2EL8A

Solution structure of the human stap2 sh2 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
118
structure length
118
Chain Sequence
b'GSSGSSGEVLAKEEARRALETPSCFLKVSRLEAQLLLERYPECGNLLLRPSGDGADGVSVTTRQMHNGTHVVRHYKVKREGPKYVIDVEQPFSCTSLDAVVNYFVSHTKKALVPFLLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal-transducing adaptor protein 2
publication title Solution structure of the human STAP2 SH2 domain
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 10
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2007-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2el8A01
2IUHA 1OO3A 4QSYA 3N7YA 3VRNA 1O42A 2CR4A 4A4BA 4D8KA 1LCJA 1JYUA 1Z3KA 1IS0A 2PLEA 1A07A 1CJ1A 4EY0A 4GWFA 2OZOA 2H5KA 3OB1B 1P13A 4U17A 1SKJA 1M61A 1H9OA 1TZEE 2CRHA 2K79B 1MILA 5CDWA 3BUWB 4OHDA 5BO4A 1KA6A 3BUOB 5EELA 3VS6A 5EEQA 2RMXA 3S8LA 5EHPA 1LKLA 1NRVA 5GJIA 2C0TA 3GXWA 2Y3AB 4P9VA 2CI9A 1JWOA 1O4HA 4XZ0A 4XZ1A 4F59A 3WA4A 2LCTA 2MRJA 2BBUA 3UYOA 3VGOA 3HIZB 4GL9E 5IBSA 3HCKA 1O4EA 1O4OA 2RVFA 1O4QA 2PTKA 4E68A 2MC1A 1RPYA 1R1QA 1O49A 4X6SA 1CSYA 4A4CA 4K2RA 3VRRA 5DC0B 1R1SA 1BLJA 3TL0A 1O41A 4NWFA 1AYCA 3QWYA 1A09A 3MAZA 1LUNA 3C7IA 2EU0A 1A1EA 2JYQA 5AXIA 3PJPA 3M7FA 3VROA 1AB2A 1BLKA 2DX0A 1FU6A 1BFJA 2MQIA 1WQUA 1SPSA 1QG1E 3OB2B 1O4DA 1O4LA 3GQIB 2EYVA 1FHSA 3VRZA 1M27A 1O45A 5DC9A 1O4NA 3OV1A 1KA7A 1SHDA 5HKYA 4H1OA 2YU7A 1LUMA 4EIHA 2KK6A 3VS1A 1AOUF 4JEGA 1A81A 1XA6A 3PLFB 5HKWA 2PLDA 1O4PA 1K9AA 1NZVA 1QCFA 2DLYA 4FL3A 2MRKA 2HDVA 2CI8A 3IN8A 4FL2A 2L6KA 2SHPA 2SRCA 3VS2A 1NZLA 2Y1MA 4WWQA 4K44A 1PICA 2DVJA 1O4GA 1YVHA 1RJAA 3PSJA 4OHLA 1AYAA 3N84A 2FO0A 1BMBA 2KNOA 4OHIA 2GE9A 2AOBA 1A1BA 2AOAA 1O48A 1UURA 1JU5A 1BM2A 3VRPA 2DM0A 1O47A 1ZFPE 1YVLA 3VS3A 2EL8A 1O4AA 1KSWA 1MW4A 2EYYA 2IZVA 1FBVA 2C9WA 3BUXB 2L3TA 3IMDA 3GXXA 2CIAA 5DF6A 3PFVA 1UUSA 2ECDA 4TZIA 5KAZA 2LQWA 1O4FA 2HCKA 1BHHB 2GSBA 2DLZA 4U1PA 4DGXA 1A08A 4GPLB 2IUGA 1X27A 3ZNIA 1GRIA 1OPKA 1HCSB 3QWXX 2CBLA 4F5AA 2L4KA 1I3ZA 3CBLA 1SHBA 2PNAA 1FU5A 2OQ1A 1RQQC 5AULA 4P9ZA 1BFIA 1F2FA 1IJRA 3S8OA 4M4ZA 1AD5A 1B47A 2HUWA 2K7AB 3BUMB 2IUIA 1O4RA 3KFJA 3VS7A 3VS0A 1BHHA 1LUKA 3EACA 3UF4A 2EO3A 4JGHA 3CXLA 3TKZA 1O4BA 1O44A 3N8MA 3IN7A 3NHNA 1CSZA 4FBNA 1CWEA 4K11A 1BF5A 3VRYA 2XP1A 2HMHA 4F5BA 1HCTB 3VRQA 3PSKA 1OPLA 4L1BB 4ROJA 1OO4A 1D4TA 3CWGA 3PS5A 1O4KA 1O4MA 