1A1EA

C-src (sh2 domain) complexed with ace-phosphotyr-glu-(3-butylpiperidine)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
IQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C-SRC TYROSINE KINASE
publication title Peptide ligands of pp60(c-src) SH2 domains: a thermodynamic and structural study.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (transferase/peptide)
total genus 27
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1a1eA00
5EEQA 1X0NA 2EU0A 1JYUA 3PQZA 1FU5A 3CBLA 1NZLA 1KA6A 1O4GA 3QWXX 1O48A 1CWEA 1JU5A 4NWGA 2HMHA 1RPYA 3VS1A 1YVLA 5HKZA 2HDXA 2EL8A 4K2RA 2DLZA 3GQIB 1O49A 4GWFA 2B3OA 1CJ1A 2BBUA 3S8OA 3GXWA 1PICA 4DGPA 1MILA 1CSYA 4M4ZA 3MXYA 2AOBA 3QWYA 3GXXA 2OZOA 2PLDA 4OHLA 2EOBA 1O47A 1O4IA 5DC0B 2JYQA 3VGOA 1LUNA 4JEGA 3IMDA 1BLJA 1FHSA 2DVJA 1O45A 3MXCA 1A07A 3VS3A 1OPLA 4OHDA 4QSYA 5EHPA 1H9OA 2CS0A 3EACA 2DM0A 3WA4A 2ABLA 2HDVA 4XZ0A 2PNAA 1R1QA 1AD5A 3HIZB 2LNWA 1IS0A 2ECDA 5DF6A 5I6VA 1O4MA 2H8HA 1QG1E 3UYOA 4L1BB 2EYVA 2RSYA 3N84A 2CI9A 1AOUF 4TZIA 3OV1A 1BFIA 1BLKA 3BKBA 3BUXB 1KA7A 3PJPA 1BHHA 1RJAA 4FL3A 3S8LA 1IJRA 2IUHA 3VS0A 3KFJA 3PSKA 2LCTA 2K79B 2IZVA 1AYDA 2C0OA 2Y3AB 1BFJA 1BHFA 1I3ZA 2RVFA 3S8NA 3CXLA 3PFVA 1FMKA 4A4BA 1O4PA 3M7FA 1NRVA 2OQ1A 3VRPA 3VS5A 1JWOA 2FO0A 2YU7A 1A81A 3US4A 1K9AA 2CR4A 1AYCA 1QCFA 3OB1B 2ETZA 3VS7A 3HHMB 2PLEA 1BKMA 1R1PA 4P9VA 1Y1UA 1P13A 1UUSA 1A09A 1HCSB 1BMBA 1Z3KA 2QMSA 2AOAA 3IN8A 4EIHA 1LUMA 1SPSA 2Y1NA 5EELA 2C9WA 2C0TA 1O46A 2LQWA 2GSBA 4ROJA 1LKKA 1YVHA 1F2FA 1LUKA 2YSXA 3CD3A 2KNOA 4EY0A 3PS5A 5CDWA 1O41A 4H1OA 1BG1A 1O43A 3VS2A 2MRJA 1CSZA 1MW4A 3VS4A 4A4CA 1SKJA 1GHUA 4LUDA 1A08A 1HCTB 1TCEA 2KK6A 1R1SA 1OO3A 1X6CA 1KSWA 2CIAA 3VRRA 2RMXA 1QADA 5IBMA 1NZVA 4OHIA 5J3XA 2EO6A 5DC9A 1OPKA 3C7IA 4JE4A 4X6SA 1AB2A 1O4OA 1BF5A 1BKLA 3VRYA 5DC4A 1O4CA 2H5KA 2GE9A 5AXIA 5IBSA 3VROA 3VRNA 1X27A 1O42A 3TL0A 1AOTF 1WQUA 1LKLA 2L4KA 1O4RA 1FBVA 1O4BA 2EYZA 1FU6A 1A1BA 4D8KA 4P9ZA 2EYYA 5D0JA 1LCKA 4JGHA 4F5AA 5HKYA 1O4JA 3BUNB 2DCRA 1A1AA 1BHHB 5BO4A 4K45A 1Y57A 1ZFPE 5EG3B 2MRKA 3OVEA 2RORA 2EO3A 1KC2A 1O4DA 2LNXA 4LUEA 2C0IA 2SHPA 3K2MA 1O4LA 3CWGA 2MQIA 1SHBA 1BM2A 1F1WA 1JYQA 2L6KA 1TZEE 4U17A 2K7AB 5KAZA 4H34A 1M27A 2EKXA 4FBNA 1G83A 3HCKA 1SHDA 1OO4A 2PTKA 4XZ1A 1XA6A 4OHEA 5GJHA 2AUGA 3BUOB 4GPLB 2H46E 4WWQA 4U1PA 