4F5BA

Triple mutant src sh2 domain bound to phosphotyrosine
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
108
Chain Sequence
b'DSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETVKGAYALSVSDFDNAKGLNVKHYLIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Superbinder SH2 Domains Act as Antagonists of Cell Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 28
structure length 108
sequence length 108
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4f5bA00
5DC0B 3QWXX 1BKLA 3BUOB 1XA6A 1O47A 2FO0A 3HCKA 4GWFA 4XZ1A 2HMHA 1BFJA 1UURA 1X27A 3HIZB 2ETZA 2DLYA 4FL3A 4JEGA 3QWYA 3MAZA 3TKZA 1R1PA 5CDWA 1FU6A 2XP1A 2CIAA 1FU5A 2K79B 1OO4A 4U1PA 4GL9E 1NRVA 1OPLA 4JE4A 2CS0A 3OB1B 3S8LA 4XZ0A 2DLZA 1GRIA 1BFIA 1LUKA 1KSWA 4WWQA 2EYYA 3BUWB 4L1BB 2MRKA 1B47A 3CXLA 1X0NA 1AOTF 3GXXA 2PNAA 1SPRA 3PJPA 1BHHA 3IMJA 4K44A 4F5BA 1LUIA 2MK2A 2ABLA 2AOAA 2DVJA 2OZOA 1A09A 1O4MA 2BBUA 1AYAA 2EL8A 1IS0A 1O4HA 3C7IA 1FBZA 5KAZA 1SKJA 1O42A 3OV1A 2FCIA 5DC9A 5EHRA 1I3ZA 1AYDA 1IJRA 1D4WA 4D8KA 2RMXA 2EKXA 1LCJA 2MC1A 3MXCA 2DX0A 1HCTB 1A1BA 4A4BA 1NZVA 3VRQA 3N8MA 3VS5A 1A81A 2C0IA 2H46E 4U17A 5EG3B 1BLKA 4OHIA 1O4QA 4ROJA 1O4BA 3IN7A 2CI9A 3PSKA 1A1AA 1LUNA 1O4DA 2EYVA 2ECDA 1SHBA 2GE9A 4TZIA 3VRPA 3K2MA 2K7AB 1AYCA 4E93A 3VS3A 5EEQA 2L4KA 2CI8A 1LKKA 2IUHA 1Y1UA 3GQIB 3VS7A 1HCSB 4JGHA 1BMBA 1KA6A 2C0OA 2LQWA 2LNXA 1X6CA 4NWFA 1SHDA 2DCRA 2B3OA 1O4FA 2IZVA 1GHUA 2VIFA 1M27A 3EACA 1BHFA 2RORA 1CSYA 5D0JA 2EO3A 2HCKA 3VRYA 3PSJA 3UYOA 3S8OA 2PTKA 2OQ1A 2CRHA 1MW4A 5BO4A 1Y57A 4DGXA 3EAZA 3BUXB 1QADA 1RJAA 5I6VA 5J3XA 1O4IA 3VS2A 4H1OA 3MXYA 2MRJA 2KNOA 1O4NA 4K2RA 1AD5A 1R1QA 1BKMA 1BHHB 1O4OA 3M7FA 4P9VA 1O4RA 5IBMA 5EHPA 1O4CA 3HHMB 5DF6A 1O4EA 1TCEA 4P9ZA 2CR4A 1O4JA 1O43A 1A08A 4EIHA 1YVHA 1JU5A 3UF4A 4A4CA 4LUEA 3VRZA 1SPSA 5HKZA 1BF5A 4E68A 3PS5A 1D4TA 2CBLA 1FYRA 3N84A 2PLDA 3IN8A 1ZFPE 3IMDA 3CD3A 1SHAA 3KFJA 4EY0A 3N7YA 1K9AA 1CSZA 4OHLA 1A1CA 3VRRA 1R1SA 1KA7A 3T04A 1JYUA 1JYRA 1LCKA 5GJHA 1QG1E 2KK6A 1O4GA 2Y1MA 1H9OA 3VS0A 2RSYA 1YVLA 1O4AA 2GSBA 3PQZA 1AYBA 1UUSA 2LQNA 1AOUF 1LKLA 5AXIA 5EELA 3WA4A 1KC2A 1O44A 4LUDA 2EOBA 1LUMA 1AB2A 2Y1NA 1WQUA 4K45A 2HDVA 4NWGA 4DGPA 1O4PA 2HUWA 4OHEA 1O48A 3VRNA 1O4KA 1Z3KA 2PNBA 1A1EA 2LCTA 1JWOA 1F2FA 4X6SA 2AOBA 2DM0A 3BKBA 3US4A 2Y3AB 3TL0A 3PFVA 2AUGA 4FBNA 