1O4GA

Crystal structure of sh2 in complex with dpi59.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
105
Chain Sequence
b'SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
publication title Requirements for specific binding of low affinity inhibitor fragments to the SH2 domain of (pp60)Src are identical to those for high affinity binding of full length inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 26
structure length 105
sequence length 106
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1o4gA00
2CI8A 4QSYA 1O43A 2VIFA 4WWQA 3HHMB 5CDWA 2EL8A 1O45A 2DX0A 1AB2A 1BFIA 1O46A 4XZ0A 4F5AA 2EYYA 1O4FA 3VS1A 4K11A 3HIZB 1FU6A 2FO0A 1BFJA 1UUSA 2RVFA 2ECDA 2CI9A 3IN8A 3CBLA 1LCKA 1O4JA 4A4CA 2YSXA 3BKBA 1M61A 1SHBA 2BBUA 3VROA 5J3XA 1HCTB 1AYBA 1BHHA 2IZVA 4X6SA 1O44A 1NZVA 2H46E 2YU7A 1QG1E 2H5KA 2PTKA 5GJHA 4OHDA 1YVLA 2LNWA 3K2MA 2MRKA 1FBVA 1O4IA 1R1QA 2L6KA 3N7YA 2DVJA 3CWGA 3US4A 1A08A 2MC1A 3MXCA 4JE4A 3VS0A 1A81A 1R1SA 2RMXA 3VS6A 2EOBA 1AOTF 2K79B 2DLZA 2CBLA 1ZFPE 1FMKA 2LNXA 2B3OA 1QCFA 1CJ1A 2ABLA 4U1PA 1MW4A 5EHRA 4OHHA 5DC0B 3VS4A 1BKLA 3ZNIA 1FYRA 4K45A 2MRJA 4A4BA 4EIHA 1O47A 1SKJA 2AOAA 1O4LA 1O4GA 2L3TA 1JYRA 3UYOA 3WA4A 3GXXA 1OO3A 1UURA 1O4QA 1JWOA 2Y1MA 3S9KA 2EO3A 4P9VA 1A09A 2LCTA 1YVHA 2K7AB 3S8LA 3QWXX 1O4PA 1B47A 1LCJA 1CWEA 2PLEA 1GHUA 1O42A 3S8NA 1KC2A 2HDXA 1O4RA 4GL9E 4JGHA 1O49A 1GRIA 5BO4A 2PLDA 5HKWA 1Z3KA 5IBMA 2HDVA 1MILA 3VS3A 2JYQA 3PQZA 3EAZA 1A1AA 4GPLB 3S8OA 4OHLA 2H8HA 1HCSB 3UF4A 5I6VA 1CSYA 1O4HA 1CWDL 3HCKA 1A07A 2IUHA 3BUXB 1X6CA 4TZIA 1O4OA 2HMHA 1NZLA 1A1EA 2C0TA 2IUIA 1SPSA 3BUNB 2CR4A 1H9OA 4U17A 1RJAA 1NRVA 4GWFA 1O4KA 4JEGA 2CIAA 1IS0A 3GQIB 1TZEE 4H1OA 3VRPA 2PNBA 3PJPA 1X0NA 1SPRA 1PICA 1AOUF 1IJRA 1G83A 3VRQA 1BM2A 1AYDA 1OPKA 4E68A 1KA6A 1R1PA 2OZOA 1FU5A 1LKLA 2MQIA 2ETZA 1F2FA 1XA6A 4FL2A 3CXLA 4NWGA 5DC9A 2IUGA 4K2RA 4OHIA 2LQWA 3TL0A 2Y1NA 5D0JA 1O4MA 5EEQA 2C9WA 2DLYA 3PFVA 5DF6A 1OPLA 3TKZA 2FCIA 1BKMA 1JYUA 1FBZA 1O4AA 1BG1A 1LUIA 2AUGA 2DM0A 3MXYA 3PSJA 2C0IA 2XP1A 1LUMA 4OHEA 2CS0A 2MK2A 3T04A 3IN7A 1LUKA 3PSKA 4DGPA 1D1ZA 1F1WA 1LKKA 3KFJA 1BHFA 2GE9A 2EU0A 3GXWA 1M27A 4F59A 1BF5A 3BUOB 1X27A 4P9ZA 2RSYA 3PLFB 3VS2A 4DGXA 4EY0A 1D4TA 4M4ZA 4LUDA 5EG3B 1O41A 3VRYA 3OVEA 3IMJA 5KAZA 1AD5A 1O4NA 3OB2B 1OO4A 2SRCA 2L4KA 4ROJA 4FBNA 1AYCA 