1RQQC

Crystal structure of the insulin receptor kinase in complex with the sh2 domain of aps
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
85
structure length
83
Chain Sequence
b'LELSDYPWFHGTLSRVKAAQLVLAGGPRSHGLFVIRQSETRPGECVLTFNFQGKAKHLRLSLNGQCHVQHLWFQSVFDMLRHF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Insulin receptor
publication title Structural basis for recruitment of the adaptor protein APS to the activated insulin receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
total genus 26
structure length 83
sequence length 85
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1rqqC00
2LQNA 3BUXB 1LCKA 4K45A 2KK6A 4XZ1A 2IUGA 3GXXA 4JE4A 2CS0A 3EACA 1UUSA 5GJHA 4X6SA 1SHBA 2ETZA 1KC2A 4F5AA 1TCEA 1F2FA 1G83A 2DM0A 1A08A 1O45A 1LKLA 3PSKA 3IMDA 1A07A 2CR4A 1O46A 3EAZA 1O4MA 3PS5A 3OP0A 1Y1UA 5CDWA 1P13A 1NZLA 1X27A 2YU7A 1A1BA 2CRHA 1HCSB 3US4A 1UURA 4D8KA 5EHPA 1AYDA 1JYRA 3IMJA 1LCJA 4OHLA 1A81A 1FBVA 1FU6A 3OB2B 3PFVA 1IS0A 1Z3KA 5EG3B 1O41A 1R1PA 1YVLA 4L1BB 1O4CA 2PNAA 1MILA 2ABLA 4K44A 3TL0A 3BUNB 1O4PA 2FO0A 3VS6A 1KA6A 3PLFB 3VRNA 2BBUA 1SPSA 1O4IA 3VROA 1BHHB 2HCKA 4JEGA 4U17A 3BUMB 5AULA 2PNBA 4XZ0A 3WA4A 3KFJA 1A1CA 4EIHA 1O4DA 2L6KA 2GE9A 5DF6A 2DCRA 1X0NA 2SHPA 3PSJA 5HKZA 4E68A 1AYBA 2MRKA 4H1OA 3VRPA 2RVFA 4P9VA 5D0JA 3VRRA 3K2MA 1F1WA 2HDXA 3N84A 1O44A 2CBLA 4FBNA 1OO4A 2K7AB 2RORA 1CWEA 1O49A 5HKWA 1QADA 2PTKA 1O4JA 1JWOA 4F5BA 1OPKA 3HHMB 3BKBA 1H9OA 1MW4A 1CWDL 4NWFA 4OHDA 2LNXA 1AYAA 1O4NA 4OHHA 2L3TA 2PLDA 1FMKA 1LUNA 2C0IA 4FL2A 1X6CA 1AYCA 3BUWB 1R1QA 3HIZB 3VS2A 2LNWA 4GWFA 1R1SA 4LUDA 1A09A 1OO3A 1KA7A 3N8MA 4TZIA 2GSBA 3PJPA 2OZOA 2AUGA 3UF4A 5J3XA 1BG1A 1YVHA 2AOBA 3QWXX 1BFIA 2EU0A 1FU5A 1B47A 3CBLA 3S8NA 4OHEA 4ROJA 1CJ1A 1BM2A 2C0OA 2VIFA 4LUEA 1RJAA 2AOAA 1KSWA 1O4KA 3PQZA 5DC9A 3VS5A 3IN8A 3OB1B 1LKKA 2H46E 3ZNIA 2MQIA 1WQUA 2KNOA 3CWGA 4P9ZA 1K9AA 1O48A 2YSXA 1BHHA 3CXLA 4H34A 1A1AA 1D4WA 4K11A 1FBZA 2K79B 1O47A 3OV1A 3VRQA 2LQWA 2CIAA 1LUKA 1XA6A 1O4BA 4EY0A 1SHAA 2H8HA 1Y57A 2B3OA 1RPYA 1JYUA 3VS4A 3S8OA 1FHSA 1BMBA 1BLKA 5IBSA 1QG1E 4NWGA 4M4ZA 1M61A 1ZFPE 2MRJA 1O43A 3NHNA 1BLJA 3S8LA 3VRYA 4E93A 1O4RA 2CI9A 4DGXA 1O4GA 2EO3A 5HKYA 2Y1NA 2DLYA 2EL8A 1AD5A 4A4CA 3MAZA 3VGOA 2MK2A 2ECDA 1O4AA 1I3ZA 5DC4A 1SHDA 4U1PA 5BO4A 1QCFA 2EOBA 4WWQA 1AOUF 2C9WA 3N7YA 3GQIB 2EO6A 