1M61A 3OB2B 4FL2A 2SRCA 2HCKA 3TKZA 2Y1MA 1O4EA 2DLYA 5GJIA 1O4KA 1A1CA 3BUWB 4NWFA 1D4TA 3T04A 3N8MA 4OHHA 2HUWA 2IUIA 4GL9E 2IUGA 4F5BA 3MAZA 4K11A 3PSJA 2DX0A 1O4NA 3UF4A 3BUMB 1SHAA 2CI8A 1LCJA 4E93A 2VIFA 3S9KA 2CBLA 1AYAA 3IMJA 3EAZA 3VS6A 4DGXA 2XP1A 1JYRA 1O4HA 3PLFB 3ZNIA 1D1ZA 4K44A 1O4FA 1AYBA 2LQNA 1UURA 1CWDL 1O4QA 3NHNA 3OP0A 1A1EA 3N7YA 1SPRA 1RQQC 2CRHA 1FBZA 1GRIA 1B47A 2L3TA 4F59A 1D4WA 3VRQA 5EHRA 1LUIA 2MK2A 1FYRA 3IN7A 3VRZA 2PNBA 4E68A 1O4AA 1O44A 2MC1A 2FCIA 5AULA 5HKWA
chains in the Genus database with same CATH superfamily
5EEQA 1X0NA 2EU0A 1JYUA 3PQZA 1FU5A 3CBLA 1NZLA 1KA6A 1O4GA 3QWXX 1O48A 1CWEA 1JU5A 4NWGA 2HMHA 1RPYA 3VS1A 1YVLA 5HKZA 2HDXA 2EL8A 4K2RA 2DLZA 3GQIB 1O49A 4GWFA 2B3OA 1CJ1A 2BBUA 3S8OA 3GXWA 1PICA 4DGPA 1MILA 1CSYA 4M4ZA 3MXYA 2AOBA 3QWYA 3GXXA 2OZOA 2PLDA 4OHLA 2EOBA 1O47A 1O4IA 5DC0B 2JYQA 3LYVA 3VGOA 1LUNA 4JEGA 3IMDA 1BLJA 1FHSA 2DVJA 1O45A 3MXCA 1A07A 3VS3A 1OPLA 4OHDA 4QSYA 5EHPA 1H9OA 2CS0A 3EACA 2DM0A 3WA4A 2ABLA 2HDVA 4XZ0A 2PNAA 1R1QA 1AD5A 3HIZB 2LNWA 1IS0A 2ECDA 5DF6A 5I6VA 1O4MA 2H8HA 1QG1E 3UYOA 4L1BB 2EYVA 2RSYA 3N84A 2CI9A 1AOUF 4TZIA 3OV1A 1BFIA 2LRAA 1BLKA 3BKBA 3BUXB 1KA7A 3PJPA 1BHHA 1RJAA 4FL3A 3S8LA 1IJRA 2IUHA 3VS0A 3KFJA 3PSKA 2LCTA 2K79B 2IZVA 1AYDA 2C0OA 2Y3AB 1BFJA 1BHFA 1I3ZA 2RVFA 3S8NA 3CXLA 3PFVA 1FMKA 4A4BA 1O4PA 3M7FA 1NRVA 2OQ1A 3VRPA 3VS5A 1JWOA 2FO0A 2YU7A 1A81A 3US4A 1K9AA 2CR4A 1AYCA 1QCFA 3OB1B 2ETZA 3VS7A 3HHMB 2PLEA 1BKMA 1R1PA 4P9VA 1Y1UA 1P13A 1UUSA 1A09A 1HCSB 1BMBA 1Z3KA 2QMSA 2AOAA 3IN8A 4EIHA 1LUMA 1SPSA 2Y1NA 5EELA 2C9WA 2C0TA 1O46A 2LQWA 2GSBA 4ROJA 1LKKA 1YVHA 1F2FA 1LUKA 2YSXA 3CD3A 2KNOA 4EY0A 3PS5A 5CDWA 1O41A 4H1OA 1BG1A 1O43A 3VS2A 2MRJA 1CSZA 1MW4A 3VS4A 4A4CA 1SKJA 1GHUA 4LUDA 1A08A 1HCTB 1TCEA 2KK6A 1R1SA 1OO3A 1X6CA 1KSWA 2CIAA 3VRRA 2RMXA 1QADA 5IBMA 1NZVA 4OHIA 5J3XA 2EO6A 5DC9A 1OPKA 3C7IA 4JE4A 4X6SA 1AB2A 1O4OA 1BF5A 1BKLA 3VRYA 5DC4A 1O4CA 2H5KA 2GE9A 5AXIA 5IBSA 3VROA 3VRNA 1X27A 1O42A 3TL0A 1AOTF 1WQUA 1LKLA 2L4KA 1O4RA 1FBVA 1O4BA 2EYZA 1FU6A 1A1BA 4D8KA 4P9ZA 2EYYA 5D0JA 1LCKA 4JGHA 4F5AA 5HKYA 1O4JA 3BUNB 2DCRA 1A1AA 1BHHB 5BO4A 4K45A 1Y57A 1ZFPE 5EG3B 2MRKA 3OVEA 2RORA 2EO3A 1KC2A 1O4DA 2LNXA 4LUEA 2C0IA 2SHPA 3K2MA 1O4LA 3CWGA 2MQIA 1SHBA 1BM2A 1F1WA 1JYQA 2L6KA 1TZEE 4U17A 2K7AB 5KAZA 4H34A 