3VS7A 1RPYA 1RQQC 2SHPA 1LUNA 2RORA 5EELA 2GSBA 1SHDA 4D8KA 3MAZA 2EYZA 3C7IA 2PNAA 4LUEA 5DC4A 3CD3A 3PS5A 1K9AA 4E93A 2EO6A 4K44A 3BUMB 4FL3A 1O48A 1O4EA 1A1CA 2HCKA 2OQ1A 2KNOA 1SHAA 1A1BA 1O4CA 3OV1A 3VRNA 3IMDA 3VGOA 2EYVA 2AOBA 1BLJA 4L1BB 3VRZA 1QADA 1KA7A 2CRHA 2Y3AB 2C0OA 3OB1B 4F5BA 1WQUA 4H34A 1AYAA 1Y57A 5HKYA 2KK6A 3BUWB 3NHNA 5GJIA 1D4WA 2HUWA 5IBSA 3VS5A 3EACA 1KSWA 1BMBA 1BHHB 1BLKA 3N84A 3VRRA 1O4DA 1TCEA 1JYQA 5HKZA 2EKXA 4NWFA 3M7FA 5AULA 1Y1UA 3QWYA 2QMSA 5AXIA 2LQNA 1I3ZA 5EHPA 1JU5A 3N8MA 2DCRA 1O4BA 1FHSA 1CSZA 3OP0A 4XZ1A 1P13A
chains in the Genus database with same CATH superfamily
2CI8A 4QSYA 1O43A 2VIFA 4WWQA 3HHMB 5CDWA 2EL8A 1O45A 2DX0A 1AB2A 1BFIA 1O46A 4XZ0A 4F5AA 2EYYA 1O4FA 3VS1A 4K11A 3HIZB 1FU6A 2FO0A 1BFJA 1UUSA 2RVFA 2ECDA 2CI9A 3IN8A 3CBLA 1LCKA 1O4JA 4A4CA 2YSXA 3BKBA 1M61A 1SHBA 2BBUA 3VROA 5J3XA 1HCTB 1AYBA 1BHHA 2IZVA 4X6SA 1O44A 1NZVA 2H46E 2YU7A 1QG1E 2H5KA 2PTKA 5GJHA 4OHDA 1YVLA 2LNWA 3K2MA 2MRKA 1FBVA 1O4IA 1R1QA 2L6KA 3N7YA 2DVJA 3CWGA 3US4A 1A08A 2MC1A 3MXCA 4JE4A 3VS0A 1A81A 1R1SA 2RMXA 3VS6A 2LRAA 2EOBA 1AOTF 2K79B 2DLZA 2CBLA 1ZFPE 1FMKA 2LNXA 2B3OA 1QCFA 1CJ1A 2ABLA 4U1PA 1MW4A 5EHRA 4OHHA 5DC0B 3VS4A 1BKLA 3ZNIA 1FYRA 4K45A 2MRJA 4A4BA 4EIHA 1O47A 1SKJA 2AOAA 1O4LA 1O4GA 2L3TA 1JYRA 3UYOA 3WA4A 3GXXA 1OO3A 1UURA 1O4QA 1JWOA 2Y1MA 3S9KA 2EO3A 4P9VA 1A09A 2LCTA 1YVHA 2K7AB 3S8LA 3QWXX 1O4PA 1B47A 1LCJA 1CWEA 2PLEA 1GHUA 1O42A 3S8NA 1KC2A 2HDXA 1O4RA 4GL9E 4JGHA 1O49A 1GRIA 5BO4A 2PLDA 5HKWA 1Z3KA 5IBMA 2HDVA 1MILA 3VS3A 2JYQA 3PQZA 3EAZA 1A1AA 4GPLB 3S8OA 4OHLA 2H8HA 1HCSB 3UF4A 5I6VA 1CSYA 1O4HA 1CWDL 3HCKA 1A07A 2IUHA 3BUXB 1X6CA 4TZIA 1O4OA 2HMHA 1NZLA 1A1EA 2C0TA 2IUIA 1SPSA 3BUNB 2CR4A 1H9OA 4U17A 1RJAA 1NRVA 4GWFA 1O4KA 4JEGA 2CIAA 1IS0A 3GQIB 1TZEE 4H1OA 3VRPA 2PNBA 3PJPA 1X0NA 1SPRA 1PICA 1AOUF 1IJRA 1G83A 3VRQA 1BM2A 1AYDA 1OPKA 4E68A 1KA6A 3K2TA 1R1PA 2OZOA 1FU5A 1LKLA 2MQIA 2ETZA 1F2FA 1XA6A 4FL2A 3CXLA 4NWGA 5DC9A 2IUGA 4K2RA 4OHIA 2LQWA 3TL0A 2Y1NA 5D0JA 1O4MA 5EEQA 2C9WA 2DLYA 3PFVA 5DF6A 1OPLA 3TKZA 2FCIA 1BKMA 1JYUA 1FBZA 1O4AA 1BG1A 1LUIA 2AUGA 2DM0A 3MXYA 3PSJA 2C0IA 2XP1A 1LUMA 4OHEA 2CS0A 2MK2A 3T04A 3IN7A 1LUKA 3PSKA 4DGPA 1D1ZA 1F1WA 1LKKA 3KFJA 1BHFA 2GE9A 2EU0A 3GXWA 1M27A 4F59A 1BF5A 3BUOB 1X27A 4P9ZA 2RSYA 3PLFB 3VS2A 4DGXA 4EY0A 1D4TA 4M4ZA 