3VS3A 2HUWA 1O4QA 1O4HA 1AOTF 1GRIA 5EHRA 1CSYA 2CI8A 1OPLA 2EKXA 2EYZA 2LCTA 1BHFA 2DVJA 2C0TA 1LUIA 2IUHA 2Y3AB 3VS7A 5KAZA 2RMXA 4A4BA 3VS0A 2MC1A 2DX0A 2HMHA 3IN7A 2H5KA 1D4TA 3T04A 4QSYA 4F59A 2EYYA 1BFJA 1O4EA 3MXCA 2OQ1A 4JGHA 1SKJA 1A1EA 2JYQA 2XP1A 4K2RA 4OHIA 5IBMA 1BKMA 1O4OA 5I6VA 1RQQC 1FYRA 3VS1A 5DC0B 1JYQA 1NZVA 1M27A 1O42A 2SRCA 1BF5A 3HCKA 2DLZA 1CSZA 2IZVA 4GL9E 3QWYA 2HDVA 3M7FA 3BUOB 1AB2A 4DGPA 1TZEE 3S9KA 1IJRA 1NRVA 1GHUA 4GPLB 1O4LA 2QMSA 2FCIA 5EEQA 3GXWA 5AXIA 2L4KA 1BKLA 4FL3A 3C7IA 5EELA 3VRZA 3MXYA 1SPRA 1PICA 1D1ZA 3CD3A 1HCTB 2RSYA 2EYVA 1LUMA 3OVEA 3UYOA 2IUIA 5GJIA 1JU5A 3TKZA 1O4FA 2PLEA 2Y1MA
chains in the Genus database with same CATH superfamily
2LQNA 3BUXB 1LCKA 4K45A 2KK6A 4XZ1A 2IUGA 3GXXA 4JE4A 2CS0A 3EACA 1UUSA 5GJHA 4X6SA 1SHBA 2ETZA 1KC2A 4F5AA 1TCEA 1F2FA 1G83A 2DM0A 1A08A 1O45A 1LKLA 3PSKA 3IMDA 1A07A 2CR4A 1O46A 3EAZA 1O4MA 3PS5A 3OP0A 1Y1UA 5CDWA 1P13A 1NZLA 1X27A 2YU7A 1A1BA 2CRHA 1HCSB 3US4A 1UURA 4D8KA 5EHPA 1AYDA 1JYRA 3IMJA 1LCJA 4OHLA 1A81A 1FBVA 1FU6A 3OB2B 3PFVA 1IS0A 1Z3KA 5EG3B 1O41A 1R1PA 1YVLA 4L1BB 1O4CA 2PNAA 1MILA 2ABLA 4K44A 3TL0A 3BUNB 1O4PA 2FO0A 3VS6A 1KA6A 3PLFB 3VRNA 2BBUA 1SPSA 1O4IA 3VROA 1BHHB 2HCKA 4JEGA 4U17A 3BUMB 2LRAA 5AULA 2PNBA 4XZ0A 3WA4A 3KFJA 1A1CA 4EIHA 1O4DA 2L6KA 2GE9A 5DF6A 2DCRA 1X0NA 2SHPA 3PSJA 5HKZA 4E68A 1AYBA 2MRKA 4H1OA 3VRPA 2RVFA 4P9VA 5D0JA 3VRRA 3K2MA 1F1WA 2HDXA 3N84A 1O44A 2CBLA 4FBNA 1OO4A 2K7AB 2RORA 1CWEA 1O49A 5HKWA 1QADA 2PTKA 2KGYA 1O4JA 1JWOA 4F5BA 1OPKA 3HHMB 3BKBA 1H9OA 1MW4A 1CWDL 4NWFA 4OHDA 2LNXA 1AYAA 1O4NA 4OHHA 2L3TA 2PLDA 1FMKA 1LUNA 2C0IA 4FL2A 1X6CA 1AYCA 3BUWB 1R1QA 3HIZB 3VS2A 2LNWA 4GWFA 1R1SA 4LUDA 1A09A 1OO3A 1KA7A 3LYVA 3N8MA 4TZIA 2GSBA 3PJPA 2OZOA 2AUGA 3UF4A 5J3XA 1BG1A 1YVHA 2AOBA 3QWXX 1BFIA 2EU0A 1FU5A 1B47A 3CBLA 3S8NA 4OHEA 4ROJA 1CJ1A 1BM2A 2C0OA 2VIFA 4LUEA 1RJAA 2AOAA 1KSWA 1O4KA 3PQZA 5DC9A 3VS5A 3IN8A 3OB1B 1LKKA 2H46E 3ZNIA 2MQIA 1WQUA 2KNOA 3CWGA 4P9ZA 1K9AA 1O48A 2YSXA 1BHHA 3CXLA 4H34A 1A1AA 1D4WA 4K11A 1FBZA 2K79B 1O47A 3OV1A 3VRQA 2LQWA 2CIAA 1LUKA 1XA6A 1O4BA 4EY0A 1SHAA 2H8HA 1Y57A 2B3OA 1RPYA 1JYUA 3VS4A 3S8OA 1FHSA 1BMBA 1BLKA 5IBSA 1QG1E 4NWGA 4M4ZA 1M61A 1ZFPE 2MRJA 1O43A 3NHNA 1BLJA 3S8LA 3VRYA 4E93A 1O4RA 2CI9A 4DGXA 1O4GA 2EO3A 5HKYA 2Y1NA 2DLYA 2EL8A 1AD5A 4A4CA 3MAZA 3VGOA 2MK2A 