2EO6A 1O4JA 4LUDA 4NWGA 3OP0A 2PNBA 1FMKA 1R1PA 3S8NA 1QADA 4DGPA 2MK2A 2B3OA 1BKMA 2QMSA 2VIFA 1D4WA 2FCIA 5IBMA 5DC4A 5GJHA 2EKXA 2AUGA 2RORA 3T04A 1SHAA 2LNWA 2Y1NA 1F1WA 2H46E 1O4IA 1SPRA 2CS0A 1AOTF 1LKKA 4LUEA 1AYBA 5D0JA 1X0NA 5EG3B 1LUIA 3BUNB 2HDXA 1CWDL 2DCRA 3VS4A 3OVEA 5EHRA 3BKBA 3VS5A 5J3XA 1O43A 5HKZA 2YSXA 2EYZA 4OHHA 2RSYA 1JYQA 1LCKA 2EOBA 1X6CA 1GHUA 3MXCA 1G83A 3S9KA 2C0OA 4E93A 3CD3A 2C0IA 1KC2A 3IMJA 2H8HA 1FYRA 4JE4A 1Y1UA 5I6VA 3MXYA 4H34A 1A1AA 1O4CA 4K45A 1Y57A 1BG1A 1A1CA 1FBZA 3US4A 2LQNA 3K2MA 1AYDA 1BHFA 1TCEA 3EAZA 1D1ZA 2ETZA 3HHMB 2LNXA 1JYRA 1O46A 2ABLA 1BKLA 3PQZA 4OHEA
chains in the Genus database with same CATH superfamily
2IUHA 1OO3A 4QSYA 3N7YA 3VRNA 1O42A 2CR4A 4A4BA 4D8KA 1LCJA 1JYUA 1Z3KA 2KGYA 1IS0A 2PLEA 1A07A 1CJ1A 4EY0A 4GWFA 2OZOA 2H5KA 3OB1B 1P13A 4U17A 1SKJA 1M61A 1H9OA 1TZEE 2CRHA 2K79B 1MILA 5CDWA 3BUWB 4OHDA 5BO4A 1KA6A 3BUOB 5EELA 3VS6A 5EEQA 2RMXA 3S8LA 5EHPA 1LKLA 1NRVA 5GJIA 2C0TA 3GXWA 2Y3AB 4P9VA 2CI9A 1JWOA 1O4HA 4XZ0A 4XZ1A 4F59A 3WA4A 2LCTA 2MRJA 2BBUA 3UYOA 3VGOA 3HIZB 4GL9E 5IBSA 3HCKA 1O4EA 1O4OA 2RVFA 1O4QA 2PTKA 4E68A 2MC1A 1RPYA 1R1QA 1O49A 4X6SA 1CSYA 4A4CA 4K2RA 3VRRA 5DC0B 1R1SA 1BLJA 3TL0A 1O41A 4NWFA 1AYCA 3QWYA 1A09A 3MAZA 1LUNA 3C7IA 2EU0A 1A1EA 2JYQA 5AXIA 3PJPA 3M7FA 3VROA 1AB2A 1BLKA 2DX0A 1FU6A 1BFJA 2MQIA 1WQUA 1SPSA 1QG1E 3OB2B 1O4DA 1O4LA 3GQIB 2EYVA 1FHSA 3VRZA 1M27A 1O45A 5DC9A 1O4NA 3OV1A 1KA7A 1SHDA 5HKYA 4H1OA 2YU7A 1LUMA 4EIHA 2KK6A 3VS1A 1AOUF 4JEGA 1A81A 1XA6A 3PLFB 5HKWA 2PLDA 1O4PA 1K9AA 1NZVA 1QCFA 2DLYA 4FL3A 2MRKA 2HDVA 2CI8A 3IN8A 4FL2A 2L6KA 2SHPA 2SRCA 3VS2A 1NZLA 2Y1MA 4WWQA 4K44A 1PICA 2DVJA 1O4GA 1YVHA 1RJAA 3PSJA 4OHLA 1AYAA 3N84A 2FO0A 1BMBA 2KNOA 4OHIA 2GE9A 2AOBA 1A1BA 2AOAA 1O48A 1UURA 1JU5A 1BM2A 3VRPA 2DM0A 1O47A 1ZFPE 1YVLA 3VS3A 2EL8A 1O4AA 1KSWA 1MW4A 2EYYA 2IZVA 1FBVA 2C9WA 3BUXB 2L3TA 3IMDA 3GXXA 2CIAA 5DF6A 3PFVA 1UUSA 2ECDA 4TZIA 5KAZA 2LQWA 1O4FA 2HCKA 1BHHB 2GSBA 2DLZA 4U1PA 4DGXA 1A08A 4GPLB 2IUGA 1X27A 3ZNIA 1GRIA 1OPKA 1HCSB 3QWXX 2CBLA 4F5AA 2L4KA 1I3ZA 3CBLA 1SHBA 2PNAA 1FU5A 2OQ1A 1RQQC 5AULA 4P9ZA 1BFIA 1F2FA 1IJRA 3S8OA 4M4ZA 1AD5A 1B47A 2HUWA 2K7AB 3BUMB 2IUIA 1O4RA 3KFJA 3VS7A 3VS0A 1BHHA 1LUKA 3EACA 3UF4A 2EO3A 4JGHA 3CXLA 3TKZA 1O4BA 1O44A 3N8MA 3IN7A 3NHNA 1CSZA 4FBNA 1CWEA 4K11A 1BF5A 3VRYA 2XP1A 