4LUDA 5EG3B 1O41A 3VRYA 3OVEA 3IMJA 5KAZA 1AD5A 1O4NA 3OB2B 1OO4A 2SRCA 2L4KA 4ROJA 4FBNA 1AYCA 3VS7A 1RPYA 1RQQC 2SHPA 1LUNA 2RORA 5EELA 2GSBA 1SHDA 4D8KA 3MAZA 2EYZA 3C7IA 2PNAA 4LUEA 5DC4A 3CD3A 3PS5A 1K9AA 4E93A 2EO6A 4K44A 3BUMB 4FL3A 1O48A 1O4EA 1A1CA 2HCKA 2OQ1A 2KNOA 1SHAA 1A1BA 1O4CA 3OV1A 3VRNA 3IMDA 3VGOA 2EYVA 2AOBA 1BLJA 4L1BB 3VRZA 1QADA 1KA7A 2CRHA 2Y3AB 2C0OA 3OB1B 4F5BA 1WQUA 3LYVA 4H34A 1AYAA 1Y57A 5HKYA 2KK6A 3BUWB 3NHNA 5GJIA 1D4WA 2HUWA 5IBSA 3VS5A 3EACA 1KSWA 1BMBA 1BHHB 1BLKA 3N84A 3VRRA 1O4DA 1TCEA 1JYQA 5HKZA 2EKXA 4NWFA 3M7FA 5AULA 1Y1UA 3QWYA 2QMSA 5AXIA 2LQNA 1I3ZA 5EHPA 1JU5A 3N8MA 2KGYA 2DCRA 1O4BA 1FHSA 1CSZA 3OP0A 4XZ1A 1P13A
chains in the Genus database with same CATH topology
2CI8A 4QSYA 1O43A 2VIFA 4WWQA 3HHMB 5CDWA 2EL8A 1O45A 2DX0A 1AB2A 1BFIA 1O46A 4XZ0A 4F5AA 2EYYA 1O4FA 3VS1A 4K11A 3HIZB 1FU6A 2FO0A 1BFJA 1UUSA 2RVFA 2ECDA 2CI9A 3IN8A 3CBLA 1LCKA 1O4JA 4A4CA 2YSXA 3BKBA 1M61A 1SHBA 2BBUA 3VROA 5J3XA 1HCTB 1AYBA 1BHHA 2IZVA 4X6SA 1O44A 1NZVA 2H46E 2YU7A 1QG1E 2H5KA 2PTKA 5GJHA 4OHDA 1YVLA 2LNWA 3K2MA 2MRKA 1FBVA 1O4IA 1R1QA 2L6KA 3N7YA 2DVJA 3CWGA 3US4A 1A08A 2MC1A 3MXCA 4JE4A 3VS0A 1A81A 1R1SA 2RMXA 3VS6A 2EOBA 1AOTF 2K79B 2DLZA 2CBLA 1ZFPE 1FMKA 2LNXA 2B3OA 1QCFA 1CJ1A 2ABLA 4U1PA 1MW4A 5EHRA 4OHHA 5DC0B 3VS4A 1BKLA 3ZNIA 1FYRA 4K45A 2MRJA 4A4BA 4EIHA 1O47A 1SKJA 2AOAA 1O4LA 1O4GA 2L3TA 1JYRA 3UYOA 3WA4A 3GXXA 1OO3A 1UURA 1O4QA 1JWOA 2Y1MA 3S9KA 2EO3A 4P9VA 1A09A 2LCTA 1YVHA 2K7AB 3S8LA 3QWXX 1O4PA 1B47A 1LCJA 1CWEA 2PLEA 1GHUA 1O42A 3S8NA 1KC2A 2HDXA 1O4RA 4GL9E 4JGHA 1O49A 1GRIA 5BO4A 2PLDA 5HKWA 1Z3KA 5IBMA 2HDVA 1MILA 3VS3A 2JYQA 3PQZA 3EAZA 1A1AA 4GPLB 3S8OA 4OHLA 2H8HA 1HCSB 3UF4A 5I6VA 1CSYA 1O4HA 1CWDL 3HCKA 1A07A 2IUHA 3BUXB 1X6CA 4TZIA 1O4OA 2HMHA 1NZLA 1A1EA 2C0TA 2IUIA 1SPSA 3BUNB 2CR4A 1H9OA 4U17A 1RJAA 1NRVA 4GWFA 1O4KA 4JEGA 2CIAA 1IS0A 3GQIB 1TZEE 4H1OA 3VRPA 2PNBA 3PJPA 1X0NA 1SPRA 1PICA 1AOUF 1IJRA 1G83A 3VRQA 1BM2A 1AYDA 1OPKA 4E68A 1KA6A 1R1PA 2OZOA 1FU5A 1LKLA 2MQIA 2ETZA 1F2FA 1XA6A 4FL2A 3CXLA 4NWGA 5DC9A 2IUGA 4K2RA 4OHIA 2LQWA 3TL0A 2Y1NA 5D0JA 1O4MA 5EEQA 2C9WA 2DLYA 3PFVA 5DF6A 1OPLA 3TKZA 2FCIA 1BKMA 1JYUA 1FBZA 1O4AA 1BG1A 1LUIA 2AUGA 2DM0A 3MXYA 3PSJA 2C0IA 2XP1A 1LUMA 4OHEA 2CS0A 2MK2A 3T04A 3IN7A 1LUKA 3PSKA 4DGPA 1D1ZA 1F1WA 1LKKA 3KFJA 1BHFA 