2L3TA 5GJIA 1A07A 1FHSA 3OP0A 2LNWA 3CWGA 1BG1A 1BLJA 4FL2A 2RVFA 2IUIA 4M4ZA 2C0TA 1P13A 1OO3A 1F1WA 1G83A 3OB2B 1CWDL 3OVEA 1TZEE 2IUGA 1O45A 3S9KA 2QMSA 3VS6A 5AULA 1M61A 3S8NA 2L6KA 2EO6A 5DC4A 2HDXA 2EU0A 1RQQC 4QSYA 3VS1A 2YU7A 1QCFA 2MQIA 2JYQA 4H34A 2YSXA 3VS4A 4OHDA 4OHHA 3CBLA 4GPLB 1FMKA 1MILA 1O41A 3BUMB 2H8HA 1O49A 1RPYA 1PICA 3PLFB 5HKWA 2SRCA 2H5KA 3GXWA 1JYQA 3BUNB 1O4LA 3VROA 1BM2A 2C9WA 1OPKA 4F59A 3NHNA 2PLEA 1FBVA 3ZNIA 4K11A 2SHPA 1NZLA 1D1ZA 2EYZA 1CJ1A 1O46A 4F5AA 5IBSA 1CWEA 3VGOA 5HKYA
chains in the Genus database with same CATH superfamily
5DC0B 3QWXX 1BKLA 3BUOB 1XA6A 1O47A 2FO0A 3HCKA 4GWFA 4XZ1A 2HMHA 1BFJA 1UURA 1X27A 3HIZB 2ETZA 2DLYA 4FL3A 4JEGA 3QWYA 3MAZA 3TKZA 1R1PA 5CDWA 1FU6A 2XP1A 2CIAA 1FU5A 2K79B 1OO4A 4U1PA 4GL9E 1NRVA 1OPLA 4JE4A 2CS0A 3OB1B 3S8LA 4XZ0A 2DLZA 1GRIA 1BFIA 1LUKA 1KSWA 4WWQA 2EYYA 3BUWB 4L1BB 2MRKA 1B47A 3CXLA 1X0NA 1AOTF 3GXXA 2PNAA 1SPRA 3PJPA 1BHHA 3IMJA 4K44A 4F5BA 1LUIA 2MK2A 2ABLA 2AOAA 2DVJA 2OZOA 1A09A 1O4MA 2BBUA 1AYAA 2EL8A 1IS0A 1O4HA 3C7IA 1FBZA 5KAZA 1SKJA 1O42A 3OV1A 2FCIA 5DC9A 5EHRA 1I3ZA 1AYDA 1IJRA 1D4WA 4D8KA 2RMXA 2EKXA 1LCJA 2MC1A 3MXCA 2DX0A 1HCTB 1A1BA 4A4BA 1NZVA 3VRQA 3N8MA 3VS5A 1A81A 2C0IA 2H46E 4U17A 5EG3B 1BLKA 3K2TA 4OHIA 1O4QA 4ROJA 1O4BA 3IN7A 2CI9A 3PSKA 1A1AA 1LUNA 1O4DA 2EYVA 2ECDA 1SHBA 2GE9A 4TZIA 3VRPA 3K2MA 2K7AB 1AYCA 4E93A 3VS3A 5EEQA 2L4KA 2CI8A 1LKKA 2IUHA 1Y1UA 3GQIB 3VS7A 1HCSB 4JGHA 1BMBA 1KA6A 2C0OA 2LQWA 2LNXA 1X6CA 4NWFA 1SHDA 2DCRA 2B3OA 1O4FA 2IZVA 1GHUA 2VIFA 1M27A 3EACA 1BHFA 2RORA 1CSYA 5D0JA 2EO3A 2HCKA 3VRYA 3PSJA 3UYOA 3S8OA 2PTKA 2OQ1A 2CRHA 1MW4A 5BO4A 1Y57A 4DGXA 3EAZA 3BUXB 1QADA 1RJAA 5I6VA 5J3XA 1O4IA 3VS2A 4H1OA 3MXYA 2MRJA 2KNOA 1O4NA 4K2RA 1AD5A 1R1QA 1BKMA 1BHHB 1O4OA 3M7FA 4P9VA 1O4RA 2KGYA 5IBMA 5EHPA 1O4CA 3HHMB 2LRAA 5DF6A 1O4EA 1TCEA 4P9ZA 2CR4A 1O4JA 1O43A 1A08A 4EIHA 1YVHA 1JU5A 3UF4A 4A4CA 4LUEA 3VRZA 1SPSA 5HKZA 1BF5A 4E68A 3PS5A 1D4TA 2CBLA 1FYRA 3N84A 2PLDA 3IN8A 1ZFPE 3IMDA 3CD3A 1SHAA 3KFJA 4EY0A 3N7YA 1K9AA 1CSZA 4OHLA 1A1CA 3VRRA 1R1SA 1KA7A 3T04A 1JYUA 1JYRA 1LCKA 5GJHA 1QG1E 2KK6A 1O4GA 2Y1MA 1H9OA 3VS0A 2RSYA 1YVLA 1O4AA 2GSBA 3PQZA 1AYBA 1UUSA 2LQNA 1AOUF 1LKLA 5AXIA 5EELA 3WA4A 1KC2A 1O44A 4LUDA 2EOBA 1LUMA 1AB2A 2Y1NA 1WQUA 4K45A 2HDVA 4NWGA 4DGPA 1O4PA 2HUWA 4OHEA 1O48A 