1M27A 2EKXA 4FBNA 1G83A 3HCKA 1SHDA 1OO4A 2PTKA 4XZ1A 1XA6A 4OHEA 5GJHA 2AUGA 3BUOB 4GPLB 2H46E 4WWQA 4U1PA 1M61A 3OB2B 4FL2A 2SRCA 2HCKA 3TKZA 2Y1MA 1O4EA 2DLYA 5GJIA 1O4KA 1A1CA 3BUWB 4NWFA 1D4TA 3T04A 3N8MA 4OHHA 2HUWA 2IUIA 4GL9E 2IUGA 4F5BA 3MAZA 4K11A 3PSJA 2DX0A 1O4NA 3UF4A 3BUMB 1SHAA 2CI8A 1LCJA 4E93A 2VIFA 3S9KA 2CBLA 1AYAA 3IMJA 3EAZA 3VS6A 4DGXA 2XP1A 1JYRA 1O4HA 3PLFB 2KGYA 3ZNIA 1D1ZA 4K44A 1O4FA 1AYBA 2LQNA 1UURA 1CWDL 1O4QA 3K2TA 3NHNA 3OP0A 1A1EA 3N7YA 1SPRA 1RQQC 2CRHA 1FBZA 1GRIA 1B47A 2L3TA 4F59A 1D4WA 3VRQA 5EHRA 1LUIA 2MK2A 1FYRA 3IN7A 3VRZA 2PNBA 4E68A 1O4AA 1O44A 2MC1A 2FCIA 5AULA 5HKWA
chains in the Genus database with same CATH topology
5EEQA 1X0NA 2EU0A 1JYUA 3PQZA 1FU5A 3CBLA 1NZLA 1KA6A 1O4GA 3QWXX 1O48A 1CWEA 1JU5A 4NWGA 2HMHA 1RPYA 3VS1A 1YVLA 5HKZA 2HDXA 2EL8A 4K2RA 2DLZA 3GQIB 1O49A 4GWFA 2B3OA 1CJ1A 2BBUA 3S8OA 3GXWA 1PICA 4DGPA 1MILA 1CSYA 4M4ZA 3MXYA 2AOBA 3QWYA 3GXXA 2OZOA 2PLDA 4OHLA 2EOBA 1O47A 1O4IA 5DC0B 2JYQA 3VGOA 1LUNA 4JEGA 3IMDA 1BLJA 1FHSA 2DVJA 1O45A 3MXCA 1A07A 3VS3A 1OPLA 4OHDA 4QSYA 5EHPA 1H9OA 2CS0A 3EACA 2DM0A 3WA4A 2ABLA 2HDVA 4XZ0A 2PNAA 1R1QA 1AD5A 3HIZB 2LNWA 1IS0A 2ECDA 5DF6A 5I6VA 1O4MA 2H8HA 1QG1E 3UYOA 4L1BB 2EYVA 2RSYA 3N84A 2CI9A 1AOUF 4TZIA 3OV1A 1BFIA 1BLKA 3BKBA 3BUXB 1KA7A 3PJPA 1BHHA 1RJAA 4FL3A 3S8LA 1IJRA 2IUHA 3VS0A 3KFJA 3PSKA 2LCTA 2K79B 2IZVA 1AYDA 2C0OA 2Y3AB 1BFJA 1BHFA 1I3ZA 2RVFA 3S8NA 3CXLA 3PFVA 1FMKA 4A4BA 1O4PA 3M7FA 1NRVA 2OQ1A 3VRPA 3VS5A 1JWOA 2FO0A 2YU7A 1A81A 3US4A 1K9AA 2CR4A 1AYCA 1QCFA 3OB1B 2ETZA 3VS7A 3HHMB 2PLEA 1BKMA 1R1PA 4P9VA 1Y1UA 1P13A 1UUSA 1A09A 1HCSB 1BMBA 1Z3KA 2QMSA 2AOAA 3IN8A 4EIHA 1LUMA 1SPSA 2Y1NA 5EELA 2C9WA 2C0TA 1O46A 2LQWA 2GSBA 4ROJA 1LKKA 1YVHA 1F2FA 1LUKA 2YSXA 3CD3A 2KNOA 4EY0A 3PS5A 5CDWA 1O41A 4H1OA 1BG1A 1O43A 3VS2A 2MRJA 1CSZA 1MW4A 3VS4A 4A4CA 1SKJA 1GHUA 4LUDA 1A08A 1HCTB 1TCEA 2KK6A 1R1SA 1OO3A 1X6CA 1KSWA 2CIAA 3VRRA 2RMXA 1QADA 5IBMA 1NZVA 4OHIA 5J3XA 2EO6A 5DC9A 1OPKA 3C7IA 4JE4A 4X6SA 1AB2A 1O4OA 1BF5A 1BKLA 3VRYA 5DC4A 1O4CA 2H5KA 2GE9A 5AXIA 5IBSA 3VROA 3VRNA 1X27A 1O42A 3TL0A 1AOTF 1WQUA 1LKLA 2L4KA 1O4RA 1FBVA 1O4BA 2EYZA 1FU6A 1A1BA 4D8KA 4P9ZA 2EYYA 5D0JA 1LCKA 4JGHA 4F5AA 5HKYA 1O4JA 3BUNB 2DCRA 1A1AA 1BHHB 5BO4A 4K45A 1Y57A 1ZFPE 5EG3B 2MRKA 3OVEA 2RORA 2EO3A 1KC2A 1O4DA 2LNXA 