2HMHA 3K2TA 4F5BA 1HCTB 3VRQA 3PSKA 1OPLA 4L1BB 4ROJA 1OO4A 3LYVA 1D4TA 3CWGA 3PS5A 1O4KA 1O4MA 2EO6A 1O4JA 4LUDA 4NWGA 3OP0A 2PNBA 1FMKA 1R1PA 3S8NA 1QADA 4DGPA 2MK2A 2B3OA 1BKMA 2QMSA 2VIFA 1D4WA 2FCIA 5IBMA 5DC4A 5GJHA 2EKXA 2AUGA 2RORA 3T04A 1SHAA 2LNWA 2Y1NA 1F1WA 2H46E 1O4IA 1SPRA 2CS0A 1AOTF 1LKKA 4LUEA 1AYBA 5D0JA 1X0NA 5EG3B 1LUIA 3BUNB 2HDXA 1CWDL 2DCRA 3VS4A 3OVEA 5EHRA 3BKBA 3VS5A 5J3XA 1O43A 5HKZA 2YSXA 2EYZA 4OHHA 2RSYA 1JYQA 1LCKA 2EOBA 1X6CA 1GHUA 3MXCA 1G83A 3S9KA 2C0OA 4E93A 3CD3A 2C0IA 1KC2A 3IMJA 2H8HA 1FYRA 2LRAA 4JE4A 1Y1UA 5I6VA 3MXYA 4H34A 1A1AA 1O4CA 4K45A 1Y57A 1BG1A 1A1CA 1FBZA 3US4A 2LQNA 3K2MA 1AYDA 1BHFA 1TCEA 3EAZA 1D1ZA 2ETZA 3HHMB 2LNXA 1JYRA 1O46A 2ABLA 1BKLA 3PQZA 4OHEA
chains in the Genus database with same CATH topology
2IUHA 1OO3A 4QSYA 3N7YA 3VRNA 1O42A 2CR4A 4A4BA 4D8KA 1LCJA 1JYUA 1Z3KA 1IS0A 2PLEA 1A07A 1CJ1A 4EY0A 4GWFA 2OZOA 2H5KA 3OB1B 1P13A 4U17A 1SKJA 1M61A 1H9OA 1TZEE 2CRHA 2K79B 1MILA 5CDWA 3BUWB 4OHDA 5BO4A 1KA6A 3BUOB 5EELA 3VS6A 5EEQA 2RMXA 3S8LA 5EHPA 1LKLA 1NRVA 5GJIA 2C0TA 3GXWA 2Y3AB 4P9VA 2CI9A 1JWOA 1O4HA 4XZ0A 4XZ1A 4F59A 3WA4A 2LCTA 2MRJA 2BBUA 3UYOA 3VGOA 3HIZB 4GL9E 5IBSA 3HCKA 1O4EA 1O4OA 2RVFA 1O4QA 2PTKA 4E68A 2MC1A 1RPYA 1R1QA 1O49A 4X6SA 1CSYA 4A4CA 4K2RA 3VRRA 5DC0B 1R1SA 1BLJA 3TL0A 1O41A 4NWFA 1AYCA 3QWYA 1A09A 3MAZA 1LUNA 3C7IA 2EU0A 1A1EA 2JYQA 5AXIA 3PJPA 3M7FA 3VROA 1AB2A 1BLKA 2DX0A 1FU6A 1BFJA 2MQIA 1WQUA 1SPSA 1QG1E 3OB2B 1O4DA 1O4LA 3GQIB 2EYVA 1FHSA 3VRZA 1M27A 1O45A 5DC9A 1O4NA 3OV1A 1KA7A 1SHDA 5HKYA 4H1OA 2YU7A 1LUMA 4EIHA 2KK6A 3VS1A 1AOUF 4JEGA 1A81A 1XA6A 3PLFB 5HKWA 2PLDA 1O4PA 1K9AA 1NZVA 1QCFA 2DLYA 4FL3A 2MRKA 2HDVA 2CI8A 3IN8A 4FL2A 2L6KA 2SHPA 2SRCA 3VS2A 1NZLA 2Y1MA 4WWQA 4K44A 1PICA 2DVJA 1O4GA 1YVHA 1RJAA 3PSJA 4OHLA 1AYAA 3N84A 2FO0A 1BMBA 2KNOA 4OHIA 2GE9A 2AOBA 1A1BA 2AOAA 1O48A 1UURA 1JU5A 1BM2A 3VRPA 2DM0A 1O47A 1ZFPE 1YVLA 3VS3A 2EL8A 1O4AA 1KSWA 1MW4A 2EYYA 2IZVA 1FBVA 2C9WA 3BUXB 2L3TA 3IMDA 3GXXA 2CIAA 5DF6A 3PFVA 1UUSA 2ECDA 4TZIA 5KAZA 2LQWA 1O4FA 2HCKA 1BHHB 2GSBA 2DLZA 4U1PA 4DGXA 1A08A 4GPLB 2IUGA 1X27A 3ZNIA 1GRIA 1OPKA 1HCSB 3QWXX 2CBLA 4F5AA 2L4KA 1I3ZA 3CBLA 1SHBA 2PNAA 1FU5A 2OQ1A 1RQQC 5AULA 4P9ZA 1BFIA 1F2FA 1IJRA 3S8OA 4M4ZA 1AD5A 1B47A 2HUWA 2K7AB 3BUMB 2IUIA 1O4RA 3KFJA 3VS7A 3VS0A 1BHHA 1LUKA 3EACA 3UF4A 