3VRNA 1O4KA 1Z3KA 2PNBA 1A1EA 2LCTA 1JWOA 1F2FA 4X6SA 2AOBA 2DM0A 3BKBA 3US4A 2Y3AB 3TL0A 3PFVA 2AUGA 4FBNA 2L3TA 5GJIA 1A07A 1FHSA 3OP0A 2LNWA 3CWGA 1BG1A 1BLJA 4FL2A 2RVFA 2IUIA 4M4ZA 3LYVA 2C0TA 1P13A 1OO3A 1F1WA 1G83A 3OB2B 1CWDL 3OVEA 1TZEE 2IUGA 1O45A 3S9KA 2QMSA 3VS6A 5AULA 1M61A 3S8NA 2L6KA 2EO6A 5DC4A 2HDXA 2EU0A 1RQQC 4QSYA 3VS1A 2YU7A 1QCFA 2MQIA 2JYQA 4H34A 2YSXA 3VS4A 4OHDA 4OHHA 3CBLA 4GPLB 1FMKA 1MILA 1O41A 3BUMB 2H8HA 1O49A 1RPYA 1PICA 3PLFB 5HKWA 2SRCA 2H5KA 3GXWA 1JYQA 3BUNB 1O4LA 3VROA 1BM2A 2C9WA 1OPKA 4F59A 3NHNA 2PLEA 1FBVA 3ZNIA 4K11A 2SHPA 1NZLA 1D1ZA 2EYZA 1CJ1A 1O46A 4F5AA 5IBSA 1CWEA 3VGOA 5HKYA
chains in the Genus database with same CATH topology
5DC0B 3QWXX 1BKLA 3BUOB 1XA6A 1O47A 2FO0A 3HCKA 4GWFA 4XZ1A 2HMHA 1BFJA 1UURA 1X27A 3HIZB 2ETZA 2DLYA 4FL3A 4JEGA 3QWYA 3MAZA 3TKZA 1R1PA 5CDWA 1FU6A 2XP1A 2CIAA 1FU5A 2K79B 1OO4A 4U1PA 4GL9E 1NRVA 1OPLA 4JE4A 2CS0A 3OB1B 3S8LA 4XZ0A 2DLZA 1GRIA 1BFIA 1LUKA 1KSWA 4WWQA 2EYYA 3BUWB 4L1BB 2MRKA 1B47A 3CXLA 1X0NA 1AOTF 3GXXA 2PNAA 1SPRA 3PJPA 1BHHA 3IMJA 4K44A 4F5BA 1LUIA 2MK2A 2ABLA 2AOAA 2DVJA 2OZOA 1A09A 1O4MA 2BBUA 1AYAA 2EL8A 1IS0A 1O4HA 3C7IA 1FBZA 5KAZA 1SKJA 1O42A 3OV1A 2FCIA 5DC9A 5EHRA 1I3ZA 1AYDA 1IJRA 1D4WA 4D8KA 2RMXA 2EKXA 1LCJA 2MC1A 3MXCA 2DX0A 1HCTB 1A1BA 4A4BA 1NZVA 3VRQA 3N8MA 3VS5A 1A81A 2C0IA 2H46E 4U17A 5EG3B 1BLKA 4OHIA 1O4QA 4ROJA 1O4BA 3IN7A 2CI9A 3PSKA 1A1AA 1LUNA 1O4DA 2EYVA 2ECDA 1SHBA 2GE9A 4TZIA 3VRPA 3K2MA 2K7AB 1AYCA 4E93A 3VS3A 5EEQA 2L4KA 2CI8A 1LKKA 2IUHA 1Y1UA 3GQIB 3VS7A 1HCSB 4JGHA 1BMBA 1KA6A 2C0OA 2LQWA 2LNXA 1X6CA 4NWFA 1SHDA 2DCRA 2B3OA 1O4FA 2IZVA 1GHUA 2VIFA 1M27A 3EACA 1BHFA 2RORA 1CSYA 5D0JA 2EO3A 2HCKA 3VRYA 3PSJA 3UYOA 3S8OA 2PTKA 2OQ1A 2CRHA 1MW4A 5BO4A 1Y57A 4DGXA 3EAZA 3BUXB 1QADA 1RJAA 5I6VA 5J3XA 1O4IA 3VS2A 4H1OA 3MXYA 2MRJA 2KNOA 1O4NA 4K2RA 1AD5A 1R1QA 1BKMA 1BHHB 1O4OA 3M7FA 4P9VA 1O4RA 5IBMA 5EHPA 1O4CA 3HHMB 5DF6A 1O4EA 1TCEA 4P9ZA 2CR4A 1O4JA 1O43A 1A08A 4EIHA 1YVHA 1JU5A 3UF4A 4A4CA 4LUEA 3VRZA 1SPSA 5HKZA 1BF5A 4E68A 3PS5A 1D4TA 2CBLA 1FYRA 3N84A 2PLDA 3IN8A 1ZFPE 3IMDA 3CD3A 1SHAA 3KFJA 4EY0A 3N7YA 1K9AA 1CSZA 4OHLA 1A1CA 3VRRA 1R1SA 1KA7A 3T04A 1JYUA 1JYRA 1LCKA 5GJHA 1QG1E 2KK6A 1O4GA 2Y1MA 1H9OA 3VS0A 2RSYA 1YVLA 1O4AA 2GSBA 3PQZA 1AYBA 1UUSA 2LQNA 1AOUF 1LKLA 5AXIA 5EELA 3WA4A 