1MW4A

Solution structure of the human grb7-sh2 domain in complex with a 10 amino acid peptide py1139
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
120
structure length
120
Chain Sequence
GSPASGTSLSAAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth factor receptor-bound protein 7
publication title Solution structure of the human Grb7-SH2 domain/erbB2 peptide complex and structural basis for Grb7 binding to ErbB2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor/transferase
total genus 17
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2002-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1mw4A00
4NWGA 1O4AA 1BHFA 3UYOA 4OHEA 1AB2A 1RJAA 2L4KA 4XZ1A 1O4IA 1GRIA 1O4BA 1R1PA 3OB1B 1SPRA 1AYCA 1O4PA 1H9OA 1RQQC 1D4TA 1MW4A 2DX0A 4E68A 3VS7A 1M27A 3HCKA 1FMKA 2YU7A 4F5AA 4LUDA 3IN7A 1X27A 1P13A 1BHHA 3BUWB 3S8LA 1KA7A 1TZEE 3K2MA 2EYZA 2ABLA 2DVJA 5KAZA 1HCTB 1O42A 4P9VA 1NZLA 3EAZA 1OO3A 5J3XA 3IN8A 4QSYA 2HCKA 2IZVA 1O41A 3PFVA 2DM0A 2LCTA 1ZFPE 4A4CA 1AYAA 5EG3B 1O44A 1D4WA 2C9WA 3VRZA 3CBLA 1FU6A 3ZNIA 1A1BA 1YVLA 4FL3A 4K11A 1LUNA 2HMHA 3GXXA 2K79B 1LCKA 3EACA 2LNWA 1RPYA 2XP1A 2KK6A 4FBNA 1LUKA 1O4JA 4OHIA 1LKKA 3CWGA 1X0NA 2EKXA 1BHHB 2CRHA 5I6VA 3N8MA 3OV1A 1NZVA 2EYVA 2OZOA 1TCEA 3WA4A 5DC0B 2IUIA 4GPLB 2PTKA 1GHUA 3MAZA 1OPKA 3BUMB 1Z3KA 2DLZA 2EOBA 2GSBA 3VS0A 2CR4A 2EO6A 2EO3A 3VRPA 2EYYA 1A09A 2RVFA 3PQZA 2YSXA 1LCJA 1O4QA 2SRCA 4GWFA 1BKLA 1UURA 3HIZB 3IMDA 1KSWA 5EELA 4P9ZA 1O43A 5EEQA 3C7IA 4NWFA 2JYQA 4DGXA 1O46A 2FCIA 3M7FA 3S8NA 4F59A 3VS4A 1KC2A 2MRJA 2PLEA 1A1CA 1AOUF 3BUOB 3CD3A 2PNAA 4K44A 2RMXA 1BFJA 2L6KA 5DC4A 5DC9A 3BKBA 2DCRA 3VS1A 1I3ZA 3QWXX 4K2RA 3T04A 2K7AB 1LKLA 1CSZA 1JYRA 2CS0A 1BLJA 3TL0A 1A1EA 2Y1NA 1BF5A 2IUGA 1SHAA 1FU5A 2AOAA 2CIAA 2CI8A 4LUEA 1O4GA 1CJ1A 1FHSA 1O48A 3OVEA 1O4EA 1O4KA 3GQIB 1BM2A 1YVHA 2CI9A 1OO4A 1LUIA 1KA6A 2MQIA 4JEGA 2DLYA 2ECDA 3HHMB 1BLKA 4OHHA 3OB2B 5DF6A 4A4BA 1A1AA 5IBMA 1O4HA 3MXYA 2HDXA 1O4LA 3VS5A 5BO4A 2MK2A 2GE9A 2H46E 5GJIA 3BUXB 3CXLA 1A07A 1G83A 2MC1A 4JGHA 2QMSA 5HKWA 4L1BB 4DGPA 2CBLA 2C0OA 1SPSA 2Y1MA 4E93A 2H5KA 1BKMA 1FBVA 2RORA 3VRQA 3VS2A 4ROJA 4TZIA 1O4MA 4H34A 1BG1A 3S8OA 1JYUA 2B3OA 1BFIA 4JE4A 1AYBA 5AXIA 2LNXA 1D1ZA 2C0TA 1JWOA 5CDWA 3VS6A 3QWYA 3BUNB 1Y57A 1R1QA 4EIHA 3VRRA 2Y3AB 5HKZA 1O4NA 1PICA 4D8KA 1IJRA 3VROA 2OQ1A 