2GE9A 2EU0A 3GXWA 1M27A 4F59A 1BF5A 3BUOB 1X27A 4P9ZA 2RSYA 3PLFB 3VS2A 4DGXA 4EY0A 1D4TA 4M4ZA 4LUDA 5EG3B 1O41A 3VRYA 3OVEA 3IMJA 5KAZA 1AD5A 1O4NA 3OB2B 1OO4A 2SRCA 2L4KA 4ROJA 4FBNA 1AYCA 3VS7A 1RPYA 1RQQC 2SHPA 1LUNA 2RORA 5EELA 2GSBA 1SHDA 4D8KA 3MAZA 2EYZA 3C7IA 2PNAA 4LUEA 5DC4A 3CD3A 3PS5A 1K9AA 4E93A 2EO6A 4K44A 3BUMB 4FL3A 1O48A 1O4EA 1A1CA 2HCKA 2OQ1A 2KNOA 1SHAA 1A1BA 1O4CA 3OV1A 3VRNA 3IMDA 3VGOA 2EYVA 2AOBA 1BLJA 4L1BB 3VRZA 1QADA 1KA7A 2CRHA 2Y3AB 2C0OA 3OB1B 4F5BA 1WQUA 4H34A 1AYAA 1Y57A 5HKYA 2KK6A 3BUWB 3NHNA 5GJIA 1D4WA 2HUWA 5IBSA 3VS5A 3EACA 1KSWA 1BMBA 1BHHB 1BLKA 3N84A 3VRRA 1O4DA 1TCEA 1JYQA 5HKZA 2EKXA 4NWFA 3M7FA 5AULA 1Y1UA 3QWYA 2QMSA 5AXIA 2LQNA 1I3ZA 5EHPA 1JU5A 3N8MA 2DCRA 1O4BA 1FHSA 1CSZA 3OP0A 4XZ1A 1P13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CI8 A;  4QSY A;  1O43 A;  2VIF A;  4WWQ A;  3HHM B;  5CDW A;  2EL8 A;  1O45 A;  2DX0 A;  1AB2 A;  1BFI A;  1O46 A;  4XZ0 A;  4F5A A;  2EYY A;  1O4F A;  3VS1 A;  4K11 A;  3HIZ B;  1FU6 A;  2FO0 A;  1BFJ A;  1UUS A;  2RVF A;  2ECD A;  2CI9 A;  3IN8 A;  3CBL A;  1LCK A;  1O4J A;  4A4C A;  2YSX A;  3BKB A;  1M61 A;  1SHB A;  2BBU A;  3VRO A;  5J3X A;  1HCT B;  1AYB A;  1BHH A;  2IZV A;  4X6S A;  1O44 A;  1NZV A;  2H46 E;  2YU7 A;  1QG1 E;  2H5K A;  2PTK A;  5GJH A;  4OHD A;  1YVL A;  2LNW A;  3K2M A;  2MRK A;  1FBV A;  1O4I A;  1R1Q A;  2L6K A;  3N7Y A;  2DVJ A;  3CWG A;  3US4 A;  1A08 A;  2MC1 A;  3MXC A;  4JE4 A;  3VS0 A;  1A81 A;  1R1S A;  2RMX A;  3VS6 A;  2EOB A;  1AOT F;  2K79 B;  2DLZ A;  2CBL A;  1ZFP E;  1FMK A;  2LNX A;  2B3O A;  1QCF A;  1CJ1 A;  2ABL A;  4U1P A;  1MW4 A;  5EHR A;  4OHH A;  5DC0 B;  3VS4 A;  1BKL A;  3ZNI A;  1FYR A;  4K45 A;  2MRJ A;  4A4B A;  4EIH A;  1O47 A;  1SKJ A;  2AOA A;  1O4L A;  1O4G A;  2L3T A;  1JYR A;  3UYO A;  3WA4 A;  3GXX A;  1OO3 A;  1UUR A;  1O4Q A;  1JWO A;  2Y1M A;  3S9K A;  2EO3 A;  4P9V A;  1A09 A;  2LCT A;  1YVH A;  2K7A B;  3S8L A;  3QWX X;  1O4P A;  1B47 A;  1LCJ A;  1CWE A;  2PLE A;  1GHU A;  1O42 A;  3S8N A;  1KC2 A;  2HDX A;  1O4R A;  4GL9 E;  4JGH A;  1O49 A;  1GRI A;  5BO4 A;  2PLD A;  5HKW A;  1Z3K A;  5IBM A;  2HDV A;  1MIL A;  3VS3 A;  2JYQ A;  3PQZ A;  3EAZ A;  1A1A A;  4GPL B;  3S8O A;  4OHL A;  2H8H A;  1HCS B;  3UF4 A;  5I6V A;  1CSY A;  1O4H A;  1CWD L;  3HCK A;  1A07 A;  