2ECDA 1O4AA 1I3ZA 5DC4A 1SHDA 4U1PA 5BO4A 1QCFA 2EOBA 4WWQA 1AOUF 2C9WA 3N7YA 3GQIB 2EO6A 3VS3A 2HUWA 1O4QA 1O4HA 1AOTF 1GRIA 5EHRA 1CSYA 2CI8A 1OPLA 2EKXA 2EYZA 2LCTA 1BHFA 2DVJA 2C0TA 1LUIA 2IUHA 2Y3AB 3VS7A 5KAZA 2RMXA 4A4BA 3VS0A 2MC1A 2DX0A 2HMHA 3IN7A 2H5KA 1D4TA 3T04A 4QSYA 4F59A 2EYYA 1BFJA 1O4EA 3MXCA 2OQ1A 4JGHA 1SKJA 1A1EA 2JYQA 2XP1A 4K2RA 4OHIA 5IBMA 1BKMA 1O4OA 5I6VA 1RQQC 1FYRA 3VS1A 5DC0B 1JYQA 1NZVA 1M27A 3K2TA 1O42A 2SRCA 1BF5A 3HCKA 2DLZA 1CSZA 2IZVA 4GL9E 3QWYA 2HDVA 3M7FA 3BUOB 1AB2A 4DGPA 1TZEE 3S9KA 1IJRA 1NRVA 1GHUA 4GPLB 1O4LA 2QMSA 2FCIA 5EEQA 3GXWA 5AXIA 2L4KA 1BKLA 4FL3A 3C7IA 5EELA 3VRZA 3MXYA 1SPRA 1PICA 1D1ZA 3CD3A 1HCTB 2RSYA 2EYVA 1LUMA 3OVEA 3UYOA 2IUIA 5GJIA 1JU5A 3TKZA 1O4FA 2PLEA 2Y1MA
chains in the Genus database with same CATH topology
2LQNA 3BUXB 1LCKA 4K45A 2KK6A 4XZ1A 2IUGA 3GXXA 4JE4A 2CS0A 3EACA 1UUSA 5GJHA 4X6SA 1SHBA 2ETZA 1KC2A 4F5AA 1TCEA 1F2FA 1G83A 2DM0A 1A08A 1O45A 1LKLA 3PSKA 3IMDA 1A07A 2CR4A 1O46A 3EAZA 1O4MA 3PS5A 3OP0A 1Y1UA 5CDWA 1P13A 1NZLA 1X27A 2YU7A 1A1BA 2CRHA 1HCSB 3US4A 1UURA 4D8KA 5EHPA 1AYDA 1JYRA 3IMJA 1LCJA 4OHLA 1A81A 1FBVA 1FU6A 3OB2B 3PFVA 1IS0A 1Z3KA 5EG3B 1O41A 1R1PA 1YVLA 4L1BB 1O4CA 2PNAA 1MILA 2ABLA 4K44A 3TL0A 3BUNB 1O4PA 2FO0A 3VS6A 1KA6A 3PLFB 3VRNA 2BBUA 1SPSA 1O4IA 3VROA 1BHHB 2HCKA 4JEGA 4U17A 3BUMB 5AULA 2PNBA 4XZ0A 3WA4A 3KFJA 1A1CA 4EIHA 1O4DA 2L6KA 2GE9A 5DF6A 2DCRA 1X0NA 2SHPA 3PSJA 5HKZA 4E68A 1AYBA 2MRKA 4H1OA 3VRPA 2RVFA 4P9VA 5D0JA 3VRRA 3K2MA 1F1WA 2HDXA 3N84A 1O44A 2CBLA 4FBNA 1OO4A 2K7AB 2RORA 1CWEA 1O49A 5HKWA 1QADA 2PTKA 1O4JA 1JWOA 4F5BA 1OPKA 3HHMB 3BKBA 1H9OA 1MW4A 1CWDL 4NWFA 4OHDA 2LNXA 1AYAA 1O4NA 4OHHA 2L3TA 2PLDA 1FMKA 1LUNA 2C0IA 4FL2A 1X6CA 1AYCA 3BUWB 1R1QA 3HIZB 3VS2A 2LNWA 4GWFA 1R1SA 4LUDA 1A09A 1OO3A 1KA7A 3N8MA 4TZIA 2GSBA 3PJPA 2OZOA 2AUGA 3UF4A 5J3XA 1BG1A 1YVHA 2AOBA 3QWXX 1BFIA 2EU0A 1FU5A 1B47A 3CBLA 3S8NA 4OHEA 4ROJA 1CJ1A 1BM2A 2C0OA 2VIFA 4LUEA 1RJAA 2AOAA 1KSWA 1O4KA 3PQZA 5DC9A 3VS5A 3IN8A 3OB1B 1LKKA 2H46E 3ZNIA 2MQIA 1WQUA 2KNOA 3CWGA 4P9ZA 1K9AA 1O48A 2YSXA 1BHHA 3CXLA 4H34A 1A1AA 1D4WA 4K11A 1FBZA 2K79B 1O47A 3OV1A 3VRQA 2LQWA 2CIAA 1LUKA 1XA6A 1O4BA 4EY0A 1SHAA 2H8HA 1Y57A 2B3OA 1RPYA 1JYUA 3VS4A 3S8OA 1FHSA 1BMBA 1BLKA 5IBSA 1QG1E 4NWGA 4M4ZA 1M61A 1ZFPE 2MRJA 1O43A 3NHNA 1BLJA 3S8LA 3VRYA 4E93A 1O4RA 