3VGOA 1SKJA 1AOTF 2SHPA 1OPLA 4H1OA 5GJHA 1AD5A 5HKYA 2LQWA 3PJPA 3GXWA 3VRNA 1A81A 5AULA 1O45A 2EL8A 1A08A 3VRYA 1O4CA 1O4RA 1O4FA 1CSYA 2BBUA 1QG1E 1QCFA 3IMJA 3KFJA 5EHRA 3PSJA 4M4ZA 3VS3A 1CWEA 1AYDA 2EU0A 5EHPA 1Y1UA 5D0JA 2MRKA 4OHDA 3TKZA 3US4A 1SHDA 1WQUA 3PLFB 1FYRA 3UF4A 1O47A 2KNOA 3OP0A 2H8HA 1MILA 2ETZA 2HUWA 3MXCA 2AUGA 1UUSA 1FBZA 1LUMA 2FO0A 4FL2A 1O4OA 2C0IA 2RSYA 4U17A 1HCSB 1IS0A 4K45A 2HDVA 1M61A 1X6CA 5IBSA 2LQNA 4F5BA 4XZ0A 1O4DA 2L3TA 4EY0A 4U1PA 1JU5A 1R1SA 1F2FA 1O49A 3S9KA 4WWQA 1SHBA 2PLDA 1K9AA 4GL9E 1F1WA 4X6SA 1JYQA 3N7YA 1BMBA 3PSKA 1NRVA 3N84A 2PNBA 2VIFA 2IUHA 2AOBA 1XA6A 1QADA 3NHNA 1CWDL 4OHLA 1B47A 3PS5A
chains in the Genus database with same CATH superfamily
4NWGA 1O4AA 1BHFA 3UYOA 4OHEA 1AB2A 1RJAA 2L4KA 4XZ1A 1O4IA 1GRIA 1O4BA 1R1PA 3OB1B 1SPRA 1AYCA 1O4PA 1H9OA 1RQQC 1D4TA 1MW4A 2DX0A 4E68A 3VS7A 1M27A 3HCKA 1FMKA 2YU7A 4F5AA 4LUDA 3IN7A 1X27A 1P13A 1BHHA 3BUWB 3S8LA 1KA7A 1TZEE 3K2MA 2EYZA 2ABLA 2DVJA 5KAZA 1HCTB 1O42A 4P9VA 1NZLA 3EAZA 1OO3A 5J3XA 3IN8A 4QSYA 2HCKA 2IZVA 1O41A 3PFVA 2DM0A 2LCTA 1ZFPE 4A4CA 1AYAA 5EG3B 1O44A 1D4WA 2C9WA 3VRZA 3CBLA 1FU6A 3ZNIA 1A1BA 1YVLA 4FL3A 4K11A 1LUNA 2HMHA 3GXXA 2K79B 1LCKA 3EACA 2LNWA 1RPYA 2XP1A 2KK6A 4FBNA 1LUKA 1O4JA 4OHIA 1LKKA 3CWGA 1X0NA 2EKXA 1BHHB 2CRHA 5I6VA 3N8MA 3OV1A 1NZVA 2EYVA 2OZOA 1TCEA 3WA4A 5DC0B 2KGYA 2IUIA 4GPLB 2PTKA 1GHUA 3MAZA 1OPKA 3BUMB 1Z3KA 2DLZA 2EOBA 2GSBA 3VS0A 2CR4A 2EO6A 2EO3A 3VRPA 2EYYA 1A09A 2RVFA 3PQZA 2YSXA 1LCJA 1O4QA 2SRCA 4GWFA 1BKLA 1UURA 3HIZB 3IMDA 1KSWA 5EELA 4P9ZA 1O43A 5EEQA 3C7IA 4NWFA 2JYQA 4DGXA 1O46A 2FCIA 3M7FA 3S8NA 4F59A 3VS4A 1KC2A 2MRJA 2PLEA 1A1CA 1AOUF 3BUOB 3CD3A 2PNAA 4K44A 2RMXA 1BFJA 2L6KA 5DC4A 5DC9A 3BKBA 2DCRA 3VS1A 1I3ZA 3QWXX 4K2RA 3T04A 2K7AB 1LKLA 1CSZA 1JYRA 2CS0A 1BLJA 3TL0A 1A1EA 2Y1NA 1BF5A 2IUGA 1SHAA 1FU5A 2AOAA 2CIAA 2CI8A 4LUEA 1O4GA 1CJ1A 1FHSA 1O48A 3OVEA 1O4EA 1O4KA 3GQIB 1BM2A 1YVHA 2CI9A 1OO4A 1LUIA 1KA6A 2MQIA 4JEGA 2DLYA 2ECDA 3HHMB 1BLKA 4OHHA 3OB2B 5DF6A 4A4BA 1A1AA 5IBMA 1O4HA 3MXYA 2HDXA 1O4LA 3VS5A 5BO4A 2MK2A 2GE9A 2H46E 5GJIA 3BUXB 3CXLA 1A07A 1G83A 2MC1A 4JGHA 2QMSA 5HKWA 4L1BB 4DGPA 2CBLA 2C0OA 1SPSA 2Y1MA 4E93A 2H5KA 1BKMA 1FBVA 2RORA 3VRQA 3VS2A 4ROJA 4TZIA 1O4MA 4H34A 1BG1A 3S8OA 1JYUA 2B3OA 1BFIA 4JE4A 1AYBA 5AXIA 2LNXA 1D1ZA 2C0TA 3K2TA 1JWOA 5CDWA 3VS6A 