2IUH A;  3BUX B;  1X6C A;  4TZI A;  1O4O A;  2HMH A;  1NZL A;  1A1E A;  2C0T A;  2IUI A;  1SPS A;  3BUN B;  2CR4 A;  1H9O A;  4U17 A;  1RJA A;  1NRV A;  4GWF A;  1O4K A;  4JEG A;  2CIA A;  1IS0 A;  3GQI B;  1TZE E;  4H1O A;  3VRP A;  2PNB A;  3PJP A;  1X0N A;  1SPR A;  1PIC A;  1AOU F;  1IJR A;  1G83 A;  3VRQ A;  1BM2 A;  1AYD A;  1OPK A;  4E68 A;  1KA6 A;  1R1P A;  2OZO A;  1FU5 A;  1LKL A;  2MQI A;  2ETZ A;  1F2F A;  1XA6 A;  4FL2 A;  3CXL A;  4NWG A;  5DC9 A;  2IUG A;  4K2R A;  4OHI A;  2LQW A;  3TL0 A;  2Y1N A;  5D0J A;  1O4M A;  5EEQ A;  2C9W A;  2DLY A;  3PFV A;  5DF6 A;  1OPL A;  3TKZ A;  2FCI A;  1BKM A;  1JYU A;  1FBZ A;  1O4A A;  1BG1 A;  1LUI A;  2AUG A;  2DM0 A;  3MXY A;  3PSJ A;  2C0I A;  2XP1 A;  1LUM A;  4OHE A;  2CS0 A;  2MK2 A;  3T04 A;  3IN7 A;  1LUK A;  3PSK A;  4DGP A;  1D1Z A;  1F1W A;  1LKK A;  3KFJ A;  1BHF A;  2GE9 A;  2EU0 A;  3GXW A;  1M27 A;  4F59 A;  1BF5 A;  3BUO B;  1X27 A;  4P9Z A;  2RSY A;  3PLF B;  3VS2 A;  4DGX A;  4EY0 A;  1D4T A;  4M4Z A;  4LUD A;  5EG3 B;  1O41 A;  3VRY A;  3OVE A;  3IMJ A;  5KAZ A;  1AD5 A;  1O4N A;  3OB2 B;  1OO4 A;  2SRC A;  2L4K A;  4ROJ A;  4FBN A;  1AYC A;  3VS7 A;  1RPY A;  1RQQ C;  2SHP A;  1LUN A;  2ROR A;  5EEL A;  2GSB A;  1SHD A;  4D8K A;  3MAZ A;  2EYZ A;  3C7I A;  2PNA A;  4LUE A;  5DC4 A;  3CD3 A;  3PS5 A;  1K9A A;  4E93 A;  2EO6 A;  4K44 A;  3BUM B;  4FL3 A;  1O48 A;  1O4E A;  1A1C A;  2HCK A;  2OQ1 A;  2KNO A;  1SHA A;  1A1B A;  1O4C A;  3OV1 A;  3VRN A;  3IMD A;  3VGO A;  2EYV A;  2AOB A;  1BLJ A;  4L1B B;  3VRZ A;  1QAD A;  1KA7 A;  2CRH A;  2Y3A B;  2C0O A;  3OB1 B;  4F5B A;  1WQU A;  4H34 A;  1AYA A;  1Y57 A;  5HKY A;  2KK6 A;  3BUW B;  3NHN A;  5GJI A;  1D4W A;  2HUW A;  5IBS A;  3VS5 A;  3EAC A;  1KSW A;  1BMB A;  1BHH B;  1BLK A;  3N84 A;  3VRR A;  1O4D A;  1TCE A;  1JYQ A;  5HKZ A;  2EKX A;  4NWF A;  3M7F A;  5AUL A;  1Y1U A;  3QWY A;  2QMS A;  5AXI A;  2LQN A;  1I3Z A;  5EHP A;  1JU5 A;  3N8M A;  2DCR A;  1O4B A;  1FHS A;  1CSZ A;  3OP0 A;  4XZ1 A;  1P13 A; 
#chains in the Genus database with same CATH topology