2CI9A 4DGXA 1O4GA 2EO3A 5HKYA 2Y1NA 2DLYA 2EL8A 1AD5A 4A4CA 3MAZA 3VGOA 2MK2A 2ECDA 1O4AA 1I3ZA 5DC4A 1SHDA 4U1PA 5BO4A 1QCFA 2EOBA 4WWQA 1AOUF 2C9WA 3N7YA 3GQIB 2EO6A 3VS3A 2HUWA 1O4QA 1O4HA 1AOTF 1GRIA 5EHRA 1CSYA 2CI8A 1OPLA 2EKXA 2EYZA 2LCTA 1BHFA 2DVJA 2C0TA 1LUIA 2IUHA 2Y3AB 3VS7A 5KAZA 2RMXA 4A4BA 3VS0A 2MC1A 2DX0A 2HMHA 3IN7A 2H5KA 1D4TA 3T04A 4QSYA 4F59A 2EYYA 1BFJA 1O4EA 3MXCA 2OQ1A 4JGHA 1SKJA 1A1EA 2JYQA 2XP1A 4K2RA 4OHIA 5IBMA 1BKMA 1O4OA 5I6VA 1RQQC 1FYRA 3VS1A 5DC0B 1JYQA 1NZVA 1M27A 1O42A 2SRCA 1BF5A 3HCKA 2DLZA 1CSZA 2IZVA 4GL9E 3QWYA 2HDVA 3M7FA 3BUOB 1AB2A 4DGPA 1TZEE 3S9KA 1IJRA 1NRVA 1GHUA 4GPLB 1O4LA 2QMSA 2FCIA 5EEQA 3GXWA 5AXIA 2L4KA 1BKLA 4FL3A 3C7IA 5EELA 3VRZA 3MXYA 1SPRA 1PICA 1D1ZA 3CD3A 1HCTB 2RSYA 2EYVA 1LUMA 3OVEA 3UYOA 2IUIA 5GJIA 1JU5A 3TKZA 1O4FA 2PLEA 2Y1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQN A;  3BUX B;  1LCK A;  4K45 A;  2KK6 A;  4XZ1 A;  2IUG A;  3GXX A;  4JE4 A;  2CS0 A;  3EAC A;  1UUS A;  5GJH A;  4X6S A;  1SHB A;  2ETZ A;  1KC2 A;  4F5A A;  1TCE A;  1F2F A;  1G83 A;  2DM0 A;  1A08 A;  1O45 A;  1LKL A;  3PSK A;  3IMD A;  1A07 A;  2CR4 A;  1O46 A;  3EAZ A;  1O4M A;  3PS5 A;  3OP0 A;  1Y1U A;  5CDW A;  1P13 A;  1NZL A;  1X27 A;  2YU7 A;  1A1B A;  2CRH A;  1HCS B;  3US4 A;  1UUR A;  4D8K A;  5EHP A;  1AYD A;  1JYR A;  3IMJ A;  1LCJ A;  4OHL A;  1A81 A;  1FBV A;  1FU6 A;  3OB2 B;  3PFV A;  1IS0 A;  1Z3K A;  5EG3 B;  1O41 A;  1R1P A;  1YVL A;  4L1B B;  1O4C A;  2PNA A;  1MIL A;  2ABL A;  4K44 A;  3TL0 A;  3BUN B;  1O4P A;  2FO0 A;  3VS6 A;  1KA6 A;  3PLF B;  3VRN A;  2BBU A;  1SPS A;  1O4I A;  3VRO A;  1BHH B;  2HCK A;  4JEG A;  4U17 A;  3BUM B;  5AUL A;  2PNB A;  4XZ0 A;  3WA4 A;  3KFJ A;  1A1C A;  4EIH A;  1O4D A;  2L6K A;  2GE9 A;  5DF6 A;  2DCR A;  1X0N A;  2SHP A;  3PSJ A;  5HKZ A;  4E68 A;  1AYB A;  2MRK A;  4H1O A;  3VRP A;  2RVF A;  4P9V A;  5D0J A;  3VRR A;  3K2M A;  1F1W A;  2HDX A;  3N84 A;  1O44 A;  2CBL A;  4FBN A;  1OO4 A;  2K7A B;  2ROR A;  1CWE A;  1O49 A;  5HKW A;  1QAD A;  2PTK A;  1O4J A;  1JWO A;  4F5B A;  1OPK A;  3HHM B;  3BKB A;  1H9O A;  1MW4 A;  1CWD L;  4NWF A;  4OHD A;  2LNX A;  1AYA A;  1O4N A;  4OHH A;  2L3T A;  2PLD A;  1FMK A;  1LUN A;  2C0I A;  4FL2 A;  1X6C A;  1AYC A;  3BUW B;  1R1Q A;  3HIZ B;  3VS2 A;  2LNW A;  4GWF A;  1R1S A;  4LUD A;  