2H5K A;  1O4J A;  2L4K A;  1OPK A;  1A1E A;  2CS0 A;  1O4H A;  2Y1N A;  4FBN A;  1O4K A;  4K45 A;  1AD5 A;  2LNW A;  2RSY A;  3UF4 A;  1BKM A;  3VRN A;  3PQZ A;  4K44 A;  2HMH A;  2HUW A;  1D1Z A;  1RQQ C;  2MQI A;  1LUM A;  1KA6 A;  2C0I A;  3OP0 A;  2DCR A;  2VIF A;  2HDV A;  4XZ0 A;  1D4W A;  4JEG A;  3QWY A;  5KAZ A;  1Y1U A;  1SPS A;  1YVL A;  1O4O A;  3BUM B;  5DC4 A;  5IBM A;  3ZNI A;  1AB2 A;  1O4E A;  1SPR A;  3MAZ A;  2IZV A;  4F5A A;  2FCI A;  1PIC A;  4M4Z A;  1BHF A;  1B47 A;  1JU5 A;  3M7F A;  5EG3 B;  1LUN A;  3PSJ A;  4FL3 A;  1CSY A;  2DM0 A;  1O4M A;  2EKX A;  1O43 A;  5DC0 B;  2LQW A;  1OO3 A;  1A1C A;  4OHI A;  5EHP A;  3BUN B;  1FU5 A;  1LUI A;  3VS3 A;  5HKZ A;  2JYQ A;  1A09 A;  4QSY A;  4EIH A;  2ROR A;  2PLE A;  4ROJ A;  2RMX A;  1CWE A;  4D8K A;  4A4B A;  5AUL A;  1RJA A;  1R1Q A;  1SHD A;  2GSB A;  3K2M A;  4F59 A;  1CWD L;  1JYU A;  1A81 A;  3VS6 A;  1KA7 A;  3VRR A;  2MC1 A;  2CIA A;  2ETZ A;  4H1O A;  4OHH A;  3VRY A;  2YU7 A;  4X6S A;  2DVJ A;  4P9V A;  3N7Y A;  3KFJ A;  1AYD A;  1P13 A;  1BLK A;  1M27 A;  3WA4 A;  3S8O A;  1CJ1 A;  2YSX A;  2IUG A;  1A1B A;  3UYO A;  1TCE A;  5DF6 A;  4JGH A;  2MK2 A;  3VGO A;  1BG1 A;  1O4C A;  1RPY A;  3IN8 A;  3IMJ A;  1I3Z A;  4F5B A;  2DX0 A;  1SKJ A;  1BHH A;  1O4D A;  2OZO A; 
#chains in the Genus database with same CATH topology
 1QG1 E;  2SHP A;  1NZL A;  3BUX B;  1A07 A;  1CSZ A;  5HKW A;  2EO6 A;  1LCJ A;  4NWF A;  1UUR A;  2AOB A;  3CWG A;  4WWQ A;  5EEL A;  1QAD A;  2CBL A;  2RVF A;  1JYR A;  3VS1 A;  3TKZ A;  1JWO A;  5EHR A;  5IBS A;  4DGP A;  5DC9 A;  2C0O A;  1LKL A;  1MW4 A;  4U17 A;  1HCT B;  1FMK A;  3OV1 A;  1SHA A;  1OO4 A;  3VRZ A;  1O4P A;  4K2R A;  3QWX X;  1H9O A;  3IMD A;  2PNB A;  1O42 A;  2ECD A;  3US4 A;  3BUO B;  5GJH A;  4H34 A;  1BM2 A;  2FO0 A;  1LUK A;  4TZI A;  1BHH B;  1R1P A;  2B3O A;  1D4T A;  1ZFP E;  1O47 A;  3NHN A;  5CDW A;  2K79 B;  1A1A A;  3IN7 A;  1FYR A;  2H46 E;  4FL2 A;  3VS5 A;  4P9Z A;  1O4F A;  2EL8 A;  5J3X A;  1QCF A;  2PLD A;  2AUG A;  3PFV A;  1X6C A;  4EY0 A;  1GRI A;  1BKL A;  3PLF B;  1TZE E;  5I6V A;  1O4N A;  1BMB A;  