1KC2A 1O44A 4LUDA 2EOBA 1LUMA 1AB2A 2Y1NA 1WQUA 4K45A 2HDVA 4NWGA 4DGPA 1O4PA 2HUWA 4OHEA 1O48A 3VRNA 1O4KA 1Z3KA 2PNBA 1A1EA 2LCTA 1JWOA 1F2FA 4X6SA 2AOBA 2DM0A 3BKBA 3US4A 2Y3AB 3TL0A 3PFVA 2AUGA 4FBNA 2L3TA 5GJIA 1A07A 1FHSA 3OP0A 2LNWA 3CWGA 1BG1A 1BLJA 4FL2A 2RVFA 2IUIA 4M4ZA 2C0TA 1P13A 1OO3A 1F1WA 1G83A 3OB2B 1CWDL 3OVEA 1TZEE 2IUGA 1O45A 3S9KA 2QMSA 3VS6A 5AULA 1M61A 3S8NA 2L6KA 2EO6A 5DC4A 2HDXA 2EU0A 1RQQC 4QSYA 3VS1A 2YU7A 1QCFA 2MQIA 2JYQA 4H34A 2YSXA 3VS4A 4OHDA 4OHHA 3CBLA 4GPLB 1FMKA 1MILA 1O41A 3BUMB 2H8HA 1O49A 1RPYA 1PICA 3PLFB 5HKWA 2SRCA 2H5KA 3GXWA 1JYQA 3BUNB 1O4LA 3VROA 1BM2A 2C9WA 1OPKA 4F59A 3NHNA 2PLEA 1FBVA 3ZNIA 4K11A 2SHPA 1NZLA 1D1ZA 2EYZA 1CJ1A 1O46A 4F5AA 5IBSA 1CWEA 3VGOA 5HKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DC0 B;  3QWX X;  1BKL A;  3BUO B;  1XA6 A;  1O47 A;  2FO0 A;  3HCK A;  4GWF A;  4XZ1 A;  2HMH A;  1BFJ A;  1UUR A;  1X27 A;  3HIZ B;  2ETZ A;  2DLY A;  4FL3 A;  4JEG A;  3QWY A;  3MAZ A;  3TKZ A;  1R1P A;  5CDW A;  1FU6 A;  2XP1 A;  2CIA A;  1FU5 A;  2K79 B;  1OO4 A;  4U1P A;  4GL9 E;  1NRV A;  1OPL A;  4JE4 A;  2CS0 A;  3OB1 B;  3S8L A;  4XZ0 A;  2DLZ A;  1GRI A;  1BFI A;  1LUK A;  1KSW A;  4WWQ A;  2EYY A;  3BUW B;  4L1B B;  2MRK A;  1B47 A;  3CXL A;  1X0N A;  1AOT F;  3GXX A;  2PNA A;  1SPR A;  3PJP A;  1BHH A;  3IMJ A;  4K44 A;  4F5B A;  1LUI A;  2MK2 A;  2ABL A;  2AOA A;  2DVJ A;  2OZO A;  1A09 A;  1O4M A;  2BBU A;  1AYA A;  2EL8 A;  1IS0 A;  1O4H A;  3C7I A;  1FBZ A;  5KAZ A;  1SKJ A;  1O42 A;  3OV1 A;  2FCI A;  5DC9 A;  5EHR A;  1I3Z A;  1AYD A;  1IJR A;  1D4W A;  4D8K A;  2RMX A;  2EKX A;  1LCJ A;  2MC1 A;  3MXC A;  2DX0 A;  1HCT B;  1A1B A;  4A4B A;  1NZV A;  3VRQ A;  3N8M A;  3VS5 A;  1A81 A;  2C0I A;  2H46 E;  4U17 A;  5EG3 B;  1BLK A;  4OHI A;  1O4Q A;  4ROJ A;  1O4B A;  3IN7 A;  2CI9 A;  3PSK A;  1A1A A;  1LUN A;  1O4D A;  2EYV A;  2ECD A;  1SHB A;  2GE9 A;  4TZI A;  3VRP A;  3K2M A;  2K7A B;  1AYC A;  4E93 A;  3VS3 A;  5EEQ A;  2L4K A;  2CI8 A;  1LKK A;  2IUH A;  1Y1U A;  3GQI B;  3VS7 A;  1HCS B;  4JGH A;  1BMB A;  1KA6 A;  2C0O A;  2LQW A;  2LNX A;  1X6C A;  4NWF A;  1SHD A;  2DCR A;  2B3O A;  1O4F A;  2IZV A;  1GHU A;  2VIF A;  1M27 A;  3EAC A;  1BHF A;  2ROR A;  1CSY A;  5D0J A;  2EO3 A;  2HCK A;  3VRY A;  3PSJ A;  3UYO A;  3S8O A;  2PTK