1A09 A;  1OO3 A;  1KA7 A;  3N8M A;  4TZI A;  2GSB A;  3PJP A;  2OZO A;  2AUG A;  3UF4 A;  5J3X A;  1BG1 A;  1YVH A;  2AOB A;  3QWX X;  1BFI A;  2EU0 A;  1FU5 A;  1B47 A;  3CBL A;  3S8N A;  4OHE A;  4ROJ A;  1CJ1 A;  1BM2 A;  2C0O A;  2VIF A;  4LUE A;  1RJA A;  2AOA A;  1KSW A;  1O4K A;  3PQZ A;  5DC9 A;  3VS5 A;  3IN8 A;  3OB1 B;  1LKK A;  2H46 E;  3ZNI A;  2MQI A;  1WQU A;  2KNO A;  3CWG A;  4P9Z A;  1K9A A;  1O48 A;  2YSX A;  1BHH A;  3CXL A;  4H34 A;  1A1A A;  1D4W A;  4K11 A;  1FBZ A;  2K79 B;  1O47 A;  3OV1 A;  3VRQ A;  2LQW A;  2CIA A;  1LUK A;  1XA6 A;  1O4B A;  4EY0 A;  1SHA A;  2H8H A;  1Y57 A;  2B3O A;  1RPY A;  1JYU A;  3VS4 A;  3S8O A;  1FHS A;  1BMB A;  1BLK A;  5IBS A;  1QG1 E;  4NWG A;  4M4Z A;  1M61 A;  1ZFP E;  2MRJ A;  1O43 A;  3NHN A;  1BLJ A;  3S8L A;  3VRY A;  4E93 A;  1O4R A;  2CI9 A;  4DGX A;  1O4G A;  2EO3 A;  5HKY A;  2Y1N A;  2DLY A;  2EL8 A;  1AD5 A;  4A4C A;  3MAZ A;  3VGO A;  2MK2 A;  2ECD A;  1O4A A;  1I3Z A;  5DC4 A;  1SHD A;  4U1P A;  5BO4 A;  1QCF A;  2EOB A;  4WWQ A;  1AOU F;  2C9W A;  3N7Y A;  3GQI B;  2EO6 A;  3VS3 A;  2HUW A;  1O4Q A;  1O4H A;  1AOT F;  1GRI A;  5EHR A;  1CSY A;  2CI8 A;  1OPL A;  2EKX A;  2EYZ A;  2LCT A;  1BHF A;  2DVJ A;  2C0T A;  1LUI A;  2IUH A;  2Y3A B;  3VS7 A;  5KAZ A;  2RMX A;  4A4B A;  3VS0 A;  2MC1 A;  2DX0 A;  2HMH A;  3IN7 A;  2H5K A;  1D4T A;  3T04 A;  4QSY A;  4F59 A;  2EYY A;  1BFJ A;  1O4E A;  3MXC A;  2OQ1 A;  4JGH A;  1SKJ A;  1A1E A;  2JYQ A;  2XP1 A;  4K2R A;  4OHI A;  5IBM A;  1BKM A;  1O4O A;  5I6V A;  1RQQ C;  1FYR A;  3VS1 A;  5DC0 B;  1JYQ A;  1NZV A;  1M27 A;  1O42 A;  2SRC A;  1BF5 A;  3HCK A;  2DLZ A;  1CSZ A;  2IZV A;  4GL9 E;  3QWY A;  2HDV A;  3M7F A;  3BUO B;  1AB2 A;  4DGP A;  1TZE E;  3S9K A;  1IJR A;  1NRV A;  1GHU A;  4GPL B;  1O4L A;  2QMS A;  2FCI A;  5EEQ A;  3GXW A;  5AXI A;  2L4K A;  1BKL A;  4FL3 A;  3C7I A;  5EEL A;  3VRZ A;  3MXY A;  1SPR A;  1PIC A;  1D1Z A;  3CD3 A;  1HCT B;  2RSY A;  2EYV A;  1LUM A;  3OVE A;  3UYO A;  2IUI A;  5GJI A;  1JU5 A;  3TKZ A;  1O4F A;  2PLE A;  2Y1M A; 
#chains in the Genus database with same CATH topology