4DGX A;  1LCK A;  1HCS B;  1O4I A;  3OB2 B;  3MXY A;  1YVH A;  2EYV A;  2L3T A;  3N84 A;  4GWF A;  2DLZ A;  2CI8 A;  1O48 A;  1NRV A;  2XP1 A;  1G83 A;  1M61 A;  1O4G A;  1FBV A;  2C0T A;  2CR4 A;  3S8L A;  5EEQ A;  3S8N A;  2Y1M A;  1IJR A;  3TL0 A;  3BUW B;  3S9K A;  1KSW A;  3PS5 A;  4L1B B;  1AYB A;  2L6K A;  2LNX A;  2SRC A;  2PTK A;  1SHB A;  3OVE A;  4XZ1 A;  1R1S A;  4LUE A;  4JE4 A;  3EAZ A;  1F2F A;  3EAC A;  2CRH A;  2LQN A;  2IUI A;  2IUH A;  3C7I A;  4NWG A;  1AOU F;  3T04 A;  3CBL A;  4K11 A;  5AXI A;  1O4R A;  1O44 A;  2AOA A;  1MIL A;  2KNO A;  3CXL A;  4U1P A;  3GQI B;  1O46 A;  2K7A B;  1A08 A;  3VRQ A;  1FHS A;  1UUS A;  4OHE A;  2HCK A;  4A4C A;  2BBU A;  5GJI A;  2ABL A;  1KC2 A;  1XA6 A;  1BFI A;  1JYQ A;  2H8H A;  1O4B A;  1K9A A;  4E68 A;  2LRA A;  1O41 A;  2EOB A;  2EU0 A;  1GHU A;  1O49 A;  2KK6 A;  4OHD A;  1FU6 A;  1F1W A;  1LKK A;  1O4L A;  1X0N A;  1BFJ A;  2DLY A;  3MXC A;  5HKY A;  2MRJ A;  3OB1 B;  2CI9 A;  1NZV A;  4OHL A;  1AYC A;  2C9W A;  3GXX A;  2EYZ A;  2OQ1 A;  1X27 A;  3VS2 A;  4GL9 E;  1BF5 A;  3VS7 A;  3HIZ B;  1IS0 A;  3VRP A;  1WQU A;  1AYA A;  2EO3 A;  1OPL A;  3PJP A;  2QMS A;  1FBZ A;  2LCT A;  2MRK A;  2HDX A;  3N8M A;  2EYY A;  3HHM B;  5BO4 A;  3VS0 A;  1BLJ A;  3BKB A;  3GXW A;  1Y57 A;  3CD3 A;  2GE9 A;  3PSK A;  3VRO A;  2PNA A;  3HCK A;  1Z3K A;  1AOT F;  1O4Q A;  4GPL B;  2Y3A B;  1O4A A;  4E93 A;  3VS4 A;  4LUD A;  5D0J A;  1O45 A;  2H5K A;  1O4J A;  2L4K A;  1OPK A;  1A1E A;  2CS0 A;  1O4H A;  2Y1N A;  4FBN A;  1O4K A;  4K45 A;  1AD5 A;  2LNW A;  2RSY A;  3UF4 A;  1BKM A;  3VRN A;  3PQZ A;  4K44 A;  2HMH A;  2HUW A;  1D1Z A;  1RQQ C;  2MQI A;  1LUM A;  1KA6 A;  2C0I A;  3OP0 A;  2DCR A;  2VIF A;  2HDV A;  4XZ0 A;  1D4W A;  4JEG A;  3QWY A;  5KAZ A;  1Y1U A;  1SPS A;  1YVL A;  1O4O A;  3BUM B;  5DC4 A;  5IBM A;  3ZNI A;  1AB2 A;  1O4E A;  1SPR A;  3MAZ A;  2IZV A;  4F5A A;  2FCI A;  1PIC A;  4M4Z A;  1BHF A;  1B47 A;  1JU5 A;  3M7F A;  5EG3 B;  1LUN A;  3PSJ A;  4FL3 A;  1CSY A;  2DM0 A;  1O4M A;  2EKX A;  1O43 A;  5DC0 B;  2LQW A;  1OO3 A;  1A1C A;  4OHI A;  5EHP A;  3BUN B;  1FU5 A;  