A;  2OQ1 A;  2CRH A;  1MW4 A;  5BO4 A;  1Y57 A;  4DGX A;  3EAZ A;  3BUX B;  1QAD A;  1RJA A;  5I6V A;  5J3X A;  1O4I A;  3VS2 A;  4H1O A;  3MXY A;  2MRJ A;  2KNO A;  1O4N A;  4K2R A;  1AD5 A;  1R1Q A;  1BKM A;  1BHH B;  1O4O A;  3M7F A;  4P9V A;  1O4R A;  5IBM A;  5EHP A;  1O4C A;  3HHM B;  5DF6 A;  1O4E A;  1TCE A;  4P9Z A;  2CR4 A;  1O4J A;  1O43 A;  1A08 A;  4EIH A;  1YVH A;  1JU5 A;  3UF4 A;  4A4C A;  4LUE A;  3VRZ A;  1SPS A;  5HKZ A;  1BF5 A;  4E68 A;  3PS5 A;  1D4T A;  2CBL A;  1FYR A;  3N84 A;  2PLD A;  3IN8 A;  1ZFP E;  3IMD A;  3CD3 A;  1SHA A;  3KFJ A;  4EY0 A;  3N7Y A;  1K9A A;  1CSZ A;  4OHL A;  1A1C A;  3VRR A;  1R1S A;  1KA7 A;  3T04 A;  1JYU A;  1JYR A;  1LCK A;  5GJH A;  1QG1 E;  2KK6 A;  1O4G A;  2Y1M A;  1H9O A;  3VS0 A;  2RSY A;  1YVL A;  1O4A A;  2GSB A;  3PQZ A;  1AYB A;  1UUS A;  2LQN A;  1AOU F;  1LKL A;  5AXI A;  5EEL A;  3WA4 A;  1KC2 A;  1O44 A;  4LUD A;  2EOB A;  1LUM A;  1AB2 A;  2Y1N A;  1WQU A;  4K45 A;  2HDV A;  4NWG A;  4DGP A;  1O4P A;  2HUW A;  4OHE A;  1O48 A;  3VRN A;  1O4K A;  1Z3K A;  2PNB A;  1A1E A;  2LCT A;  1JWO A;  1F2F A;  4X6S A;  2AOB A;  2DM0 A;  3BKB A;  3US4 A;  2Y3A B;  3TL0 A;  3PFV A;  2AUG A;  4FBN A;  2L3T A;  5GJI A;  1A07 A;  1FHS A;  3OP0 A;  2LNW A;  3CWG A;  1BG1 A;  1BLJ A;  4FL2 A;  2RVF A;  2IUI A;  4M4Z A;  2C0T A;  1P13 A;  1OO3 A;  1F1W A;  1G83 A;  3OB2 B;  1CWD L;  3OVE A;  1TZE E;  2IUG A;  1O45 A;  3S9K A;  2QMS A;  3VS6 A;  5AUL A;  1M61 A;  3S8N A;  2L6K A;  2EO6 A;  5DC4 A;  2HDX A;  2EU0 A;  1RQQ C;  4QSY A;  3VS1 A;  2YU7 A;  1QCF A;  2MQI A;  2JYQ A;  4H34 A;  2YSX A;  3VS4 A;  4OHD A;  4OHH A;  3CBL A;  4GPL B;  1FMK A;  1MIL A;  1O41 A;  3BUM B;  2H8H A;  1O49 A;  1RPY A;  1PIC A;  3PLF B;  5HKW A;  2SRC A;  2H5K A;  3GXW A;  1JYQ A;  3BUN B;  1O4L A;  3VRO A;  1BM2 A;  2C9W A;  1OPK A;  4F59 A;  3NHN A;  2PLE A;  1FBV A;  3ZNI A;  4K11 A;  2SHP A;  1NZL A;  1D1Z A;  2EYZ A;  1CJ1 A;  1O46 A;  4F5A A;  5IBS A;  1CWE A;  3VGO A;  5HKY A; 
#chains in the Genus database with same CATH topology