 2LQN A;  3BUX B;  1LCK A;  4K45 A;  2KK6 A;  4XZ1 A;  2IUG A;  3GXX A;  4JE4 A;  2CS0 A;  3EAC A;  1UUS A;  5GJH A;  4X6S A;  1SHB A;  2ETZ A;  1KC2 A;  4F5A A;  1TCE A;  1F2F A;  1G83 A;  2DM0 A;  1A08 A;  1O45 A;  1LKL A;  3PSK A;  3IMD A;  1A07 A;  2CR4 A;  1O46 A;  3EAZ A;  1O4M A;  3PS5 A;  3OP0 A;  1Y1U A;  5CDW A;  1P13 A;  1NZL A;  1X27 A;  2YU7 A;  1A1B A;  2CRH A;  1HCS B;  3US4 A;  1UUR A;  4D8K A;  5EHP A;  1AYD A;  1JYR A;  3IMJ A;  1LCJ A;  4OHL A;  1A81 A;  1FBV A;  1FU6 A;  3OB2 B;  3PFV A;  1IS0 A;  1Z3K A;  5EG3 B;  1O41 A;  1R1P A;  1YVL A;  4L1B B;  1O4C A;  2PNA A;  1MIL A;  2ABL A;  4K44 A;  3TL0 A;  3BUN B;  1O4P A;  2FO0 A;  3VS6 A;  1KA6 A;  3PLF B;  3VRN A;  2BBU A;  1SPS A;  1O4I A;  3VRO A;  1BHH B;  2HCK A;  4JEG A;  4U17 A;  3BUM B;  2LRA A;  5AUL A;  2PNB A;  4XZ0 A;  3WA4 A;  3KFJ A;  1A1C A;  4EIH A;  1O4D A;  2L6K A;  2GE9 A;  5DF6 A;  2DCR A;  1X0N A;  2SHP A;  3PSJ A;  5HKZ A;  4E68 A;  1AYB A;  2MRK A;  4H1O A;  3VRP A;  2RVF A;  4P9V A;  5D0J A;  3VRR A;  3K2M A;  1F1W A;  2HDX A;  3N84 A;  1O44 A;  2CBL A;  4FBN A;  1OO4 A;  2K7A B;  2ROR A;  1CWE A;  1O49 A;  5HKW A;  1QAD A;  2PTK A;  2KGY A;  1O4J A;  1JWO A;  4F5B A;  1OPK A;  3HHM B;  3BKB A;  1H9O A;  1MW4 A;  1CWD L;  4NWF A;  4OHD A;  2LNX A;  1AYA A;  1O4N A;  4OHH A;  2L3T A;  2PLD A;  1FMK A;  1LUN A;  2C0I A;  4FL2 A;  1X6C A;  1AYC A;  3BUW B;  1R1Q A;  3HIZ B;  3VS2 A;  2LNW A;  4GWF A;  1R1S A;  4LUD A;  1A09 A;  1OO3 A;  1KA7 A;  3LYV A;  3N8M A;  4TZI A;  2GSB A;  3PJP A;  2OZO A;  2AUG A;  3UF4 A;  5J3X A;  1BG1 A;  1YVH A;  2AOB A;  3QWX X;  1BFI A;  2EU0 A;  1FU5 A;  1B47 A;  3CBL A;  3S8N A;  4OHE A;  4ROJ A;  1CJ1 A;  1BM2 A;  2C0O A;  2VIF A;  4LUE A;  1RJA A;  2AOA A;  1KSW A;  1O4K A;  3PQZ A;  5DC9 A;  3VS5 A;  3IN8 A;  3OB1 B;  1LKK A;  2H46 E;  3ZNI A;  2MQI A;  1WQU A;  2KNO A;  3CWG A;  4P9Z A;  1K9A A;  1O48 A;  2YSX A;  1BHH A;  3CXL A;  4H34 A;  1A1A A;  1D4W A;  4K11 A;  1FBZ A;  2K79 B;  1O47 A;  3OV1 A;  3VRQ A;  2LQW A;  2CIA A;  1LUK A;  1XA6 A;  1O4B A;  4EY0 A;  1SHA A;  2H8H A;  1Y57 A;  2B3O A;  1RPY A;  1JYU A;  3VS4 A;  3S8O A;  1FHS A;  1BMB A;  1BLK A;  5IBS A;  1QG1 E;  4NWG A;  4M4Z A;  1M61 A;  1ZFP E;  2MRJ A;  1O43 A;  3NHN A;  1BLJ A;  3S8L A;  3VRY A;  4E93 A;  1O4R A;  2CI9 A;  4DGX A;  1O4G A;  2EO3 A;  5HKY A;  2Y1N A;  2DLY A;  2EL8 A;  1AD5 A;  4A4C A;  3MAZ A;  3VGO A;  2MK2 A;  2ECD A;  1O4A A;  1I3Z A;  5DC4 A;  1SHD A;  4U1P A;  5BO4 A;  1QCF A;  2EOB A;  4WWQ A;  1AOU F;  