2EO3A 4JGHA 3CXLA 3TKZA 1O4BA 1O44A 3N8MA 3IN7A 3NHNA 1CSZA 4FBNA 1CWEA 4K11A 1BF5A 3VRYA 2XP1A 2HMHA 4F5BA 1HCTB 3VRQA 3PSKA 1OPLA 4L1BB 4ROJA 1OO4A 1D4TA 3CWGA 3PS5A 1O4KA 1O4MA 2EO6A 1O4JA 4LUDA 4NWGA 3OP0A 2PNBA 1FMKA 1R1PA 3S8NA 1QADA 4DGPA 2MK2A 2B3OA 1BKMA 2QMSA 2VIFA 1D4WA 2FCIA 5IBMA 5DC4A 5GJHA 2EKXA 2AUGA 2RORA 3T04A 1SHAA 2LNWA 2Y1NA 1F1WA 2H46E 1O4IA 1SPRA 2CS0A 1AOTF 1LKKA 4LUEA 1AYBA 5D0JA 1X0NA 5EG3B 1LUIA 3BUNB 2HDXA 1CWDL 2DCRA 3VS4A 3OVEA 5EHRA 3BKBA 3VS5A 5J3XA 1O43A 5HKZA 2YSXA 2EYZA 4OHHA 2RSYA 1JYQA 1LCKA 2EOBA 1X6CA 1GHUA 3MXCA 1G83A 3S9KA 2C0OA 4E93A 3CD3A 2C0IA 1KC2A 3IMJA 2H8HA 1FYRA 4JE4A 1Y1UA 5I6VA 3MXYA 4H34A 1A1AA 1O4CA 4K45A 1Y57A 1BG1A 1A1CA 1FBZA 3US4A 2LQNA 3K2MA 1AYDA 1BHFA 1TCEA 3EAZA 1D1ZA 2ETZA 3HHMB 2LNXA 1JYRA 1O46A 2ABLA 1BKLA 3PQZA 4OHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUH A;  1OO3 A;  4QSY A;  3N7Y A;  3VRN A;  1O42 A;  2CR4 A;  4A4B A;  4D8K A;  1LCJ A;  1JYU A;  1Z3K A;  1IS0 A;  2PLE A;  1A07 A;  1CJ1 A;  4EY0 A;  4GWF A;  2OZO A;  2H5K A;  3OB1 B;  1P13 A;  4U17 A;  1SKJ A;  1M61 A;  1H9O A;  1TZE E;  2CRH A;  2K79 B;  1MIL A;  5CDW A;  3BUW B;  4OHD A;  5BO4 A;  1KA6 A;  3BUO B;  5EEL A;  3VS6 A;  5EEQ A;  2RMX A;  3S8L A;  5EHP A;  1LKL A;  1NRV A;  5GJI A;  2C0T A;  3GXW A;  2Y3A B;  4P9V A;  2CI9 A;  1JWO A;  1O4H A;  4XZ0 A;  4XZ1 A;  4F59 A;  3WA4 A;  2LCT A;  2MRJ A;  2BBU A;  3UYO A;  3VGO A;  3HIZ B;  4GL9 E;  5IBS A;  3HCK A;  1O4E A;  1O4O A;  2RVF A;  1O4Q A;  2PTK A;  4E68 A;  2MC1 A;  1RPY A;  1R1Q A;  1O49 A;  4X6S A;  1CSY A;  4A4C A;  4K2R A;  3VRR A;  5DC0 B;  1R1S A;  1BLJ A;  3TL0 A;  1O41 A;  4NWF A;  1AYC A;  3QWY A;  1A09 A;  3MAZ A;  1LUN A;  3C7I A;  2EU0 A;  1A1E A;  2JYQ A;  5AXI A;  3PJP A;  3M7F A;  3VRO A;  1AB2 A;  1BLK A;  2DX0 A;  1FU6 A;  1BFJ A;  2MQI A;  1WQU A;  1SPS A;  1QG1 E;  3OB2 B;  1O4D A;  1O4L A;  3GQI B;  2EYV A;  1FHS A;  3VRZ A;  1M27 A;  1O45 A;  5DC9 A;  1O4N A;  3OV1 A;  1KA7 A;  1SHD A;  5HKY A;  4H1O A;  2YU7 A;  1LUM A;  4EIH A;  2KK6 A;  3VS1 A;  1AOU F;  4JEG A;  1A81 A;  1XA6 A;  3PLF B;  5HKW A;  2PLD A;  1O4P A;  1K9A A;  1NZV A;  1QCF A;  2DLY A;  4FL3 A;  2MRK A;  2HDV A;  2CI8 A;  3IN8 A;  4FL2 A;  2L6K A;  2SHP A;  2SRC A;  3VS2 A;  1NZL A;  2Y1M A;  4WWQ A;  4K44 A;  1PIC A;  2DVJ A;  1O4G A;  1YVH