3QWYA 3BUNB 1Y57A 1R1QA 4EIHA 3VRRA 2Y3AB 5HKZA 1O4NA 1PICA 4D8KA 1IJRA 3VROA 2OQ1A 3VGOA 1SKJA 1AOTF 2SHPA 1OPLA 4H1OA 5GJHA 1AD5A 5HKYA 2LQWA 3PJPA 3GXWA 3VRNA 1A81A 5AULA 1O45A 2EL8A 1A08A 3VRYA 1O4CA 1O4RA 1O4FA 1CSYA 2BBUA 1QG1E 1QCFA 3IMJA 3KFJA 5EHRA 3PSJA 4M4ZA 3VS3A 1CWEA 1AYDA 2EU0A 5EHPA 1Y1UA 5D0JA 2MRKA 4OHDA 3TKZA 3US4A 1SHDA 1WQUA 3PLFB 1FYRA 3UF4A 1O47A 2KNOA 3OP0A 2H8HA 1MILA 2ETZA 2HUWA 3MXCA 2AUGA 1UUSA 1FBZA 1LUMA 2FO0A 4FL2A 1O4OA 2C0IA 2RSYA 4U17A 1HCSB 1IS0A 4K45A 2HDVA 1M61A 1X6CA 5IBSA 2LQNA 4F5BA 4XZ0A 1O4DA 2L3TA 4EY0A 4U1PA 1JU5A 1R1SA 1F2FA 1O49A 3S9KA 4WWQA 1SHBA 2PLDA 1K9AA 4GL9E 1F1WA 4X6SA 1JYQA 3N7YA 1BMBA 3PSKA 1NRVA 3N84A 2LRAA 2PNBA 2VIFA 2IUHA 2AOBA 1XA6A 1QADA 3NHNA 1CWDL 4OHLA 3LYVA 1B47A 3PS5A
chains in the Genus database with same CATH topology
4NWGA 1O4AA 1BHFA 3UYOA 4OHEA 1AB2A 1RJAA 2L4KA 4XZ1A 1O4IA 1GRIA 1O4BA 1R1PA 3OB1B 1SPRA 1AYCA 1O4PA 1H9OA 1RQQC 1D4TA 1MW4A 2DX0A 4E68A 3VS7A 1M27A 3HCKA 1FMKA 2YU7A 4F5AA 4LUDA 3IN7A 1X27A 1P13A 1BHHA 3BUWB 3S8LA 1KA7A 1TZEE 3K2MA 2EYZA 2ABLA 2DVJA 5KAZA 1HCTB 1O42A 4P9VA 1NZLA 3EAZA 1OO3A 5J3XA 3IN8A 4QSYA 2HCKA 2IZVA 1O41A 3PFVA 2DM0A 2LCTA 1ZFPE 4A4CA 1AYAA 5EG3B 1O44A 1D4WA 2C9WA 3VRZA 3CBLA 1FU6A 3ZNIA 1A1BA 1YVLA 4FL3A 4K11A 1LUNA 2HMHA 3GXXA 2K79B 1LCKA 3EACA 2LNWA 1RPYA 2XP1A 2KK6A 4FBNA 1LUKA 1O4JA 4OHIA 1LKKA 3CWGA 1X0NA 2EKXA 1BHHB 2CRHA 5I6VA 3N8MA 3OV1A 1NZVA 2EYVA 2OZOA 1TCEA 3WA4A 5DC0B 2IUIA 4GPLB 2PTKA 1GHUA 3MAZA 1OPKA 3BUMB 1Z3KA 2DLZA 2EOBA 2GSBA 3VS0A 2CR4A 2EO6A 2EO3A 3VRPA 2EYYA 1A09A 2RVFA 3PQZA 2YSXA 1LCJA 1O4QA 2SRCA 4GWFA 1BKLA 1UURA 3HIZB 3IMDA 1KSWA 5EELA 4P9ZA 1O43A 5EEQA 3C7IA 4NWFA 2JYQA 4DGXA 1O46A 2FCIA 3M7FA 3S8NA 4F59A 3VS4A 1KC2A 2MRJA 2PLEA 1A1CA 1AOUF 3BUOB 3CD3A 2PNAA 4K44A 2RMXA 1BFJA 2L6KA 5DC4A 5DC9A 3BKBA 2DCRA 3VS1A 1I3ZA 3QWXX 4K2RA 3T04A 2K7AB 1LKLA 1CSZA 1JYRA 2CS0A 1BLJA 3TL0A 1A1EA 2Y1NA 1BF5A 2IUGA 1SHAA 1FU5A 2AOAA 2CIAA 2CI8A 4LUEA 1O4GA 1CJ1A 1FHSA 1O48A 3OVEA 1O4EA 1O4KA 3GQIB 1BM2A 1YVHA 2CI9A 1OO4A 1LUIA 1KA6A 2MQIA 4JEGA 2DLYA 2ECDA 3HHMB 1BLKA 4OHHA 3OB2B 5DF6A 4A4BA 1A1AA 5IBMA 1O4HA 3MXYA 2HDXA 1O4LA 3VS5A 5BO4A 2MK2A 2GE9A 2H46E 5GJIA 3BUXB 3CXLA 1A07A 1G83A 2MC1A 4JGHA 2QMSA 5HKWA 4L1BB 4DGPA 2CBLA 2C0OA 1SPSA 2Y1MA 4E93A 2H5KA 1BKMA 1FBVA 2RORA 3VRQA 3VS2A 4ROJA 4TZIA 1O4MA 4H34A 