4LUEA 2C0IA 2SHPA 3K2MA 1O4LA 3CWGA 2MQIA 1SHBA 1BM2A 1F1WA 1JYQA 2L6KA 1TZEE 4U17A 2K7AB 5KAZA 4H34A 1M27A 2EKXA 4FBNA 1G83A 3HCKA 1SHDA 1OO4A 2PTKA 4XZ1A 1XA6A 4OHEA 5GJHA 2AUGA 3BUOB 4GPLB 2H46E 4WWQA 4U1PA 1M61A 3OB2B 4FL2A 2SRCA 2HCKA 3TKZA 2Y1MA 1O4EA 2DLYA 5GJIA 1O4KA 1A1CA 3BUWB 4NWFA 1D4TA 3T04A 3N8MA 4OHHA 2HUWA 2IUIA 4GL9E 2IUGA 4F5BA 3MAZA 4K11A 3PSJA 2DX0A 1O4NA 3UF4A 3BUMB 1SHAA 2CI8A 1LCJA 4E93A 2VIFA 3S9KA 2CBLA 1AYAA 3IMJA 3EAZA 3VS6A 4DGXA 2XP1A 1JYRA 1O4HA 3PLFB 3ZNIA 1D1ZA 4K44A 1O4FA 1AYBA 2LQNA 1UURA 1CWDL 1O4QA 3NHNA 3OP0A 1A1EA 3N7YA 1SPRA 1RQQC 2CRHA 1FBZA 1GRIA 1B47A 2L3TA 4F59A 1D4WA 3VRQA 5EHRA 1LUIA 2MK2A 1FYRA 3IN7A 3VRZA 2PNBA 4E68A 1O4AA 1O44A 2MC1A 2FCIA 5AULA 5HKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EEQ A;  1X0N A;  2EU0 A;  1JYU A;  3PQZ A;  1FU5 A;  3CBL A;  1NZL A;  1KA6 A;  1O4G A;  3QWX X;  1O48 A;  1CWE A;  1JU5 A;  4NWG A;  2HMH A;  1RPY A;  3VS1 A;  1YVL A;  5HKZ A;  2HDX A;  2EL8 A;  4K2R A;  2DLZ A;  3GQI B;  1O49 A;  4GWF A;  2B3O A;  1CJ1 A;  2BBU A;  3S8O A;  3GXW A;  1PIC A;  4DGP A;  1MIL A;  1CSY A;  4M4Z A;  3MXY A;  2AOB A;  3QWY A;  3GXX A;  2OZO A;  2PLD A;  4OHL A;  2EOB A;  1O47 A;  1O4I A;  5DC0 B;  2JYQ A;  3VGO A;  1LUN A;  4JEG A;  3IMD A;  1BLJ A;  1FHS A;  2DVJ A;  1O45 A;  3MXC A;  1A07 A;  3VS3 A;  1OPL A;  4OHD A;  4QSY A;  5EHP A;  1H9O A;  2CS0 A;  3EAC A;  2DM0 A;  3WA4 A;  2ABL A;  2HDV A;  4XZ0 A;  2PNA A;  1R1Q A;  1AD5 A;  3HIZ B;  2LNW A;  1IS0 A;  2ECD A;  5DF6 A;  5I6V A;  1O4M A;  2H8H A;  1QG1 E;  3UYO A;  4L1B B;  2EYV A;  2RSY A;  3N84 A;  2CI9 A;  1AOU F;  4TZI A;  3OV1 A;  1BFI A;  1BLK A;  3BKB A;  3BUX B;  1KA7 A;  3PJP A;  1BHH A;  1RJA A;  4FL3 A;  3S8L A;  1IJR A;  2IUH A;  3VS0 A;  3KFJ A;  3PSK A;  2LCT A;  2K79 B;  2IZV A;  1AYD A;  2C0O A;  2Y3A B;  1BFJ A;  1BHF A;  1I3Z A;  2RVF A;  3S8N A;  3CXL A;  3PFV A;  1FMK A;  4A4B A;  1O4P A;  3M7F A;  1NRV A;  2OQ1 A;  3VRP A;  3VS5 A;  1JWO A;  2FO0 A;  2YU7 A;  1A81 A;  3US4 A;  1K9A A;  2CR4 A;  1AYC A;  1QCF A;  3OB1 B;  2ETZ A;  3VS7 A;  3HHM B;  2PLE A;  1BKM A;  1R1P A;  4P9V A;  1Y1U A;  1P13 A;  1UUS A;  1A09 A;  1HCS B;  1BMB A;  1Z3K A;  2QMS A;  2AOA A;  3IN8 A;  4EIH A;  1LUM A;  1SPS A;  2Y1N A;  5EEL A;  2C9W A;  2C0T A;  1O46 A;  2LQW A;  2GSB A;  4ROJ A;  1LKK A;  1YVH A;  1F2F A;  1LUK A;  2YSX A;  3CD3 A;  2KNO A;  4EY0 A;  3PS5 A;  5CDW A;  1O41 A;  4H1O A;  1BG1 A;  1O43 A;  3VS2 A;  2MRJ A;  1CSZ A;  1MW4 A;  3VS4 A;  4A4C A;  1SKJ A;  1GHU A;  4LUD A;  1A08 A;  1HCT B;  1TCE A;  2KK6 A;  1R1S A;  1OO3 A;  1X6C A;  1KSW A;  2CIA A;  3VRR A;  2RMX A;  1QAD A;  5IBM A;  1NZV A;  4OHI A;  5J3X A;  2EO6 A;  5DC9 A;  1OPK A;  3C7I A;  4JE4 A;  4X6S A;  1AB2 A;  1O4O A;  1BF5 A;  1BKL A;  3VRY A;  5DC4 A;  1O4C A;  2H5K A;  2GE9 A;  5AXI A;  5IBS A;  3VRO A;  3VRN A;  1X27 A;  1O42 A;  3TL0 A;  1AOT F;  1WQU A;  1LKL A;  2L4K A;  1O4R A;  1FBV A;  1O4B A;  2EYZ A;  1FU6 A;  1A1B A;  4D8K A;  4P9Z A;  2EYY A;  5D0J A;  1LCK A;  4JGH A;  4F5A A;  5HKY A;  1O4J A;  3BUN B;  2DCR A;  1A1A A;  1BHH B;  5BO4 A;  4K45 A;  1Y57 A;  1ZFP E;  5EG3 B;  2MRK A;  3OVE A;  2ROR A;  2EO3 A;  1KC2 A;  1O4D A;  2LNX A;  4LUE A;  2C0I A;  2SHP A;  3K2M A;  1O4L A;  3CWG A;  2MQI A;  1SHB A;  1BM2 A;  1F1W A;  1JYQ A;  2L6K A;  1TZE E;  4U17 A;  2K7A B;  5KAZ A;  4H34 A;  1M27 A;  2EKX A;  4FBN A;  1G83 A;  3HCK A;  1SHD A;  1OO4 A;  2PTK A;  4XZ1 A;  1XA6 A;  4OHE A;  5GJH A;  2AUG A;  3BUO B;  4GPL B;  2H46 E;  4WWQ A;  4U1P A;  1M61 A;  3OB2 B;  4FL2 A;  2SRC A;  2HCK A;  3TKZ A;  2Y1M A;  1O4E A;  2DLY A;  5GJI A;  1O4K A;  1A1C A;  3BUW B;  4NWF A;  1D4T A;  3T04 A;  3N8M A;  4OHH A;  2HUW A;  2IUI A;  4GL9 E;  2IUG A;  4F5B A;  3MAZ A;  4K11 A;  3PSJ A;  2DX0 A;  1O4N A;  3UF4 A;  3BUM B;  1SHA A;  2CI8 A;  1LCJ A;  4E93 A;  2VIF A;  3S9K A;  2CBL A;  1AYA A;  3IMJ A;  3EAZ A;  3VS6 A;  4DGX A;  2XP1 A;  1JYR A;  1O4H A;  3PLF B;  3ZNI A;  1D1Z A;  4K44 A;  1O4F A;  1AYB A;  2LQN A;  1UUR A;  1CWD L;  1O4Q A;  3NHN A;  3OP0 A;  1A1E A;  3N7Y A;  1SPR A;  1RQQ C;  2CRH A;  1FBZ A;  1GRI A;  1B47 A;  2L3T A;  4F59 A;  1D4W A;  3VRQ A;  5EHR A;  1LUI A;  2MK2 A;  1FYR A;  3IN7 A;  3VRZ A;  2PNB A;  4E68 A;  1O4A A;  1O44 A;  2MC1 A;  2FCI A;  5AUL A;  5HKW A; 
#chains in the Genus database with same CATH topology