A;  1RJA A;  3PSJ A;  4OHL A;  1AYA A;  3N84 A;  2FO0 A;  1BMB A;  2KNO A;  4OHI A;  2GE9 A;  2AOB A;  1A1B A;  2AOA A;  1O48 A;  1UUR A;  1JU5 A;  1BM2 A;  3VRP A;  2DM0 A;  1O47 A;  1ZFP E;  1YVL A;  3VS3 A;  2EL8 A;  1O4A A;  1KSW A;  1MW4 A;  2EYY A;  2IZV A;  1FBV A;  2C9W A;  3BUX B;  2L3T A;  3IMD A;  3GXX A;  2CIA A;  5DF6 A;  3PFV A;  1UUS A;  2ECD A;  4TZI A;  5KAZ A;  2LQW A;  1O4F A;  2HCK A;  1BHH B;  2GSB A;  2DLZ A;  4U1P A;  4DGX A;  1A08 A;  4GPL B;  2IUG A;  1X27 A;  3ZNI A;  1GRI A;  1OPK A;  1HCS B;  3QWX X;  2CBL A;  4F5A A;  2L4K A;  1I3Z A;  3CBL A;  1SHB A;  2PNA A;  1FU5 A;  2OQ1 A;  1RQQ C;  5AUL A;  4P9Z A;  1BFI A;  1F2F A;  1IJR A;  3S8O A;  4M4Z A;  1AD5 A;  1B47 A;  2HUW A;  2K7A B;  3BUM B;  2IUI A;  1O4R A;  3KFJ A;  3VS7 A;  3VS0 A;  1BHH A;  1LUK A;  3EAC A;  3UF4 A;  2EO3 A;  4JGH A;  3CXL A;  3TKZ A;  1O4B A;  1O44 A;  3N8M A;  3IN7 A;  3NHN A;  1CSZ A;  4FBN A;  1CWE A;  4K11 A;  1BF5 A;  3VRY A;  2XP1 A;  2HMH A;  4F5B A;  1HCT B;  3VRQ A;  3PSK A;  1OPL A;  4L1B B;  4ROJ A;  1OO4 A;  1D4T A;  3CWG A;  3PS5 A;  1O4K A;  1O4M A;  2EO6 A;  1O4J A;  4LUD A;  4NWG A;  3OP0 A;  2PNB A;  1FMK A;  1R1P A;  3S8N A;  1QAD A;  4DGP A;  2MK2 A;  2B3O A;  1BKM A;  2QMS A;  2VIF A;  1D4W A;  2FCI A;  5IBM A;  5DC4 A;  5GJH A;  2EKX A;  2AUG A;  2ROR A;  3T04 A;  1SHA A;  2LNW A;  2Y1N A;  1F1W A;  2H46 E;  1O4I A;  1SPR A;  2CS0 A;  1AOT F;  1LKK A;  4LUE A;  1AYB A;  5D0J A;  1X0N A;  5EG3 B;  1LUI A;  3BUN B;  2HDX A;  1CWD L;  2DCR A;  3VS4 A;  3OVE A;  5EHR A;  3BKB A;  3VS5 A;  5J3X A;  1O43 A;  5HKZ A;  2YSX A;  2EYZ A;  4OHH A;  2RSY A;  1JYQ A;  1LCK A;  2EOB A;  1X6C A;  1GHU A;  3MXC A;  1G83 A;  3S9K A;  2C0O A;  4E93 A;  3CD3 A;  2C0I A;  1KC2 A;  3IMJ A;  2H8H A;  1FYR A;  4JE4 A;  1Y1U A;  5I6V A;  3MXY A;  4H34 A;  1A1A A;  1O4C A;  4K45 A;  1Y57 A;  1BG1 A;  1A1C A;  1FBZ A;  3US4 A;  2LQN A;  3K2M A;  1AYD A;  1BHF A;  1TCE A;  3EAZ A;  1D1Z A;  2ETZ A;  3HHM B;  2LNX A;  1JYR A;  1O46 A;  2ABL A;  1BKL A;  3PQZ A;  4OHE A; 
#chains in the Genus database with same CATH topology