1BG1A 3S8OA 1JYUA 2B3OA 1BFIA 4JE4A 1AYBA 5AXIA 2LNXA 1D1ZA 2C0TA 1JWOA 5CDWA 3VS6A 3QWYA 3BUNB 1Y57A 1R1QA 4EIHA 3VRRA 2Y3AB 5HKZA 1O4NA 1PICA 4D8KA 1IJRA 3VROA 2OQ1A 3VGOA 1SKJA 1AOTF 2SHPA 1OPLA 4H1OA 5GJHA 1AD5A 5HKYA 2LQWA 3PJPA 3GXWA 3VRNA 1A81A 5AULA 1O45A 2EL8A 1A08A 3VRYA 1O4CA 1O4RA 1O4FA 1CSYA 2BBUA 1QG1E 1QCFA 3IMJA 3KFJA 5EHRA 3PSJA 4M4ZA 3VS3A 1CWEA 1AYDA 2EU0A 5EHPA 1Y1UA 5D0JA 2MRKA 4OHDA 3TKZA 3US4A 1SHDA 1WQUA 3PLFB 1FYRA 3UF4A 1O47A 2KNOA 3OP0A 2H8HA 1MILA 2ETZA 2HUWA 3MXCA 2AUGA 1UUSA 1FBZA 1LUMA 2FO0A 4FL2A 1O4OA 2C0IA 2RSYA 4U17A 1HCSB 1IS0A 4K45A 2HDVA 1M61A 1X6CA 5IBSA 2LQNA 4F5BA 4XZ0A 1O4DA 2L3TA 4EY0A 4U1PA 1JU5A 1R1SA 1F2FA 1O49A 3S9KA 4WWQA 1SHBA 2PLDA 1K9AA 4GL9E 1F1WA 4X6SA 1JYQA 3N7YA 1BMBA 3PSKA 1NRVA 3N84A 2PNBA 2VIFA 2IUHA 2AOBA 1XA6A 1QADA 3NHNA 1CWDL 4OHLA 1B47A 3PS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NWG A;  1O4A A;  1BHF A;  3UYO A;  4OHE A;  1AB2 A;  1RJA A;  2L4K A;  4XZ1 A;  1O4I A;  1GRI A;  1O4B A;  1R1P A;  3OB1 B;  1SPR A;  1AYC A;  1O4P A;  1H9O A;  1RQQ C;  1D4T A;  1MW4 A;  2DX0 A;  4E68 A;  3VS7 A;  1M27 A;  3HCK A;  1FMK A;  2YU7 A;  4F5A A;  4LUD A;  3IN7 A;  1X27 A;  1P13 A;  1BHH A;  3BUW B;  3S8L A;  1KA7 A;  1TZE E;  3K2M A;  2EYZ A;  2ABL A;  2DVJ A;  5KAZ A;  1HCT B;  1O42 A;  4P9V A;  1NZL A;  3EAZ A;  1OO3 A;  5J3X A;  3IN8 A;  4QSY A;  2HCK A;  2IZV A;  1O41 A;  3PFV A;  2DM0 A;  2LCT A;  1ZFP E;  4A4C A;  1AYA A;  5EG3 B;  1O44 A;  1D4W A;  2C9W A;  3VRZ A;  3CBL A;  1FU6 A;  3ZNI A;  1A1B A;  1YVL A;  4FL3 A;  4K11 A;  1LUN A;  2HMH A;  3GXX A;  2K79 B;  1LCK A;  3EAC A;  2LNW A;  1RPY A;  2XP1 A;  2KK6 A;  4FBN A;  1LUK A;  1O4J A;  4OHI A;  1LKK A;  3CWG A;  1X0N A;  2EKX A;  1BHH B;  2CRH A;  5I6V A;  3N8M A;  3OV1 A;  1NZV A;  2EYV A;  2OZO A;  1TCE A;  3WA4 A;  5DC0 B;  2IUI A;  4GPL B;  2PTK A;  1GHU A;  3MAZ A;  1OPK A;  3BUM B;  1Z3K A;  2DLZ A;  2EOB A;  2GSB A;  3VS0 A;  2CR4 A;  2EO6 A;  2EO3 A;  3VRP A;  2EYY A;  1A09 A;  2RVF A;  3PQZ A;  2YSX A;  1LCJ A;  1O4Q A;  2SRC A;  4GWF A;  1BKL A;  1UUR A;  3HIZ B;  3IMD A;  1KSW A;  5EEL A;  4P9Z A;  1O43 A;  5EEQ A;  3C7I A;  4NWF A;  2JYQ A;  4DGX A;  1O46 A;  2FCI A;  3M7F A;  3S8N A;  4F59 A;  3VS4 A;  1KC2 A;  2MRJ A;  2PLE A;  1A1C A;  1AOU F;  3BUO B;  3CD3 A;  2PNA A;  4K44 A;  2RMX A;  