 2CI8 A;  4QSY A;  1O43 A;  2VIF A;  4WWQ A;  3HHM B;  5CDW A;  2EL8 A;  1O45 A;  2DX0 A;  1AB2 A;  1BFI A;  1O46 A;  4XZ0 A;  4F5A A;  2EYY A;  1O4F A;  3VS1 A;  4K11 A;  3HIZ B;  1FU6 A;  2FO0 A;  1BFJ A;  1UUS A;  2RVF A;  2ECD A;  2CI9 A;  3IN8 A;  3CBL A;  1LCK A;  1O4J A;  4A4C A;  2YSX A;  3BKB A;  1M61 A;  1SHB A;  2BBU A;  3VRO A;  5J3X A;  1HCT B;  1AYB A;  1BHH A;  2IZV A;  4X6S A;  1O44 A;  1NZV A;  2H46 E;  2YU7 A;  1QG1 E;  2H5K A;  2PTK A;  5GJH A;  4OHD A;  1YVL A;  2LNW A;  3K2M A;  2MRK A;  1FBV A;  1O4I A;  1R1Q A;  2L6K A;  3N7Y A;  2DVJ A;  3CWG A;  3US4 A;  1A08 A;  2MC1 A;  3MXC A;  4JE4 A;  3VS0 A;  1A81 A;  1R1S A;  2RMX A;  3VS6 A;  2LRA A;  2EOB A;  1AOT F;  2K79 B;  2DLZ A;  2CBL A;  1ZFP E;  1FMK A;  2LNX A;  2B3O A;  1QCF A;  1CJ1 A;  2ABL A;  4U1P A;  1MW4 A;  5EHR A;  4OHH A;  5DC0 B;  3VS4 A;  1BKL A;  3ZNI A;  1FYR A;  4K45 A;  2MRJ A;  4A4B A;  4EIH A;  1O47 A;  1SKJ A;  2AOA A;  1O4L A;  1O4G A;  2L3T A;  1JYR A;  3UYO A;  3WA4 A;  3GXX A;  1OO3 A;  1UUR A;  1O4Q A;  1JWO A;  2Y1M A;  3S9K A;  2EO3 A;  4P9V A;  1A09 A;  2LCT A;  1YVH A;  2K7A B;  3S8L A;  3QWX X;  1O4P A;  1B47 A;  1LCJ A;  1CWE A;  2PLE A;  1GHU A;  1O42 A;  3S8N A;  1KC2 A;  2HDX A;  1O4R A;  4GL9 E;  4JGH A;  1O49 A;  1GRI A;  5BO4 A;  2PLD A;  5HKW A;  1Z3K A;  5IBM A;  2HDV A;  1MIL A;  3VS3 A;  2JYQ A;  3PQZ A;  3EAZ A;  1A1A A;  4GPL B;  3S8O A;  4OHL A;  2H8H A;  1HCS B;  3UF4 A;  5I6V A;  1CSY A;  1O4H A;  1CWD L;  3HCK A;  1A07 A;  2IUH A;  3BUX B;  1X6C A;  4TZI A;  1O4O A;  2HMH A;  1NZL A;  1A1E A;  2C0T A;  2IUI A;  1SPS A;  3BUN B;  2CR4 A;  1H9O A;  4U17 A;  1RJA A;  1NRV A;  4GWF A;  1O4K A;  4JEG A;  2CIA A;  1IS0 A;  3GQI B;  1TZE E;  4H1O A;  3VRP A;  2PNB A;  3PJP A;  1X0N A;  1SPR A;  1PIC A;  1AOU F;  1IJR A;  1G83 A;  3VRQ A;  1BM2 A;  1AYD A;  1OPK A;  4E68 A;  1KA6 A;  3K2T A;  1R1P A;  2OZO A;  1FU5 A;  1LKL A;  2MQI A;  2ETZ A;  1F2F A;  1XA6 A;  4FL2 A;  3CXL A;  4NWG A;  5DC9 A;  2IUG A;  4K2R A;  4OHI A;  2LQW A;  3TL0 A;  2Y1N A;  5D0J A;  1O4M A;  5EEQ A;  2C9W A;  2DLY A;  3PFV A;  5DF6 A;  1OPL A;  3TKZ A;  2FCI A;  1BKM A;  1JYU A;  1FBZ A;  1O4A A;  1BG1 A;  1LUI A;  2AUG A;  2DM0 A;  3MXY A;  3PSJ A;  2C0I A;  2XP1 A;  1LUM A;  4OHE A;  2CS0 A;  2MK2 A;  3T04 A;  3IN7 A;  1LUK A;  3PSK A;  4DGP A;  1D1Z A;  1F1W A;  1LKK A;  3KFJ A;  1BHF A;  2GE9 A;  2EU0 A;  3GXW A;  1M27 A;  4F59 A;  1BF5 A;  3BUO B;  1X27 A;  4P9Z A;  2RSY A;  3PLF B;  3VS2 A;  4DGX A;  4EY0 A;  1D4T A;  4M4Z A;  4LUD A;  5EG3 B;  1O41 