 2IUH A;  1OO3 A;  4QSY A;  3N7Y A;  3VRN A;  1O42 A;  2CR4 A;  4A4B A;  4D8K A;  1LCJ A;  1JYU A;  1Z3K A;  2KGY A;  1IS0 A;  2PLE A;  1A07 A;  1CJ1 A;  4EY0 A;  4GWF A;  2OZO A;  2H5K A;  3OB1 B;  1P13 A;  4U17 A;  1SKJ A;  1M61 A;  1H9O A;  1TZE E;  2CRH A;  2K79 B;  1MIL A;  5CDW A;  3BUW B;  4OHD A;  5BO4 A;  1KA6 A;  3BUO B;  5EEL A;  3VS6 A;  5EEQ A;  2RMX A;  3S8L A;  5EHP A;  1LKL A;  1NRV A;  5GJI A;  2C0T A;  3GXW A;  2Y3A B;  4P9V A;  2CI9 A;  1JWO A;  1O4H A;  4XZ0 A;  4XZ1 A;  4F59 A;  3WA4 A;  2LCT A;  2MRJ A;  2BBU A;  3UYO A;  3VGO A;  3HIZ B;  4GL9 E;  5IBS A;  3HCK A;  1O4E A;  1O4O A;  2RVF A;  1O4Q A;  2PTK A;  4E68 A;  2MC1 A;  1RPY A;  1R1Q A;  1O49 A;  4X6S A;  1CSY A;  4A4C A;  4K2R A;  3VRR A;  5DC0 B;  1R1S A;  1BLJ A;  3TL0 A;  1O41 A;  4NWF A;  1AYC A;  3QWY A;  1A09 A;  3MAZ A;  1LUN A;  3C7I A;  2EU0 A;  1A1E A;  2JYQ A;  5AXI A;  3PJP A;  3M7F A;  3VRO A;  1AB2 A;  1BLK A;  2DX0 A;  1FU6 A;  1BFJ A;  2MQI A;  1WQU A;  1SPS A;  1QG1 E;  3OB2 B;  1O4D A;  1O4L A;  3GQI B;  2EYV A;  1FHS A;  3VRZ A;  1M27 A;  1O45 A;  5DC9 A;  1O4N A;  3OV1 A;  1KA7 A;  1SHD A;  5HKY A;  4H1O A;  2YU7 A;  1LUM A;  4EIH A;  2KK6 A;  3VS1 A;  1AOU F;  4JEG A;  1A81 A;  1XA6 A;  3PLF B;  5HKW A;  2PLD A;  1O4P A;  1K9A A;  1NZV A;  1QCF A;  2DLY A;  4FL3 A;  2MRK A;  2HDV A;  2CI8 A;  3IN8 A;  4FL2 A;  2L6K A;  2SHP A;  2SRC A;  3VS2 A;  1NZL A;  2Y1M A;  4WWQ A;  4K44 A;  1PIC A;  2DVJ A;  1O4G A;  1YVH A;  1RJA A;  3PSJ A;  4OHL A;  1AYA A;  3N84 A;  2FO0 A;  1BMB A;  2KNO A;  4OHI A;  2GE9 A;  2AOB A;  1A1B A;  2AOA A;  1O48 A;  1UUR A;  1JU5 A;  1BM2 A;  3VRP A;  2DM0 A;  1O47 A;  1ZFP E;  1YVL A;  3VS3 A;  2EL8 A;  1O4A A;  1KSW A;  1MW4 A;  2EYY A;  2IZV A;  1FBV A;  2C9W A;  3BUX B;  2L3T A;  3IMD A;  3GXX A;  2CIA A;  5DF6 A;  3PFV A;  1UUS A;  2ECD A;  4TZI A;  5KAZ A;  2LQW A;  1O4F A;  2HCK A;  1BHH B;  2GSB A;  2DLZ A;  4U1P A;  4DGX A;  1A08 A;  4GPL B;  2IUG A;  1X27 A;  3ZNI A;  1GRI A;  1OPK A;  1HCS B;  3QWX X;  2CBL A;  4F5A A;  2L4K A;  1I3Z A;  3CBL A;  1SHB A;  2PNA A;  1FU5 A;  2OQ1 A;  1RQQ C;  5AUL A;  4P9Z A;  1BFI A;  1F2F A;  1IJR A;  3S8O A;  4M4Z A;  1AD5 A;  1B47 A;  2HUW A;  2K7A B;  3BUM B;  2IUI A;  1O4R A;  3KFJ A;  3VS7 A;  3VS0 A;  1BHH A;  1LUK A;  3EAC A;  3UF4 A;  2EO3 A;  4JGH A;  3CXL A;  3TKZ A;  1O4B A;  1O44 A;  3N8M A;  3IN7 A;  3NHN A;  1CSZ A;  4FBN A;  1CWE A;  4K11 A;  1BF5 A;  3VRY A;  2XP1 A;  2HMH A;  3K2T A;  4F5B A;  1HCT B;  3VRQ A;  3PSK A;  1OPL A;  4L1B B;  4ROJ A;  1OO4 A;  3LYV A;  1D4T A;  3CWG A;  3PS5 A;  1O4K A;  1O4M A;  2EO6 A;  1O4J A;  4LUD A;  4NWG A;  3OP0 A;  2PNB A;  1FMK A;  1R1P A;  3S8N A;  1QAD A;  4DGP A;  2MK2 A;  2B3O A;  1BKM A;  2QMS A;  2VIF A;  1D4W A;  2FCI A;  5IBM A;  5DC4 A;  5GJH A;  2EKX A;  2AUG A;  2ROR A;  3T04 A;  1SHA A;  2LNW A;  2Y1N A;  1F1W A;  2H46 E;  1O4I A;  1SPR A;  2CS0 A;  1AOT F;  1LKK A;  4LUE A;  1AYB A;  5D0J A;  1X0N A;  5EG3 B;  1LUI A;  3BUN B;  2HDX A;  1CWD L;  2DCR A;  3VS4 A;  3OVE A;  5EHR A;  3BKB A;  3VS5 A;  5J3X A;  1O43 A;  5HKZ A;  2YSX A;  2EYZ A;  4OHH A;  2RSY A;  1JYQ A;  1LCK A;  2EOB A;  1X6C A;  1GHU A;  3MXC A;  1G83 A;  3S9K A;  2C0O A;  4E93 A;  3CD3 A;  2C0I A;  1KC2 A;  3IMJ A;  2H8H A;  1FYR A;  2LRA A;  4JE4 A;  1Y1U A;  5I6V A;  3MXY A;  4H34 A;  1A1A A;  1O4C A;  4K45 A;  1Y57 A;  1BG1 A;  1A1C A;  1FBZ A;  3US4 A;  2LQN A;  3K2M A;  1AYD A;  1BHF A;  1TCE A;  3EAZ A;  1D1Z A;  2ETZ A;  3HHM B;  2LNX A;  1JYR A;  1O46 A;  2ABL A;  1BKL A;  3PQZ A;  4OHE A; 
#chains in the Genus database with same CATH homology
 2IUH A;  1OO3 A;  4QSY A;  3N7Y A;  3VRN A;  1O42 A;  2CR4 A;  4A4B A;  4D8K A;  1LCJ A;  1JYU A;  1Z3K A;  1IS0 A;  2PLE A;  1A07 A;  1CJ1 A;  4EY0 A;  4GWF A;  2OZO A;  2H5K A;  3OB1 B;  1P13 A;  4U17 A;  1SKJ A;  1M61 A;  1H9O A;  1TZE E;  2CRH A;  2K79 B;  1MIL A;  5CDW A;  3BUW B;  4OHD A;  5BO4 A;  1KA6 A;  3BUO B;  5EEL A;  3VS6 A;  5EEQ A;  2RMX A;  3S8L A;  5EHP A;  1LKL A;  1NRV A;  5GJI A;  2C0T A;  3GXW A;  2Y3A B;  4P9V A;  2CI9 A;  1JWO A;  1O4H A;  4XZ0 A;  4XZ1 A;  4F59 A;  3WA4 A;  2LCT A;  2MRJ A;  2BBU A;  3UYO A;  3VGO A;  3HIZ B;  4GL9 E;  5IBS A;  3HCK A;  1O4E A;  1O4O A;  2RVF A;  1O4Q A;  2PTK A;  4E68 A;  2MC1 A;  1RPY A;  1R1Q A;  1O49 A;  4X6S A;  1CSY A;  4A4C A;  4K2R A;  3VRR A;  5DC0 B;  1R1S A;  1BLJ A;  3TL0 A;  1O41 A;  4NWF A;  1AYC A;  3QWY A;  1A09 A;  3MAZ A;  1LUN A;  3C7I A;  2EU0 A;  1A1E A;  2JYQ A;  5AXI A;  3PJP A;  3M7F A;  3VRO A;  1AB2 A;  1BLK A;  2DX0 A;  1FU6 A;  1BFJ A;  2MQI A;  1WQU A;  1SPS A;  1QG1 E;  3OB2 B;  1O4D A;  1O4L A;  3GQI B;  2EYV A;  1FHS A;  3VRZ A;  1M27 A;  1O45 A;  5DC9 A;  1O4N A;  3OV1 A;  1KA7 A;  1SHD A;  5HKY A;  4H1O A;  2YU7 A;  1LUM A;  4EIH A;  2KK6 A;  3VS1 A;  1AOU F;  4JEG A;  1A81 A;  1XA6 A;  3PLF B;  5HKW A;  