1LUI A;  3VS3 A;  5HKZ A;  2JYQ A;  1A09 A;  4QSY A;  4EIH A;  2ROR A;  2PLE A;  4ROJ A;  2RMX A;  1CWE A;  4D8K A;  4A4B A;  5AUL A;  1RJA A;  1R1Q A;  1SHD A;  2GSB A;  3K2M A;  4F59 A;  1CWD L;  1JYU A;  1A81 A;  3VS6 A;  1KA7 A;  3VRR A;  2MC1 A;  2CIA A;  2ETZ A;  4H1O A;  4OHH A;  3VRY A;  2YU7 A;  4X6S A;  2DVJ A;  4P9V A;  3N7Y A;  3KFJ A;  1AYD A;  1P13 A;  1BLK A;  1M27 A;  3WA4 A;  3S8O A;  1CJ1 A;  2YSX A;  2IUG A;  1A1B A;  3UYO A;  1TCE A;  5DF6 A;  4JGH A;  2MK2 A;  3VGO A;  1BG1 A;  2KGY A;  1O4C A;  1RPY A;  3IN8 A;  3IMJ A;  1I3Z A;  3K2T A;  3LYV A;  4F5B A;  2DX0 A;  1SKJ A;  1BHH A;  1O4D A;  2OZO A; 
#chains in the Genus database with same CATH homology
 1QG1 E;  2SHP A;  1NZL A;  3BUX B;  1A07 A;  1CSZ A;  5HKW A;  2EO6 A;  1LCJ A;  4NWF A;  1UUR A;  2AOB A;  3CWG A;  4WWQ A;  5EEL A;  1QAD A;  2CBL A;  2RVF A;  1JYR A;  3VS1 A;  3TKZ A;  1JWO A;  5EHR A;  5IBS A;  4DGP A;  5DC9 A;  2C0O A;  1LKL A;  1MW4 A;  4U17 A;  1HCT B;  1FMK A;  3OV1 A;  1SHA A;  1OO4 A;  3VRZ A;  1O4P A;  4K2R A;  3QWX X;  1H9O A;  3IMD A;  2PNB A;  1O42 A;  2ECD A;  3US4 A;  3BUO B;  5GJH A;  4H34 A;  1BM2 A;  2FO0 A;  1LUK A;  4TZI A;  1BHH B;  1R1P A;  2B3O A;  1D4T A;  1ZFP E;  1O47 A;  3NHN A;  5CDW A;  2K79 B;  1A1A A;  3IN7 A;  1FYR A;  2H46 E;  4FL2 A;  3VS5 A;  4P9Z A;  1O4F A;  2EL8 A;  5J3X A;  1QCF A;  2PLD A;  2AUG A;  3PFV A;  1X6C A;  4EY0 A;  1GRI A;  1BKL A;  3PLF B;  1TZE E;  5I6V A;  1O4N A;  1BMB A;  4DGX A;  1LCK A;  1HCS B;  1O4I A;  3OB2 B;  3MXY A;  1YVH A;  2EYV A;  2L3T A;  3N84 A;  4GWF A;  2DLZ A;  2CI8 A;  1O48 A;  1NRV A;  2XP1 A;  1G83 A;  1M61 A;  1O4G A;  1FBV A;  2C0T A;  2CR4 A;  3S8L A;  5EEQ A;  3S8N A;  2Y1M A;  1IJR A;  3TL0 A;  3BUW B;  3S9K A;  1KSW A;  3PS5 A;  4L1B B;  1AYB A;  2L6K A;  2LNX A;  2SRC A;  2PTK A;  1SHB A;  3OVE A;  4XZ1 A;  1R1S A;  4LUE A;  4JE4 A;  3EAZ A;  1F2F A;  3EAC A;  2CRH A;  2LQN A;  2IUI A;  2IUH A;  3C7I A;  4NWG A;  1AOU F;  3T04 A;  3CBL A;  4K11 A;  5AXI A;  1O4R A;  1O44 A;  2AOA A;  1MIL A;  2KNO A;  3CXL A;  4U1P A;  3GQI B;  1O46 A;  2K7A B;  1A08 A;  3VRQ A;  1FHS A;  1UUS