2C9W A;  3N7Y A;  3GQI B;  2EO6 A;  3VS3 A;  2HUW A;  1O4Q A;  1O4H A;  1AOT F;  1GRI A;  5EHR A;  1CSY A;  2CI8 A;  1OPL A;  2EKX A;  2EYZ A;  2LCT A;  1BHF A;  2DVJ A;  2C0T A;  1LUI A;  2IUH A;  2Y3A B;  3VS7 A;  5KAZ A;  2RMX A;  4A4B A;  3VS0 A;  2MC1 A;  2DX0 A;  2HMH A;  3IN7 A;  2H5K A;  1D4T A;  3T04 A;  4QSY A;  4F59 A;  2EYY A;  1BFJ A;  1O4E A;  3MXC A;  2OQ1 A;  4JGH A;  1SKJ A;  1A1E A;  2JYQ A;  2XP1 A;  4K2R A;  4OHI A;  5IBM A;  1BKM A;  1O4O A;  5I6V A;  1RQQ C;  1FYR A;  3VS1 A;  5DC0 B;  1JYQ A;  1NZV A;  1M27 A;  3K2T A;  1O42 A;  2SRC A;  1BF5 A;  3HCK A;  2DLZ A;  1CSZ A;  2IZV A;  4GL9 E;  3QWY A;  2HDV A;  3M7F A;  3BUO B;  1AB2 A;  4DGP A;  1TZE E;  3S9K A;  1IJR A;  1NRV A;  1GHU A;  4GPL B;  1O4L A;  2QMS A;  2FCI A;  5EEQ A;  3GXW A;  5AXI A;  2L4K A;  1BKL A;  4FL3 A;  3C7I A;  5EEL A;  3VRZ A;  3MXY A;  1SPR A;  1PIC A;  1D1Z A;  3CD3 A;  1HCT B;  2RSY A;  2EYV A;  1LUM A;  3OVE A;  3UYO A;  2IUI A;  5GJI A;  1JU5 A;  3TKZ A;  1O4F A;  2PLE A;  2Y1M A; 
#chains in the Genus database with same CATH homology
 2LQN A;  3BUX B;  1LCK A;  4K45 A;  2KK6 A;  4XZ1 A;  2IUG A;  3GXX A;  4JE4 A;  2CS0 A;  3EAC A;  1UUS A;  5GJH A;  4X6S A;  1SHB A;  2ETZ A;  1KC2 A;  4F5A A;  1TCE A;  1F2F A;  1G83 A;  2DM0 A;  1A08 A;  1O45 A;  1LKL A;  3PSK A;  3IMD A;  1A07 A;  2CR4 A;  1O46 A;  3EAZ A;  1O4M A;  3PS5 A;  3OP0 A;  1Y1U A;  5CDW A;  1P13 A;  1NZL A;  1X27 A;  2YU7 A;  1A1B A;  2CRH A;  1HCS B;  3US4 A;  1UUR A;  4D8K A;  5EHP A;  1AYD A;  1JYR A;  3IMJ A;  1LCJ A;  4OHL A;  1A81 A;  1FBV A;  1FU6 A;  3OB2 B;  3PFV A;  1IS0 A;  1Z3K A;  5EG3 B;  1O41 A;  1R1P A;  1YVL A;  4L1B B;  1O4C A;  2PNA A;  1MIL A;  2ABL A;  4K44 A;  3TL0 A;  3BUN B;  1O4P A;  2FO0 A;  3VS6 A;  1KA6 A;  3PLF B;  3VRN A;  2BBU A;  1SPS A;  1O4I A;  3VRO A;  1BHH B;  2HCK A;  4JEG A;  4U17 A;  3BUM B;  5AUL A;  2PNB A;  4XZ0 A;  3WA4 A;  3KFJ A;  1A1C A;  4EIH A;  1O4D A;  2L6K A;  2GE9 A;  5DF6 A;  2DCR A;  1X0N A;  2SHP A;  3PSJ A;  5HKZ A;  4E68 A;  1AYB A;  2MRK A;  4H1O A;  3VRP A;  2RVF A;  4P9V A;  5D0J A;  3VRR A;  3K2M A;  1F1W A;  2HDX A;  3N84 A;  1O44 A;  2CBL A;  4FBN A;  1OO4 A;  2K7A B;  2ROR A;  1CWE A;  1O49 A;  5HKW A;  1QAD A;  2PTK A;  1O4J A;  1JWO A;  4F5B A;  1OPK A;  3HHM B;  3BKB A;  1H9O A;  1MW4 A;  1CWD