1BFJ A;  2L6K A;  5DC4 A;  5DC9 A;  3BKB A;  2DCR A;  3VS1 A;  1I3Z A;  3QWX X;  4K2R A;  3T04 A;  2K7A B;  1LKL A;  1CSZ A;  1JYR A;  2CS0 A;  1BLJ A;  3TL0 A;  1A1E A;  2Y1N A;  1BF5 A;  2IUG A;  1SHA A;  1FU5 A;  2AOA A;  2CIA A;  2CI8 A;  4LUE A;  1O4G A;  1CJ1 A;  1FHS A;  1O48 A;  3OVE A;  1O4E A;  1O4K A;  3GQI B;  1BM2 A;  1YVH A;  2CI9 A;  1OO4 A;  1LUI A;  1KA6 A;  2MQI A;  4JEG A;  2DLY A;  2ECD A;  3HHM B;  1BLK A;  4OHH A;  3OB2 B;  5DF6 A;  4A4B A;  1A1A A;  5IBM A;  1O4H A;  3MXY A;  2HDX A;  1O4L A;  3VS5 A;  5BO4 A;  2MK2 A;  2GE9 A;  2H46 E;  5GJI A;  3BUX B;  3CXL A;  1A07 A;  1G83 A;  2MC1 A;  4JGH A;  2QMS A;  5HKW A;  4L1B B;  4DGP A;  2CBL A;  2C0O A;  1SPS A;  2Y1M A;  4E93 A;  2H5K A;  1BKM A;  1FBV A;  2ROR A;  3VRQ A;  3VS2 A;  4ROJ A;  4TZI A;  1O4M A;  4H34 A;  1BG1 A;  3S8O A;  1JYU A;  2B3O A;  1BFI A;  4JE4 A;  1AYB A;  5AXI A;  2LNX A;  1D1Z A;  2C0T A;  1JWO A;  5CDW A;  3VS6 A;  3QWY A;  3BUN B;  1Y57 A;  1R1Q A;  4EIH A;  3VRR A;  2Y3A B;  5HKZ A;  1O4N A;  1PIC A;  4D8K A;  1IJR A;  3VRO A;  2OQ1 A;  3VGO A;  1SKJ A;  1AOT F;  2SHP A;  1OPL A;  4H1O A;  5GJH A;  1AD5 A;  5HKY A;  2LQW A;  3PJP A;  3GXW A;  3VRN A;  1A81 A;  5AUL A;  1O45 A;  2EL8 A;  1A08 A;  3VRY A;  1O4C A;  1O4R A;  1O4F A;  1CSY A;  2BBU A;  1QG1 E;  1QCF A;  3IMJ A;  3KFJ A;  5EHR A;  3PSJ A;  4M4Z A;  3VS3 A;  1CWE A;  1AYD A;  2EU0 A;  5EHP A;  1Y1U A;  5D0J A;  2MRK A;  4OHD A;  3TKZ A;  3US4 A;  1SHD A;  1WQU A;  3PLF B;  1FYR A;  3UF4 A;  1O47 A;  2KNO A;  3OP0 A;  2H8H A;  1MIL A;  2ETZ A;  2HUW A;  3MXC A;  2AUG A;  1UUS A;  1FBZ A;  1LUM A;  2FO0 A;  4FL2 A;  1O4O A;  2C0I A;  2RSY A;  4U17 A;  1HCS B;  1IS0 A;  4K45 A;  2HDV A;  1M61 A;  1X6C A;  5IBS A;  2LQN A;  4F5B A;  4XZ0 A;  1O4D A;  2L3T A;  4EY0 A;  4U1P A;  1JU5 A;  1R1S A;  1F2F A;  1O49 A;  3S9K A;  4WWQ A;  1SHB A;  2PLD A;  1K9A A;  4GL9 E;  1F1W A;  4X6S A;  1JYQ A;  3N7Y A;  1BMB A;  3PSK A;  1NRV A;  3N84 A;  2PNB A;  2VIF A;  2IUH A;  2AOB A;  1XA6 A;  1QAD A;  3NHN A;  1CWD L;  4OHL A;  1B47 A;  3PS5 A; 
#chains in the Genus database with same CATH topology