 5EEQ A;  1X0N A;  2EU0 A;  1JYU A;  3PQZ A;  1FU5 A;  3CBL A;  1NZL A;  1KA6 A;  1O4G A;  3QWX X;  1O48 A;  1CWE A;  1JU5 A;  4NWG A;  2HMH A;  1RPY A;  3VS1 A;  1YVL A;  5HKZ A;  2HDX A;  2EL8 A;  4K2R A;  2DLZ A;  3GQI B;  1O49 A;  4GWF A;  2B3O A;  1CJ1 A;  2BBU A;  3S8O A;  3GXW A;  1PIC A;  4DGP A;  1MIL A;  1CSY A;  4M4Z A;  3MXY A;  2AOB A;  3QWY A;  3GXX A;  2OZO A;  2PLD A;  4OHL A;  2EOB A;  1O47 A;  1O4I A;  5DC0 B;  2JYQ A;  3LYV A;  3VGO A;  1LUN A;  4JEG A;  3IMD A;  1BLJ A;  1FHS A;  2DVJ A;  1O45 A;  3MXC A;  1A07 A;  3VS3 A;  1OPL A;  4OHD A;  4QSY A;  5EHP A;  1H9O A;  2CS0 A;  3EAC A;  2DM0 A;  3WA4 A;  2ABL A;  2HDV A;  4XZ0 A;  2PNA A;  1R1Q A;  1AD5 A;  3HIZ B;  2LNW A;  1IS0 A;  2ECD A;  5DF6 A;  5I6V A;  1O4M A;  2H8H A;  1QG1 E;  3UYO A;  4L1B B;  2EYV A;  2RSY A;  3N84 A;  2CI9 A;  1AOU F;  4TZI A;  3OV1 A;  1BFI A;  2LRA A;  1BLK A;  3BKB A;  3BUX B;  1KA7 A;  3PJP A;  1BHH A;  1RJA A;  4FL3 A;  3S8L A;  1IJR A;  2IUH A;  3VS0 A;  3KFJ A;  3PSK A;  2LCT A;  2K79 B;  2IZV A;  1AYD A;  2C0O A;  2Y3A B;  1BFJ A;  1BHF A;  1I3Z A;  2RVF A;  3S8N A;  3CXL A;  3PFV A;  1FMK A;  4A4B A;  1O4P A;  3M7F A;  1NRV A;  2OQ1 A;  3VRP A;  3VS5 A;  1JWO A;  2FO0 A;  2YU7 A;  1A81 A;  3US4 A;  1K9A A;  2CR4 A;  1AYC A;  1QCF A;  3OB1 B;  2ETZ A;  3VS7 A;  3HHM B;  2PLE A;  1BKM A;  1R1P A;  4P9V A;  1Y1U A;  1P13 A;  1UUS A;  1A09 A;  1HCS B;  1BMB A;  1Z3K A;  2QMS A;  2AOA A;  3IN8 A;  4EIH A;  1LUM A;  1SPS A;  2Y1N A;  5EEL A;  2C9W A;  2C0T A;  1O46 A;  2LQW A;  2GSB A;  4ROJ A;  1LKK A;  1YVH A;  1F2F A;  1LUK A;  2YSX A;  3CD3 A;  2KNO A;  4EY0 A;  3PS5 A;  5CDW A;  1O41 A;  4H1O A;  1BG1 A;  1O43 A;  3VS2 A;  2MRJ A;  1CSZ A;  1MW4 A;  3VS4 A;  4A4C A;  1SKJ A;  1GHU A;  4LUD A;  1A08 A;  1HCT B;  1TCE A;  2KK6 A;  1R1S A;  1OO3 A;  1X6C A;  1KSW A;  2CIA A;  3VRR A;  2RMX A;  1QAD A;  5IBM A;  1NZV A;  4OHI A;  5J3X A;  2EO6 A;  5DC9 A;  1OPK A;  3C7I A;  4JE4 A;  4X6S A;  1AB2 A;  1O4O A;  1BF5 A;  1BKL A;  3VRY A;  5DC4 A;  1O4C A;  2H5K A;  2GE9 A;  5AXI A;  5IBS A;  3VRO A;  3VRN A;  1X27 A;  1O42 A;  3TL0 A;  1AOT F;  1WQU A;  1LKL A;  2L4K A;  1O4R A;  1FBV A;  1O4B A;  2EYZ A;  1FU6 A;  1A1B A;  4D8K A;  4P9Z A;  2EYY A;  5D0J A;  1LCK A;  4JGH A;  4F5A A;  5HKY A;  1O4J A;  3BUN B;  2DCR A;  1A1A A;  1BHH B;  5BO4 A;  4K45 A;  1Y57 A;  1ZFP E;  5EG3 B;  2MRK A;  3OVE A;  2ROR A;  2EO3 A;  1KC2 A;  1O4D A;  2LNX A;  4LUE A;  2C0I A;  2SHP A;  3K2M A;  1O4L A;  3CWG A;  2MQI A;  1SHB A;  1BM2 A;  1F1W A;  1JYQ A;  2L6K A;  1TZE E;  