 5DC0 B;  3QWX X;  1BKL A;  3BUO B;  1XA6 A;  1O47 A;  2FO0 A;  3HCK A;  4GWF A;  4XZ1 A;  2HMH A;  1BFJ A;  1UUR A;  1X27 A;  3HIZ B;  2ETZ A;  2DLY A;  4FL3 A;  4JEG A;  3QWY A;  3MAZ A;  3TKZ A;  1R1P A;  5CDW A;  1FU6 A;  2XP1 A;  2CIA A;  1FU5 A;  2K79 B;  1OO4 A;  4U1P A;  4GL9 E;  1NRV A;  1OPL A;  4JE4 A;  2CS0 A;  3OB1 B;  3S8L A;  4XZ0 A;  2DLZ A;  1GRI A;  1BFI A;  1LUK A;  1KSW A;  4WWQ A;  2EYY A;  3BUW B;  4L1B B;  2MRK A;  1B47 A;  3CXL A;  1X0N A;  1AOT F;  3GXX A;  2PNA A;  1SPR A;  3PJP A;  1BHH A;  3IMJ A;  4K44 A;  4F5B A;  1LUI A;  2MK2 A;  2ABL A;  2AOA A;  2DVJ A;  2OZO A;  1A09 A;  1O4M A;  2BBU A;  1AYA A;  2EL8 A;  1IS0 A;  1O4H A;  3C7I A;  1FBZ A;  5KAZ A;  1SKJ A;  1O42 A;  3OV1 A;  2FCI A;  5DC9 A;  5EHR A;  1I3Z A;  1AYD A;  1IJR A;  1D4W A;  4D8K A;  2RMX A;  2EKX A;  1LCJ A;  2MC1 A;  3MXC A;  2DX0 A;  1HCT B;  1A1B A;  4A4B A;  1NZV A;  3VRQ A;  3N8M A;  3VS5 A;  1A81 A;  2C0I A;  2H46 E;  4U17 A;  5EG3 B;  1BLK A;  3K2T A;  4OHI A;  1O4Q A;  4ROJ A;  1O4B A;  3IN7 A;  2CI9 A;  3PSK A;  1A1A A;  1LUN A;  1O4D A;  2EYV A;  2ECD A;  1SHB A;  2GE9 A;  4TZI A;  3VRP A;  3K2M A;  2K7A B;  1AYC A;  4E93 A;  3VS3 A;  5EEQ A;  2L4K A;  2CI8 A;  1LKK A;  2IUH A;  1Y1U A;  3GQI B;  3VS7 A;  1HCS B;  4JGH A;  1BMB A;  1KA6 A;  2C0O A;  2LQW A;  2LNX A;  1X6C A;  4NWF A;  1SHD A;  2DCR A;  2B3O A;  1O4F A;  2IZV A;  1GHU A;  2VIF A;  1M27 A;  3EAC A;  1BHF A;  2ROR A;  1CSY A;  5D0J A;  2EO3 A;  2HCK A;  3VRY A;  3PSJ A;  3UYO A;  3S8O A;  2PTK A;  2OQ1 A;  2CRH A;  1MW4 A;  5BO4 A;  1Y57 A;  4DGX A;  3EAZ A;  3BUX B;  1QAD A;  1RJA A;  5I6V A;  5J3X A;  1O4I A;  3VS2 A;  4H1O A;  3MXY A;  2MRJ A;  2KNO A;  1O4N A;  4K2R A;  1AD5 A;  1R1Q A;  1BKM A;  1BHH B;  1O4O A;  3M7F A;  4P9V A;  1O4R A;  2KGY A;  5IBM A;  5EHP A;  1O4C A;  3HHM B;  2LRA A;  5DF6 A;  1O4E A;  1TCE A;  4P9Z A;  2CR4 A;  1O4J A;  1O43 A;  1A08 A;  4EIH A;  1YVH A;  1JU5 A;  3UF4 A;  4A4C A;  4LUE A;  3VRZ A;  1SPS A;  5HKZ A;  1BF5 A;  4E68 A;  3PS5 A;  1D4T A;  2CBL A;  1FYR A;  3N84 A;  2PLD A;  3IN8 A;  1ZFP E;  3IMD A;  3CD3 A;  1SHA A;  3KFJ A;  4EY0 A;  3N7Y A;  1K9A A;  1CSZ A;  4OHL A;  1A1C A;  3VRR A;  1R1S A;  1KA7 A;  3T04 A;  1JYU A;  1JYR A;  1LCK A;  5GJH A;  1QG1 E;  2KK6 A;  1O4G A;  2Y1M A;  1H9O A;  3VS0 A;  2RSY A;  1YVL A;  1O4A A;  2GSB A;  3PQZ A;  1AYB A;  1UUS A;  2LQN A;  1AOU F;  1LKL A;  5AXI A;  5EEL A;  3WA4 A;  1KC2 A;  1O44 A;  4LUD A;  2EOB A;  1LUM A;  1AB2 A;  2Y1N A;  1WQU A;  4K45 A;  2HDV A;  4NWG A;  4DGP A;  1O4P A;  2HUW