 4NWG A;  1O4A A;  1BHF A;  3UYO A;  4OHE A;  1AB2 A;  1RJA A;  2L4K A;  4XZ1 A;  1O4I A;  1GRI A;  1O4B A;  1R1P A;  3OB1 B;  1SPR A;  1AYC A;  1O4P A;  1H9O A;  1RQQ C;  1D4T A;  1MW4 A;  2DX0 A;  4E68 A;  3VS7 A;  1M27 A;  3HCK A;  1FMK A;  2YU7 A;  4F5A A;  4LUD A;  3IN7 A;  1X27 A;  1P13 A;  1BHH A;  3BUW B;  3S8L A;  1KA7 A;  1TZE E;  3K2M A;  2EYZ A;  2ABL A;  2DVJ A;  5KAZ A;  1HCT B;  1O42 A;  4P9V A;  1NZL A;  3EAZ A;  1OO3 A;  5J3X A;  3IN8 A;  4QSY A;  2HCK A;  2IZV A;  1O41 A;  3PFV A;  2DM0 A;  2LCT A;  1ZFP E;  4A4C A;  1AYA A;  5EG3 B;  1O44 A;  1D4W A;  2C9W A;  3VRZ A;  3CBL A;  1FU6 A;  3ZNI A;  1A1B A;  1YVL A;  4FL3 A;  4K11 A;  1LUN A;  2HMH A;  3GXX A;  2K79 B;  1LCK A;  3EAC A;  2LNW A;  1RPY A;  2XP1 A;  2KK6 A;  4FBN A;  1LUK A;  1O4J A;  4OHI A;  1LKK A;  3CWG A;  1X0N A;  2EKX A;  1BHH B;  2CRH A;  5I6V A;  3N8M A;  3OV1 A;  1NZV A;  2EYV A;  2OZO A;  1TCE A;  3WA4 A;  5DC0 B;  2KGY A;  2IUI A;  4GPL B;  2PTK A;  1GHU A;  3MAZ A;  1OPK A;  3BUM B;  1Z3K A;  2DLZ A;  2EOB A;  2GSB A;  3VS0 A;  2CR4 A;  2EO6 A;  2EO3 A;  3VRP A;  2EYY A;  1A09 A;  2RVF A;  3PQZ A;  2YSX A;  1LCJ A;  1O4Q A;  2SRC A;  4GWF A;  1BKL A;  1UUR A;  3HIZ B;  3IMD A;  1KSW A;  5EEL A;  4P9Z A;  1O43 A;  5EEQ A;  3C7I A;  4NWF A;  2JYQ A;  4DGX A;  1O46 A;  2FCI A;  3M7F A;  3S8N A;  4F59 A;  3VS4 A;  1KC2 A;  2MRJ A;  2PLE A;  1A1C A;  1AOU F;  3BUO B;  3CD3 A;  2PNA A;  4K44 A;  2RMX A;  1BFJ A;  2L6K A;  5DC4 A;  5DC9 A;  3BKB A;  2DCR A;  3VS1 A;  1I3Z A;  3QWX X;  4K2R A;  3T04 A;  2K7A B;  1LKL A;  1CSZ A;  1JYR A;  2CS0 A;  1BLJ A;  3TL0 A;  1A1E A;  2Y1N A;  1BF5 A;  2IUG A;  1SHA A;  1FU5 A;  2AOA A;  2CIA A;  2CI8 A;  4LUE A;  1O4G A;  1CJ1 A;  1FHS A;  1O48 A;  3OVE A;  1O4E A;  1O4K A;  3GQI B;  1BM2 A;  1YVH A;  2CI9 A;  1OO4 A;  1LUI A;  1KA6 A;  2MQI A;  4JEG A;  2DLY A;  2ECD A;  3HHM B;  1BLK A;  4OHH A;  3OB2 B;  5DF6 A;  4A4B A;  1A1A A;  5IBM A;  1O4H A;  3MXY A;  2HDX A;  1O4L A;  3VS5 A;  5BO4 A;  2MK2 A;  2GE9 A;  2H46 E;  5GJI A;  3BUX B;  3CXL A;  1A07 A;  1G83 A;  2MC1 A;  4JGH A;  2QMS A;  5HKW A;  4L1B B;  4DGP A;  2CBL A;  2C0O A;  1SPS A;  2Y1M A;  4E93 A;  2H5K A;  1BKM A;  1FBV A;  2ROR A;  3VRQ A;  3VS2 A;  4ROJ A;  4TZI A;  1O4M A;  4H34 A;  1BG1 A;  3S8O A;  1JYU A;  2B3O A;  1BFI A;  4JE4 A;  1AYB A;  5AXI A;  2LNX A;  1D1Z A;  2C0T A;  3K2T A;  1JWO A;  5CDW A;  3VS6 A;  3QWY A;  3BUN B;  1Y57 A;  1R1Q A;  4EIH A;  3VRR A;  2Y3A B;  5HKZ A;  1O4N A;  1PIC A;  4D8K A;  1IJR A;  3VRO