2PLD A;  1O4P A;  1K9A A;  1NZV A;  1QCF A;  2DLY A;  4FL3 A;  2MRK A;  2HDV A;  2CI8 A;  3IN8 A;  4FL2 A;  2L6K A;  2SHP A;  2SRC A;  3VS2 A;  1NZL A;  2Y1M A;  4WWQ A;  4K44 A;  1PIC A;  2DVJ A;  1O4G A;  1YVH A;  1RJA A;  3PSJ A;  4OHL A;  1AYA A;  3N84 A;  2FO0 A;  1BMB A;  2KNO A;  4OHI A;  2GE9 A;  2AOB A;  1A1B A;  2AOA A;  1O48 A;  1UUR A;  1JU5 A;  1BM2 A;  3VRP A;  2DM0 A;  1O47 A;  1ZFP E;  1YVL A;  3VS3 A;  2EL8 A;  1O4A A;  1KSW A;  1MW4 A;  2EYY A;  2IZV A;  1FBV A;  2C9W A;  3BUX B;  2L3T A;  3IMD A;  3GXX A;  2CIA A;  5DF6 A;  3PFV A;  1UUS A;  2ECD A;  4TZI A;  5KAZ A;  2LQW A;  1O4F A;  2HCK A;  1BHH B;  2GSB A;  2DLZ A;  4U1P A;  4DGX A;  1A08 A;  4GPL B;  2IUG A;  1X27 A;  3ZNI A;  1GRI A;  1OPK A;  1HCS B;  3QWX X;  2CBL A;  4F5A A;  2L4K A;  1I3Z A;  3CBL A;  1SHB A;  2PNA A;  1FU5 A;  2OQ1 A;  1RQQ C;  5AUL A;  4P9Z A;  1BFI A;  1F2F A;  1IJR A;  3S8O A;  4M4Z A;  1AD5 A;  1B47 A;  2HUW A;  2K7A B;  3BUM B;  2IUI A;  1O4R A;  3KFJ A;  3VS7 A;  3VS0 A;  1BHH A;  1LUK A;  3EAC A;  3UF4 A;  2EO3 A;  4JGH A;  3CXL A;  3TKZ A;  1O4B A;  1O44 A;  3N8M A;  3IN7 A;  3NHN A;  1CSZ A;  4FBN A;  1CWE A;  4K11 A;  1BF5 A;  3VRY A;  2XP1 A;  2HMH A;  4F5B A;  1HCT B;  3VRQ A;  3PSK A;  1OPL A;  4L1B B;  4ROJ A;  1OO4 A;  1D4T A;  3CWG A;  3PS5 A;  1O4K A;  1O4M A;  2EO6 A;  1O4J A;  4LUD A;  4NWG A;  3OP0 A;  2PNB A;  1FMK A;  1R1P A;  3S8N A;  1QAD A;  4DGP A;  2MK2 A;  2B3O A;  1BKM A;  2QMS A;  2VIF A;  1D4W A;  2FCI A;  5IBM A;  5DC4 A;  5GJH A;  2EKX A;  2AUG A;  2ROR A;  3T04 A;  1SHA A;  2LNW A;  2Y1N A;  1F1W A;  2H46 E;  1O4I A;  1SPR A;  2CS0 A;  1AOT F;  1LKK A;  4LUE A;  1AYB A;  5D0J A;  1X0N A;  5EG3 B;  1LUI A;  3BUN B;  2HDX A;  1CWD L;  2DCR A;  3VS4 A;  3OVE A;  5EHR A;  3BKB A;  3VS5 A;  5J3X A;  1O43 A;  5HKZ A;  2YSX A;  2EYZ A;  4OHH A;  2RSY A;  1JYQ A;  1LCK A;  2EOB A;  1X6C A;  1GHU A;  3MXC A;  1G83 A;  3S9K A;  2C0O A;  4E93 A;  3CD3 A;  2C0I A;  1KC2 A;  3IMJ A;  2H8H A;  1FYR A;  4JE4 A;  1Y1U A;  5I6V A;  3MXY A;  4H34 A;  1A1A A;  1O4C A;  4K45 A;  1Y57 A;  1BG1 A;  1A1C A;  1FBZ A;  3US4 A;  2LQN A;  3K2M A;  1AYD A;  1BHF A;  1TCE A;  3EAZ A;  1D1Z A;  2ETZ A;  3HHM B;  2LNX A;  1JYR A;  1O46 A;  2ABL A;  1BKL A;  3PQZ A;  4OHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...