A;  4OHE A;  1O48 A;  3VRN A;  1O4K A;  1Z3K A;  2PNB A;  1A1E A;  2LCT A;  1JWO A;  1F2F A;  4X6S A;  2AOB A;  2DM0 A;  3BKB A;  3US4 A;  2Y3A B;  3TL0 A;  3PFV A;  2AUG A;  4FBN A;  2L3T A;  5GJI A;  1A07 A;  1FHS A;  3OP0 A;  2LNW A;  3CWG A;  1BG1 A;  1BLJ A;  4FL2 A;  2RVF A;  2IUI A;  4M4Z A;  3LYV A;  2C0T A;  1P13 A;  1OO3 A;  1F1W A;  1G83 A;  3OB2 B;  1CWD L;  3OVE A;  1TZE E;  2IUG A;  1O45 A;  3S9K A;  2QMS A;  3VS6 A;  5AUL A;  1M61 A;  3S8N A;  2L6K A;  2EO6 A;  5DC4 A;  2HDX A;  2EU0 A;  1RQQ C;  4QSY A;  3VS1 A;  2YU7 A;  1QCF A;  2MQI A;  2JYQ A;  4H34 A;  2YSX A;  3VS4 A;  4OHD A;  4OHH A;  3CBL A;  4GPL B;  1FMK A;  1MIL A;  1O41 A;  3BUM B;  2H8H A;  1O49 A;  1RPY A;  1PIC A;  3PLF B;  5HKW A;  2SRC A;  2H5K A;  3GXW A;  1JYQ A;  3BUN B;  1O4L A;  3VRO A;  1BM2 A;  2C9W A;  1OPK A;  4F59 A;  3NHN A;  2PLE A;  1FBV A;  3ZNI A;  4K11 A;  2SHP A;  1NZL A;  1D1Z A;  2EYZ A;  1CJ1 A;  1O46 A;  4F5A A;  5IBS A;  1CWE A;  3VGO A;  5HKY A; 
#chains in the Genus database with same CATH homology
 5DC0 B;  3QWX X;  1BKL A;  3BUO B;  1XA6 A;  1O47 A;  2FO0 A;  3HCK A;  4GWF A;  4XZ1 A;  2HMH A;  1BFJ A;  1UUR A;  1X27 A;  3HIZ B;  2ETZ A;  2DLY A;  4FL3 A;  4JEG A;  3QWY A;  3MAZ A;  3TKZ A;  1R1P A;  5CDW A;  1FU6 A;  2XP1 A;  2CIA A;  1FU5 A;  2K79 B;  1OO4 A;  4U1P A;  4GL9 E;  1NRV A;  1OPL A;  4JE4 A;  2CS0 A;  3OB1 B;  3S8L A;  4XZ0 A;  2DLZ A;  1GRI A;  1BFI A;  1LUK A;  1KSW A;  4WWQ A;  2EYY A;  3BUW B;  4L1B B;  2MRK A;  1B47 A;  3CXL A;  1X0N A;  1AOT F;  3GXX A;  2PNA A;  1SPR A;  3PJP A;  1BHH A;  3IMJ A;  4K44 A;  4F5B A;  1LUI A;  2MK2 A;  2ABL A;  2AOA A;  2DVJ A;  2OZO A;  1A09 A;  1O4M A;  2BBU A;  1AYA A;  2EL8 A;  1IS0 A;  1O4H A;  3C7I A;  1FBZ A;  5KAZ A;  1SKJ A;  1O42 A;  3OV1 A;  2FCI A;  5DC9 A;  5EHR A;  1I3Z A;  1AYD A;  1IJR A;  1D4W A;  4D8K A;  2RMX A;  2EKX A;  1LCJ A;  2MC1 A;  3MXC A;  2DX0 A;  1HCT B;  1A1B A;  4A4B A;  1NZV A;  3VRQ A;  3N8M A;  3VS5 A;  1A81 A;  2C0I A;  2H46 E;  4U17 A;  5EG3 B;  1BLK A;  4OHI A;  1O4Q A;  4ROJ A;  1O4B A;  3IN7 A;  2CI9 A;  3PSK A;  1A1A A;  1LUN A;  1O4D A;  2EYV A;  2ECD A;  1SHB A;  2GE9 A;  4TZI A;  3VRP A;  3K2M A;  2K7A B;  1AYC A;  4E93 A;  3VS3 A;  5EEQ A;  2L4K A;  2CI8 A;  1LKK A;  2IUH A;  1Y1U A;  3GQI B;  3VS7 A;  1HCS