A;  4OHE A;  2HCK A;  4A4C A;  2BBU A;  5GJI A;  2ABL A;  1KC2 A;  1XA6 A;  1BFI A;  1JYQ A;  2H8H A;  1O4B A;  1K9A A;  4E68 A;  1O41 A;  2EOB A;  2EU0 A;  1GHU A;  1O49 A;  2KK6 A;  4OHD A;  1FU6 A;  1F1W A;  1LKK A;  1O4L A;  1X0N A;  1BFJ A;  2DLY A;  3MXC A;  5HKY A;  2MRJ A;  3OB1 B;  2CI9 A;  1NZV A;  4OHL A;  1AYC A;  2C9W A;  3GXX A;  2EYZ A;  2OQ1 A;  1X27 A;  3VS2 A;  4GL9 E;  1BF5 A;  3VS7 A;  3HIZ B;  1IS0 A;  3VRP A;  1WQU A;  1AYA A;  2EO3 A;  1OPL A;  3PJP A;  2QMS A;  1FBZ A;  2LCT A;  2MRK A;  2HDX A;  3N8M A;  2EYY A;  3HHM B;  5BO4 A;  3VS0 A;  1BLJ A;  3BKB A;  3GXW A;  1Y57 A;  3CD3 A;  2GE9 A;  3PSK A;  3VRO A;  2PNA A;  3HCK A;  1Z3K A;  1AOT F;  1O4Q A;  4GPL B;  2Y3A B;  1O4A A;  4E93 A;  3VS4 A;  4LUD A;  5D0J A;  1O45 A;  2H5K A;  1O4J A;  2L4K A;  1OPK A;  1A1E A;  2CS0 A;  1O4H A;  2Y1N A;  4FBN A;  1O4K A;  4K45 A;  1AD5 A;  2LNW A;  2RSY A;  3UF4 A;  1BKM A;  3VRN A;  3PQZ A;  4K44 A;  2HMH A;  2HUW A;  1D1Z A;  1RQQ C;  2MQI A;  1LUM A;  1KA6 A;  2C0I A;  3OP0 A;  2DCR A;  2VIF A;  2HDV A;  4XZ0 A;  1D4W A;  4JEG A;  3QWY A;  5KAZ A;  1Y1U A;  1SPS A;  1YVL A;  1O4O A;  3BUM B;  5DC4 A;  5IBM A;  3ZNI A;  1AB2 A;  1O4E A;  1SPR A;  3MAZ A;  2IZV A;  4F5A A;  2FCI A;  1PIC A;  4M4Z A;  1BHF A;  1B47 A;  1JU5 A;  3M7F A;  5EG3 B;  1LUN A;  3PSJ A;  4FL3 A;  1CSY A;  2DM0 A;  1O4M A;  2EKX A;  1O43 A;  5DC0 B;  2LQW A;  1OO3 A;  1A1C A;  4OHI A;  5EHP A;  3BUN B;  1FU5 A;  1LUI A;  3VS3 A;  5HKZ A;  2JYQ A;  1A09 A;  4QSY A;  4EIH A;  2ROR A;  2PLE A;  4ROJ A;  2RMX A;  1CWE A;  4D8K A;  4A4B A;  5AUL A;  1RJA A;  1R1Q A;  1SHD A;  2GSB A;  3K2M A;  4F59 A;  1CWD L;  1JYU A;  1A81 A;  3VS6 A;  1KA7 A;  3VRR A;  2MC1 A;  2CIA A;  2ETZ A;  4H1O A;  4OHH A;  3VRY A;  2YU7 A;  4X6S A;  2DVJ A;  4P9V A;  3N7Y A;  3KFJ A;  1AYD A;  1P13 A;  1BLK A;  1M27 A;  3WA4 A;  3S8O A;  1CJ1 A;  2YSX A;  2IUG A;  1A1B A;  3UYO A;  1TCE A;  5DF6 A;  4JGH A;  2MK2 A;  3VGO A;  1BG1 A;  1O4C A;  1RPY A;  3IN8 A;  3IMJ A;  1I3Z A;  4F5B A;  2DX0 A;  1SKJ A;  1BHH A;  1O4D A;  2OZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...