4U17 A;  2K7A B;  5KAZ A;  4H34 A;  1M27 A;  2EKX A;  4FBN A;  1G83 A;  3HCK A;  1SHD A;  1OO4 A;  2PTK A;  4XZ1 A;  1XA6 A;  4OHE A;  5GJH A;  2AUG A;  3BUO B;  4GPL B;  2H46 E;  4WWQ A;  4U1P A;  1M61 A;  3OB2 B;  4FL2 A;  2SRC A;  2HCK A;  3TKZ A;  2Y1M A;  1O4E A;  2DLY A;  5GJI A;  1O4K A;  1A1C A;  3BUW B;  4NWF A;  1D4T A;  3T04 A;  3N8M A;  4OHH A;  2HUW A;  2IUI A;  4GL9 E;  2IUG A;  4F5B A;  3MAZ A;  4K11 A;  3PSJ A;  2DX0 A;  1O4N A;  3UF4 A;  3BUM B;  1SHA A;  2CI8 A;  1LCJ A;  4E93 A;  2VIF A;  3S9K A;  2CBL A;  1AYA A;  3IMJ A;  3EAZ A;  3VS6 A;  4DGX A;  2XP1 A;  1JYR A;  1O4H A;  3PLF B;  2KGY A;  3ZNI A;  1D1Z A;  4K44 A;  1O4F A;  1AYB A;  2LQN A;  1UUR A;  1CWD L;  1O4Q A;  3K2T A;  3NHN A;  3OP0 A;  1A1E A;  3N7Y A;  1SPR A;  1RQQ C;  2CRH A;  1FBZ A;  1GRI A;  1B47 A;  2L3T A;  4F59 A;  1D4W A;  3VRQ A;  5EHR A;  1LUI A;  2MK2 A;  1FYR A;  3IN7 A;  3VRZ A;  2PNB A;  4E68 A;  1O4A A;  1O44 A;  2MC1 A;  2FCI A;  5AUL A;  5HKW A; 
#chains in the Genus database with same CATH homology
 5EEQ A;  1X0N A;  2EU0 A;  1JYU A;  3PQZ A;  1FU5 A;  3CBL A;  1NZL A;  1KA6 A;  1O4G A;  3QWX X;  1O48 A;  1CWE A;  1JU5 A;  4NWG A;  2HMH A;  1RPY A;  3VS1 A;  1YVL A;  5HKZ A;  2HDX A;  2EL8 A;  4K2R A;  2DLZ A;  3GQI B;  1O49 A;  4GWF A;  2B3O A;  1CJ1 A;  2BBU A;  3S8O A;  3GXW A;  1PIC A;  4DGP A;  1MIL A;  1CSY A;  4M4Z A;  3MXY A;  2AOB A;  3QWY A;  3GXX A;  2OZO A;  2PLD A;  4OHL A;  2EOB A;  1O47 A;  1O4I A;  5DC0 B;  2JYQ A;  3VGO A;  1LUN A;  4JEG A;  3IMD A;  1BLJ A;  1FHS A;  2DVJ A;  1O45 A;  3MXC A;  1A07 A;  3VS3 A;  1OPL A;  4OHD A;  4QSY A;  5EHP A;  1H9O A;  2CS0 A;  3EAC A;  2DM0 A;  3WA4 A;  2ABL A;  2HDV A;  4XZ0 A;  2PNA A;  1R1Q A;  1AD5 A;  3HIZ B;  2LNW A;  1IS0 A;  2ECD A;  5DF6 A;  5I6V A;  1O4M A;  2H8H A;  1QG1 E;  3UYO A;  4L1B B;  2EYV A;  2RSY A;  3N84 A;  2CI9 A;  1AOU F;  4TZI A;  3OV1 A;  1BFI A;  1BLK A;  3BKB A;  3BUX B;  1KA7 A;  3PJP A;  1BHH A;  1RJA A;  4FL3 A;  3S8L A;  1IJR A;  2IUH A;  3VS0 A;  3KFJ A;  3PSK A;  2LCT A;  2K79 B;  2IZV A;  1AYD A;  2C0O A;  2Y3A B;  1BFJ A;  1BHF A;  1I3Z A;  2RVF A;  3S8N A;  3CXL A;  3PFV A;  1FMK A;  4A4B A;  1O4P A;  3M7F A;  1NRV A;  2OQ1 A;  3VRP A;  3VS5 A;  1JWO A;  2FO0 A;  2YU7 A;  1A81 A;  3US4 A;  1K9A A;  2CR4 A;  1AYC A;  