B;  4JGH A;  1BMB A;  1KA6 A;  2C0O A;  2LQW A;  2LNX A;  1X6C A;  4NWF A;  1SHD A;  2DCR A;  2B3O A;  1O4F A;  2IZV A;  1GHU A;  2VIF A;  1M27 A;  3EAC A;  1BHF A;  2ROR A;  1CSY A;  5D0J A;  2EO3 A;  2HCK A;  3VRY A;  3PSJ A;  3UYO A;  3S8O A;  2PTK A;  2OQ1 A;  2CRH A;  1MW4 A;  5BO4 A;  1Y57 A;  4DGX A;  3EAZ A;  3BUX B;  1QAD A;  1RJA A;  5I6V A;  5J3X A;  1O4I A;  3VS2 A;  4H1O A;  3MXY A;  2MRJ A;  2KNO A;  1O4N A;  4K2R A;  1AD5 A;  1R1Q A;  1BKM A;  1BHH B;  1O4O A;  3M7F A;  4P9V A;  1O4R A;  5IBM A;  5EHP A;  1O4C A;  3HHM B;  5DF6 A;  1O4E A;  1TCE A;  4P9Z A;  2CR4 A;  1O4J A;  1O43 A;  1A08 A;  4EIH A;  1YVH A;  1JU5 A;  3UF4 A;  4A4C A;  4LUE A;  3VRZ A;  1SPS A;  5HKZ A;  1BF5 A;  4E68 A;  3PS5 A;  1D4T A;  2CBL A;  1FYR A;  3N84 A;  2PLD A;  3IN8 A;  1ZFP E;  3IMD A;  3CD3 A;  1SHA A;  3KFJ A;  4EY0 A;  3N7Y A;  1K9A A;  1CSZ A;  4OHL A;  1A1C A;  3VRR A;  1R1S A;  1KA7 A;  3T04 A;  1JYU A;  1JYR A;  1LCK A;  5GJH A;  1QG1 E;  2KK6 A;  1O4G A;  2Y1M A;  1H9O A;  3VS0 A;  2RSY A;  1YVL A;  1O4A A;  2GSB A;  3PQZ A;  1AYB A;  1UUS A;  2LQN A;  1AOU F;  1LKL A;  5AXI A;  5EEL A;  3WA4 A;  1KC2 A;  1O44 A;  4LUD A;  2EOB A;  1LUM A;  1AB2 A;  2Y1N A;  1WQU A;  4K45 A;  2HDV A;  4NWG A;  4DGP A;  1O4P A;  2HUW A;  4OHE A;  1O48 A;  3VRN A;  1O4K A;  1Z3K A;  2PNB A;  1A1E A;  2LCT A;  1JWO A;  1F2F A;  4X6S A;  2AOB A;  2DM0 A;  3BKB A;  3US4 A;  2Y3A B;  3TL0 A;  3PFV A;  2AUG A;  4FBN A;  2L3T A;  5GJI A;  1A07 A;  1FHS A;  3OP0 A;  2LNW A;  3CWG A;  1BG1 A;  1BLJ A;  4FL2 A;  2RVF A;  2IUI A;  4M4Z A;  2C0T A;  1P13 A;  1OO3 A;  1F1W A;  1G83 A;  3OB2 B;  1CWD L;  3OVE A;  1TZE E;  2IUG A;  1O45 A;  3S9K A;  2QMS A;  3VS6 A;  5AUL A;  1M61 A;  3S8N A;  2L6K A;  2EO6 A;  5DC4 A;  2HDX A;  2EU0 A;  1RQQ C;  4QSY A;  3VS1 A;  2YU7 A;  1QCF A;  2MQI A;  2JYQ A;  4H34 A;  2YSX A;  3VS4 A;  4OHD A;  4OHH A;  3CBL A;  4GPL B;  1FMK A;  1MIL A;  1O41 A;  3BUM B;  2H8H A;  1O49 A;  1RPY A;  1PIC A;  3PLF B;  5HKW A;  2SRC A;  2H5K A;  3GXW A;  1JYQ A;  3BUN B;  1O4L A;  3VRO A;  1BM2 A;  2C9W A;  1OPK A;  4F59 A;  3NHN A;  2PLE A;  1FBV A;  3ZNI A;  4K11 A;  2SHP A;  1NZL A;  1D1Z A;  2EYZ A;  1CJ1 A;  1O46 A;  4F5A A;  5IBS A;  1CWE A;  3VGO A;  5HKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...