L;  4NWF A;  4OHD A;  2LNX A;  1AYA A;  1O4N A;  4OHH A;  2L3T A;  2PLD A;  1FMK A;  1LUN A;  2C0I A;  4FL2 A;  1X6C A;  1AYC A;  3BUW B;  1R1Q A;  3HIZ B;  3VS2 A;  2LNW A;  4GWF A;  1R1S A;  4LUD A;  1A09 A;  1OO3 A;  1KA7 A;  3N8M A;  4TZI A;  2GSB A;  3PJP A;  2OZO A;  2AUG A;  3UF4 A;  5J3X A;  1BG1 A;  1YVH A;  2AOB A;  3QWX X;  1BFI A;  2EU0 A;  1FU5 A;  1B47 A;  3CBL A;  3S8N A;  4OHE A;  4ROJ A;  1CJ1 A;  1BM2 A;  2C0O A;  2VIF A;  4LUE A;  1RJA A;  2AOA A;  1KSW A;  1O4K A;  3PQZ A;  5DC9 A;  3VS5 A;  3IN8 A;  3OB1 B;  1LKK A;  2H46 E;  3ZNI A;  2MQI A;  1WQU A;  2KNO A;  3CWG A;  4P9Z A;  1K9A A;  1O48 A;  2YSX A;  1BHH A;  3CXL A;  4H34 A;  1A1A A;  1D4W A;  4K11 A;  1FBZ A;  2K79 B;  1O47 A;  3OV1 A;  3VRQ A;  2LQW A;  2CIA A;  1LUK A;  1XA6 A;  1O4B A;  4EY0 A;  1SHA A;  2H8H A;  1Y57 A;  2B3O A;  1RPY A;  1JYU A;  3VS4 A;  3S8O A;  1FHS A;  1BMB A;  1BLK A;  5IBS A;  1QG1 E;  4NWG A;  4M4Z A;  1M61 A;  1ZFP E;  2MRJ A;  1O43 A;  3NHN A;  1BLJ A;  3S8L A;  3VRY A;  4E93 A;  1O4R A;  2CI9 A;  4DGX A;  1O4G A;  2EO3 A;  5HKY A;  2Y1N A;  2DLY A;  2EL8 A;  1AD5 A;  4A4C A;  3MAZ A;  3VGO A;  2MK2 A;  2ECD A;  1O4A A;  1I3Z A;  5DC4 A;  1SHD A;  4U1P A;  5BO4 A;  1QCF A;  2EOB A;  4WWQ A;  1AOU F;  2C9W A;  3N7Y A;  3GQI B;  2EO6 A;  3VS3 A;  2HUW A;  1O4Q A;  1O4H A;  1AOT F;  1GRI A;  5EHR A;  1CSY A;  2CI8 A;  1OPL A;  2EKX A;  2EYZ A;  2LCT A;  1BHF A;  2DVJ A;  2C0T A;  1LUI A;  2IUH A;  2Y3A B;  3VS7 A;  5KAZ A;  2RMX A;  4A4B A;  3VS0 A;  2MC1 A;  2DX0 A;  2HMH A;  3IN7 A;  2H5K A;  1D4T A;  3T04 A;  4QSY A;  4F59 A;  2EYY A;  1BFJ A;  1O4E A;  3MXC A;  2OQ1 A;  4JGH A;  1SKJ A;  1A1E A;  2JYQ A;  2XP1 A;  4K2R A;  4OHI A;  5IBM A;  1BKM A;  1O4O A;  5I6V A;  1RQQ C;  1FYR A;  3VS1 A;  5DC0 B;  1JYQ A;  1NZV A;  1M27 A;  1O42 A;  2SRC A;  1BF5 A;  3HCK A;  2DLZ A;  1CSZ A;  2IZV A;  4GL9 E;  3QWY A;  2HDV A;  3M7F A;  3BUO B;  1AB2 A;  4DGP A;  1TZE E;  3S9K A;  1IJR A;  1NRV A;  1GHU A;  4GPL B;  1O4L A;  2QMS A;  2FCI A;  5EEQ A;  3GXW A;  5AXI A;  2L4K A;  1BKL A;  4FL3 A;  3C7I A;  5EEL A;  3VRZ A;  3MXY A;  1SPR A;  1PIC A;  1D1Z A;  3CD3 A;  1HCT B;  2RSY A;  2EYV A;  1LUM A;  3OVE A;  3UYO A;  2IUI A;  5GJI A;  1JU5 A;  3TKZ A;  1O4F A;  2PLE A;  2Y1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...