A;  3VRY A;  3OVE A;  3IMJ A;  5KAZ A;  1AD5 A;  1O4N A;  3OB2 B;  1OO4 A;  2SRC A;  2L4K A;  4ROJ A;  4FBN A;  1AYC A;  3VS7 A;  1RPY A;  1RQQ C;  2SHP A;  1LUN A;  2ROR A;  5EEL A;  2GSB A;  1SHD A;  4D8K A;  3MAZ A;  2EYZ A;  3C7I A;  2PNA A;  4LUE A;  5DC4 A;  3CD3 A;  3PS5 A;  1K9A A;  4E93 A;  2EO6 A;  4K44 A;  3BUM B;  4FL3 A;  1O48 A;  1O4E A;  1A1C A;  2HCK A;  2OQ1 A;  2KNO A;  1SHA A;  1A1B A;  1O4C A;  3OV1 A;  3VRN A;  3IMD A;  3VGO A;  2EYV A;  2AOB A;  1BLJ A;  4L1B B;  3VRZ A;  1QAD A;  1KA7 A;  2CRH A;  2Y3A B;  2C0O A;  3OB1 B;  4F5B A;  1WQU A;  3LYV A;  4H34 A;  1AYA A;  1Y57 A;  5HKY A;  2KK6 A;  3BUW B;  3NHN A;  5GJI A;  1D4W A;  2HUW A;  5IBS A;  3VS5 A;  3EAC A;  1KSW A;  1BMB A;  1BHH B;  1BLK A;  3N84 A;  3VRR A;  1O4D A;  1TCE A;  1JYQ A;  5HKZ A;  2EKX A;  4NWF A;  3M7F A;  5AUL A;  1Y1U A;  3QWY A;  2QMS A;  5AXI A;  2LQN A;  1I3Z A;  5EHP A;  1JU5 A;  3N8M A;  2KGY A;  2DCR A;  1O4B A;  1FHS A;  1CSZ A;  3OP0 A;  4XZ1 A;  1P13 A; 
#chains in the Genus database with same CATH homology
 2CI8 A;  4QSY A;  1O43 A;  2VIF A;  4WWQ A;  3HHM B;  5CDW A;  2EL8 A;  1O45 A;  2DX0 A;  1AB2 A;  1BFI A;  1O46 A;  4XZ0 A;  4F5A A;  2EYY A;  1O4F A;  3VS1 A;  4K11 A;  3HIZ B;  1FU6 A;  2FO0 A;  1BFJ A;  1UUS A;  2RVF A;  2ECD A;  2CI9 A;  3IN8 A;  3CBL A;  1LCK A;  1O4J A;  4A4C A;  2YSX A;  3BKB A;  1M61 A;  1SHB A;  2BBU A;  3VRO A;  5J3X A;  1HCT B;  1AYB A;  1BHH A;  2IZV A;  4X6S A;  1O44 A;  1NZV A;  2H46 E;  2YU7 A;  1QG1 E;  2H5K A;  2PTK A;  5GJH A;  4OHD A;  1YVL A;  2LNW A;  3K2M A;  2MRK A;  1FBV A;  1O4I A;  1R1Q A;  2L6K A;  3N7Y A;  2DVJ A;  3CWG A;  3US4 A;  1A08 A;  2MC1 A;  3MXC A;  4JE4 A;  3VS0 A;  1A81 A;  1R1S A;  2RMX A;  3VS6 A;  2EOB A;  1AOT F;  2K79 B;  2DLZ A;  2CBL A;  1ZFP E;  1FMK A;  2LNX A;  2B3O A;  1QCF A;  1CJ1 A;  2ABL A;  4U1P A;  1MW4 A;  5EHR A;  4OHH A;  5DC0 B;  3VS4 A;  1BKL A;  3ZNI A;  1FYR A;  4K45 A;  2MRJ A;  4A4B A;  4EIH A;  1O47 A;  1SKJ A;  2AOA A;  1O4L A;  1O4G A;  2L3T A;  1JYR A;  3UYO A;  3WA4 A;  3GXX A;  1OO3 A;  1UUR A;  1O4Q A;  1JWO A;  2Y1M A;  3S9K A;  2EO3 A;  4P9V A;  1A09 A;  2LCT A;  1YVH A;  2K7A B;  3S8L A;  3QWX X;  1O4P A;  1B47 A;  1LCJ A;  1CWE A;  2PLE A;  1GHU A;  1O42 A;  3S8N A;  1KC2 A;  2HDX A;  1O4R A;  4GL9 E;  4JGH A;  