A;  2OQ1 A;  3VGO A;  1SKJ A;  1AOT F;  2SHP A;  1OPL A;  4H1O A;  5GJH A;  1AD5 A;  5HKY A;  2LQW A;  3PJP A;  3GXW A;  3VRN A;  1A81 A;  5AUL A;  1O45 A;  2EL8 A;  1A08 A;  3VRY A;  1O4C A;  1O4R A;  1O4F A;  1CSY A;  2BBU A;  1QG1 E;  1QCF A;  3IMJ A;  3KFJ A;  5EHR A;  3PSJ A;  4M4Z A;  3VS3 A;  1CWE A;  1AYD A;  2EU0 A;  5EHP A;  1Y1U A;  5D0J A;  2MRK A;  4OHD A;  3TKZ A;  3US4 A;  1SHD A;  1WQU A;  3PLF B;  1FYR A;  3UF4 A;  1O47 A;  2KNO A;  3OP0 A;  2H8H A;  1MIL A;  2ETZ A;  2HUW A;  3MXC A;  2AUG A;  1UUS A;  1FBZ A;  1LUM A;  2FO0 A;  4FL2 A;  1O4O A;  2C0I A;  2RSY A;  4U17 A;  1HCS B;  1IS0 A;  4K45 A;  2HDV A;  1M61 A;  1X6C A;  5IBS A;  2LQN A;  4F5B A;  4XZ0 A;  1O4D A;  2L3T A;  4EY0 A;  4U1P A;  1JU5 A;  1R1S A;  1F2F A;  1O49 A;  3S9K A;  4WWQ A;  1SHB A;  2PLD A;  1K9A A;  4GL9 E;  1F1W A;  4X6S A;  1JYQ A;  3N7Y A;  1BMB A;  3PSK A;  1NRV A;  3N84 A;  2LRA A;  2PNB A;  2VIF A;  2IUH A;  2AOB A;  1XA6 A;  1QAD A;  3NHN A;  1CWD L;  4OHL A;  3LYV A;  1B47 A;  3PS5 A; 
#chains in the Genus database with same CATH homology
 4NWG A;  1O4A A;  1BHF A;  3UYO A;  4OHE A;  1AB2 A;  1RJA A;  2L4K A;  4XZ1 A;  1O4I A;  1GRI A;  1O4B A;  1R1P A;  3OB1 B;  1SPR A;  1AYC A;  1O4P A;  1H9O A;  1RQQ C;  1D4T A;  1MW4 A;  2DX0 A;  4E68 A;  3VS7 A;  1M27 A;  3HCK A;  1FMK A;  2YU7 A;  4F5A A;  4LUD A;  3IN7 A;  1X27 A;  1P13 A;  1BHH A;  3BUW B;  3S8L A;  1KA7 A;  1TZE E;  3K2M A;  2EYZ A;  2ABL A;  2DVJ A;  5KAZ A;  1HCT B;  1O42 A;  4P9V A;  1NZL A;  3EAZ A;  1OO3 A;  5J3X A;  3IN8 A;  4QSY A;  2HCK A;  2IZV A;  1O41 A;  3PFV A;  2DM0 A;  2LCT A;  1ZFP E;  4A4C A;  1AYA A;  5EG3 B;  1O44 A;  1D4W A;  2C9W A;  3VRZ A;  3CBL A;  1FU6 A;  3ZNI A;  1A1B A;  1YVL A;  4FL3 A;  4K11 A;  1LUN A;  2HMH A;  3GXX A;  2K79 B;  1LCK A;  3EAC A;  2LNW A;  1RPY A;  2XP1 A;  2KK6 A;  4FBN A;  1LUK A;  1O4J A;  4OHI A;  1LKK A;  3CWG A;  1X0N A;  2EKX A;  1BHH B;  2CRH A;  5I6V A;  3N8M A;  3OV1 A;  1NZV A;  2EYV A;  2OZO A;  1TCE A;  3WA4 A;  5DC0 B;  2IUI A;  4GPL B;  2PTK A;  1GHU A;  3MAZ A;  1OPK A;  3BUM B;  1Z3K A;  2DLZ A;  2EOB A;  2GSB A;  3VS0 A;  2CR4 A;  2EO6 A;  2EO3 A;  3VRP A;  2EYY A;  1A09 A;  2RVF A;  3PQZ A;  2YSX A;  1LCJ A;  1O4Q A;  2SRC A;  4GWF A;  1BKL A;  1UUR A;  3HIZ B;  3IMD A;  1KSW A;  5EEL A;  4P9Z A;  1O43 