1QCF A;  3OB1 B;  2ETZ A;  3VS7 A;  3HHM B;  2PLE A;  1BKM A;  1R1P A;  4P9V A;  1Y1U A;  1P13 A;  1UUS A;  1A09 A;  1HCS B;  1BMB A;  1Z3K A;  2QMS A;  2AOA A;  3IN8 A;  4EIH A;  1LUM A;  1SPS A;  2Y1N A;  5EEL A;  2C9W A;  2C0T A;  1O46 A;  2LQW A;  2GSB A;  4ROJ A;  1LKK A;  1YVH A;  1F2F A;  1LUK A;  2YSX A;  3CD3 A;  2KNO A;  4EY0 A;  3PS5 A;  5CDW A;  1O41 A;  4H1O A;  1BG1 A;  1O43 A;  3VS2 A;  2MRJ A;  1CSZ A;  1MW4 A;  3VS4 A;  4A4C A;  1SKJ A;  1GHU A;  4LUD A;  1A08 A;  1HCT B;  1TCE A;  2KK6 A;  1R1S A;  1OO3 A;  1X6C A;  1KSW A;  2CIA A;  3VRR A;  2RMX A;  1QAD A;  5IBM A;  1NZV A;  4OHI A;  5J3X A;  2EO6 A;  5DC9 A;  1OPK A;  3C7I A;  4JE4 A;  4X6S A;  1AB2 A;  1O4O A;  1BF5 A;  1BKL A;  3VRY A;  5DC4 A;  1O4C A;  2H5K A;  2GE9 A;  5AXI A;  5IBS A;  3VRO A;  3VRN A;  1X27 A;  1O42 A;  3TL0 A;  1AOT F;  1WQU A;  1LKL A;  2L4K A;  1O4R A;  1FBV A;  1O4B A;  2EYZ A;  1FU6 A;  1A1B A;  4D8K A;  4P9Z A;  2EYY A;  5D0J A;  1LCK A;  4JGH A;  4F5A A;  5HKY A;  1O4J A;  3BUN B;  2DCR A;  1A1A A;  1BHH B;  5BO4 A;  4K45 A;  1Y57 A;  1ZFP E;  5EG3 B;  2MRK A;  3OVE A;  2ROR A;  2EO3 A;  1KC2 A;  1O4D A;  2LNX A;  4LUE A;  2C0I A;  2SHP A;  3K2M A;  1O4L A;  3CWG A;  2MQI A;  1SHB A;  1BM2 A;  1F1W A;  1JYQ A;  2L6K A;  1TZE E;  4U17 A;  2K7A B;  5KAZ A;  4H34 A;  1M27 A;  2EKX A;  4FBN A;  1G83 A;  3HCK A;  1SHD A;  1OO4 A;  2PTK A;  4XZ1 A;  1XA6 A;  4OHE A;  5GJH A;  2AUG A;  3BUO B;  4GPL B;  2H46 E;  4WWQ A;  4U1P A;  1M61 A;  3OB2 B;  4FL2 A;  2SRC A;  2HCK A;  3TKZ A;  2Y1M A;  1O4E A;  2DLY A;  5GJI A;  1O4K A;  1A1C A;  3BUW B;  4NWF A;  1D4T A;  3T04 A;  3N8M A;  4OHH A;  2HUW A;  2IUI A;  4GL9 E;  2IUG A;  4F5B A;  3MAZ A;  4K11 A;  3PSJ A;  2DX0 A;  1O4N A;  3UF4 A;  3BUM B;  1SHA A;  2CI8 A;  1LCJ A;  4E93 A;  2VIF A;  3S9K A;  2CBL A;  1AYA A;  3IMJ A;  3EAZ A;  3VS6 A;  4DGX A;  2XP1 A;  1JYR A;  1O4H A;  3PLF B;  3ZNI A;  1D1Z A;  4K44 A;  1O4F A;  1AYB A;  2LQN A;  1UUR A;  1CWD L;  1O4Q A;  3NHN A;  3OP0 A;  1A1E A;  3N7Y A;  1SPR A;  1RQQ C;  2CRH A;  1FBZ A;  1GRI A;  1B47 A;  2L3T A;  4F59 A;  1D4W A;  3VRQ A;  5EHR A;  1LUI A;  2MK2 A;  1FYR A;  3IN7 A;  3VRZ A;  2PNB A;  4E68 A;  1O4A A;  1O44 A;  2MC1 A;  2FCI A;  5AUL A;  5HKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...