1O49 A;  1GRI A;  5BO4 A;  2PLD A;  5HKW A;  1Z3K A;  5IBM A;  2HDV A;  1MIL A;  3VS3 A;  2JYQ A;  3PQZ A;  3EAZ A;  1A1A A;  4GPL B;  3S8O A;  4OHL A;  2H8H A;  1HCS B;  3UF4 A;  5I6V A;  1CSY A;  1O4H A;  1CWD L;  3HCK A;  1A07 A;  2IUH A;  3BUX B;  1X6C A;  4TZI A;  1O4O A;  2HMH A;  1NZL A;  1A1E A;  2C0T A;  2IUI A;  1SPS A;  3BUN B;  2CR4 A;  1H9O A;  4U17 A;  1RJA A;  1NRV A;  4GWF A;  1O4K A;  4JEG A;  2CIA A;  1IS0 A;  3GQI B;  1TZE E;  4H1O A;  3VRP A;  2PNB A;  3PJP A;  1X0N A;  1SPR A;  1PIC A;  1AOU F;  1IJR A;  1G83 A;  3VRQ A;  1BM2 A;  1AYD A;  1OPK A;  4E68 A;  1KA6 A;  1R1P A;  2OZO A;  1FU5 A;  1LKL A;  2MQI A;  2ETZ A;  1F2F A;  1XA6 A;  4FL2 A;  3CXL A;  4NWG A;  5DC9 A;  2IUG A;  4K2R A;  4OHI A;  2LQW A;  3TL0 A;  2Y1N A;  5D0J A;  1O4M A;  5EEQ A;  2C9W A;  2DLY A;  3PFV A;  5DF6 A;  1OPL A;  3TKZ A;  2FCI A;  1BKM A;  1JYU A;  1FBZ A;  1O4A A;  1BG1 A;  1LUI A;  2AUG A;  2DM0 A;  3MXY A;  3PSJ A;  2C0I A;  2XP1 A;  1LUM A;  4OHE A;  2CS0 A;  2MK2 A;  3T04 A;  3IN7 A;  1LUK A;  3PSK A;  4DGP A;  1D1Z A;  1F1W A;  1LKK A;  3KFJ A;  1BHF A;  2GE9 A;  2EU0 A;  3GXW A;  1M27 A;  4F59 A;  1BF5 A;  3BUO B;  1X27 A;  4P9Z A;  2RSY A;  3PLF B;  3VS2 A;  4DGX A;  4EY0 A;  1D4T A;  4M4Z A;  4LUD A;  5EG3 B;  1O41 A;  3VRY A;  3OVE A;  3IMJ A;  5KAZ A;  1AD5 A;  1O4N A;  3OB2 B;  1OO4 A;  2SRC A;  2L4K A;  4ROJ A;  4FBN A;  1AYC A;  3VS7 A;  1RPY A;  1RQQ C;  2SHP A;  1LUN A;  2ROR A;  5EEL A;  2GSB A;  1SHD A;  4D8K A;  3MAZ A;  2EYZ A;  3C7I A;  2PNA A;  4LUE A;  5DC4 A;  3CD3 A;  3PS5 A;  1K9A A;  4E93 A;  2EO6 A;  4K44 A;  3BUM B;  4FL3 A;  1O48 A;  1O4E A;  1A1C A;  2HCK A;  2OQ1 A;  2KNO A;  1SHA A;  1A1B A;  1O4C A;  3OV1 A;  3VRN A;  3IMD A;  3VGO A;  2EYV A;  2AOB A;  1BLJ A;  4L1B B;  3VRZ A;  1QAD A;  1KA7 A;  2CRH A;  2Y3A B;  2C0O A;  3OB1 B;  4F5B A;  1WQU A;  4H34 A;  1AYA A;  1Y57 A;  5HKY A;  2KK6 A;  3BUW B;  3NHN A;  5GJI A;  1D4W A;  2HUW A;  5IBS A;  3VS5 A;  3EAC A;  1KSW A;  1BMB A;  1BHH B;  1BLK A;  3N84 A;  3VRR A;  1O4D A;  1TCE A;  1JYQ A;  5HKZ A;  2EKX A;  4NWF A;  3M7F A;  5AUL A;  1Y1U A;  3QWY A;  2QMS A;  5AXI A;  2LQN A;  1I3Z A;  5EHP A;  1JU5 A;  3N8M A;  2DCR A;  1O4B A;  1FHS A;  1CSZ A;  3OP0 A;  4XZ1 A;  1P13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...