A;  5EEQ A;  3C7I A;  4NWF A;  2JYQ A;  4DGX A;  1O46 A;  2FCI A;  3M7F A;  3S8N A;  4F59 A;  3VS4 A;  1KC2 A;  2MRJ A;  2PLE A;  1A1C A;  1AOU F;  3BUO B;  3CD3 A;  2PNA A;  4K44 A;  2RMX A;  1BFJ A;  2L6K A;  5DC4 A;  5DC9 A;  3BKB A;  2DCR A;  3VS1 A;  1I3Z A;  3QWX X;  4K2R A;  3T04 A;  2K7A B;  1LKL A;  1CSZ A;  1JYR A;  2CS0 A;  1BLJ A;  3TL0 A;  1A1E A;  2Y1N A;  1BF5 A;  2IUG A;  1SHA A;  1FU5 A;  2AOA A;  2CIA A;  2CI8 A;  4LUE A;  1O4G A;  1CJ1 A;  1FHS A;  1O48 A;  3OVE A;  1O4E A;  1O4K A;  3GQI B;  1BM2 A;  1YVH A;  2CI9 A;  1OO4 A;  1LUI A;  1KA6 A;  2MQI A;  4JEG A;  2DLY A;  2ECD A;  3HHM B;  1BLK A;  4OHH A;  3OB2 B;  5DF6 A;  4A4B A;  1A1A A;  5IBM A;  1O4H A;  3MXY A;  2HDX A;  1O4L A;  3VS5 A;  5BO4 A;  2MK2 A;  2GE9 A;  2H46 E;  5GJI A;  3BUX B;  3CXL A;  1A07 A;  1G83 A;  2MC1 A;  4JGH A;  2QMS A;  5HKW A;  4L1B B;  4DGP A;  2CBL A;  2C0O A;  1SPS A;  2Y1M A;  4E93 A;  2H5K A;  1BKM A;  1FBV A;  2ROR A;  3VRQ A;  3VS2 A;  4ROJ A;  4TZI A;  1O4M A;  4H34 A;  1BG1 A;  3S8O A;  1JYU A;  2B3O A;  1BFI A;  4JE4 A;  1AYB A;  5AXI A;  2LNX A;  1D1Z A;  2C0T A;  1JWO A;  5CDW A;  3VS6 A;  3QWY A;  3BUN B;  1Y57 A;  1R1Q A;  4EIH A;  3VRR A;  2Y3A B;  5HKZ A;  1O4N A;  1PIC A;  4D8K A;  1IJR A;  3VRO A;  2OQ1 A;  3VGO A;  1SKJ A;  1AOT F;  2SHP A;  1OPL A;  4H1O A;  5GJH A;  1AD5 A;  5HKY A;  2LQW A;  3PJP A;  3GXW A;  3VRN A;  1A81 A;  5AUL A;  1O45 A;  2EL8 A;  1A08 A;  3VRY A;  1O4C A;  1O4R A;  1O4F A;  1CSY A;  2BBU A;  1QG1 E;  1QCF A;  3IMJ A;  3KFJ A;  5EHR A;  3PSJ A;  4M4Z A;  3VS3 A;  1CWE A;  1AYD A;  2EU0 A;  5EHP A;  1Y1U A;  5D0J A;  2MRK A;  4OHD A;  3TKZ A;  3US4 A;  1SHD A;  1WQU A;  3PLF B;  1FYR A;  3UF4 A;  1O47 A;  2KNO A;  3OP0 A;  2H8H A;  1MIL A;  2ETZ A;  2HUW A;  3MXC A;  2AUG A;  1UUS A;  1FBZ A;  1LUM A;  2FO0 A;  4FL2 A;  1O4O A;  2C0I A;  2RSY A;  4U17 A;  1HCS B;  1IS0 A;  4K45 A;  2HDV A;  1M61 A;  1X6C A;  5IBS A;  2LQN A;  4F5B A;  4XZ0 A;  1O4D A;  2L3T A;  4EY0 A;  4U1P A;  1JU5 A;  1R1S A;  1F2F A;  1O49 A;  3S9K A;  4WWQ A;  1SHB A;  2PLD A;  1K9A A;  4GL9 E;  1F1W A;  4X6S A;  1JYQ A;  3N7Y A;  1BMB A;  3PSK A;  1NRV A;  3N84 A;  2PNB A;  2VIF A;  2IUH A;  2AOB A;  1XA6 A;  1QAD A;  3NHN A;  1CWD L;  4OHL A;  1B47 A;  3PS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...