2H46E

Native domain-swapped dimer crystal structure of the grb2 sh2 domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords Growth Receptor Binding Protein 2
publication title Structural and energetic aspects of Grb2-SH2 domain-swapping.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2h46E00
4M4ZA 1OO4A 3C7IA 4E68A 1BLJA 2PTKA 3VS3A 1OPLA 1LUNA 1M61A 1O4EA 4P9VA 1AOTF 2EOBA 4H1OA 4OHDA 5DC9A 2FO0A 1BKMA 1O4FA 1O4IA 1FU5A 1A1CA 3IMDA 1HCSB 2VIFA 3UYOA 4JGHA 1RPYA 1LUKA 1FBZA 2QMSA 3UF4A 2CIAA 1SPSA 3CWGA 3T04A 3N7YA 4TZIA 2HMHA 1O41A 3N84A 4K11A 1TZEE 3VRNA 1R1SA 2PLDA 5EELA 1O4PA 1FMKA 5CDWA 4U1PA 4F5AA 2HDXA 2RVFA 2IUHA 1X27A 4LUDA 2EU0A 2IUGA 4JE4A 1CJ1A 1A08A 4WWQA 5EHPA 4FL2A 4K44A 2K7AB 1O4GA 2XP1A 3PFVA 5GJHA 1NRVA 1X0NA 2FCIA 3TKZA 1Z3KA 3CBLA 1Y1UA 1SHBA 2ECDA 3HCKA 3PQZA 3VS2A 4ROJA 2GSBA 1O4QA 1F1WA 1O45A 1AYDA 2AUGA 2KK6A 1HCTB 3MXYA 3CXLA 3EAZA 1O4LA 3KFJA 1JYRA 2DX0A 2CBLA 2H46E 1QCFA 4DGXA 4A4CA 4D8KA 1A1AA 1P13A 1AYCA 3N8MA 3VGOA 2MRJA 3CD3A 2EL8A 3EACA 3IN8A 5AXIA 1UURA 1BF5A 5HKWA 2PNAA 1I3ZA 1AYAA 1CSYA 1AD5A 4X6SA 1JWOA 3OV1A 3BUWB 1O4MA 2C9WA 1KA7A 2Y1MA 1O4NA 3MAZA 1O46A 2PLEA 5BO4A 2LQNA 4GWFA 2H5KA 2AOAA 1G83A 1X6CA 3VS4A 3BUXB 3GXWA 1O4KA 3VRPA 3GXXA 1BMBA 1BG1A 5DF6A 2DCRA 1D1ZA 3IN7A 4DGPA 4GL9E 2AOBA 2EKXA 1O43A 1QG1E 5DC4A 4NWFA 4H34A 1GHUA 2LNXA 2L6KA 2ABLA 2CS0A 1XA6A 1JYQA 2LNWA 1YVLA 3VS5A 3S8OA 5AULA 2CI8A 4OHLA 3ZNIA 1ZFPE 1O4BA 1SPRA 1NZLA 2CI9A 3BUOB 1LUIA 2IZVA 1F2FA 1TCEA 4GPLB 1AYBA 2CRHA 3PSKA 2EO6A 3QWYA 2SHPA 3IMJA 1LCJA 2C0IA 2Y1NA 3BUNB 1A07A 1PICA 3HHMB 2YU7A 3VRZA 3QWXX 2MRKA 2HDVA 1M27A 2L3TA 3PJPA 5EHRA 1QADA 5J3XA 2K79B 2GE9A 1AOUF 2DVJA 1FYRA 2ETZA 1CWEA 2DLZA 1BKLA 5I6VA 2RSYA 4F5BA 1NZVA 3VS6A 1BFIA 1LKLA 1GRIA 4EIHA 1KSWA 1LUMA 3VS7A 1BLKA 5D0JA 5GJIA 5IBMA 2CR4A 1MW4A 1Y57A 2MC1A 4E93A 4L1BB 3WA4A 3VRQA 2RMXA 2YSXA 3M7FA 1D4TA 2EYVA 1FU6A 4OHHA 3TL0A 4A4BA 2IUIA 3US4A 3BUMB 3HIZB 2C0OA 4OHIA 3OP0A 1IJRA 1BHFA 1JYUA 2MK2A 1KA6A 1RJAA 3VRYA 1O4OA 2PNBA 3OB2B 1SKJA 2RORA 1A81A 2HCKA 4JEGA 5HKZA 5EG3B 3BKBA 1O4DA 1A1BA 1CWDL 2SRCA 3VRRA 1H9OA 2EO3A 2DLYA 1SHAA 5DC0B 4F59A 2DM0A 2C0TA 3VROA 5KAZA 1IS0A 3S8NA 1O48A 3NHNA 1B47A 3OB1B 4K2RA 1BM2A 3VS0A 1WQUA 4OHEA 2KNOA 3PS5A 4U17A 3K2MA 1BFJA 2LQWA 1D4WA 1KC2A 1YVHA 4EY0A 1LKKA 1OO3A 2B3OA 3S8LA 1JU5A 2HUWA 3GQIB 1O4RA 1FBVA 4QSYA 1O4CA 2H8HA 4XZ0A 1R1PA 2Y3AB 4K45A 2EYZA 2OZOA 2MQIA 1O42A 4LUEA 3PLFB 4XZ1A 3VS1A 1O4JA 5EEQA 1O44A 1RQQC 1SHDA 1OPKA 1AB2A 2L4KA 3OVEA 2JYQA 4P9ZA 2LCTA 5HKYA 3S9KA 1BHHB 1A1EA 1O4AA 1BHHA 1K9AA 4FBNA 1MILA 1O49A 1CSZA 2EYYA 2BBUA 3MXCA 1O4HA 1UUSA 1LCKA 2OQ1A 1R1QA 1FHSA 5IBSA 4NWGA 4FL3A 1A09A 1O47A 3PSJA
chains in the Genus database with same CATH superfamily
4M4ZA 1OO4A 3C7IA 4E68A 1BLJA 2PTKA 3VS3A 1OPLA 1LUNA 1M61A 1O4EA 4P9VA 1AOTF 2KGYA 2EOBA 4H1OA 4OHDA 5DC9A 2FO0A 1BKMA 1O4FA 1O4IA 1FU5A 1A1CA 3IMDA 1HCSB 2VIFA 3UYOA 4JGHA 1RPYA 1LUKA 1FBZA 2QMSA 3UF4A 2CIAA 1SPSA 3CWGA 3T04A 3N7YA 4TZIA 2HMHA 1O41A 3N84A 4K11A 1TZEE 3VRNA 1R1SA 2PLDA 5EELA 1O4PA 1FMKA 5CDWA 4U1PA 4F5AA 2HDXA 2RVFA 2IUHA 1X27A 4LUDA 2EU0A 2IUGA 4JE4A 1CJ1A 1A08A 4WWQA 5EHPA 4FL2A 4K44A 2K7AB 1O4GA 2XP1A 3PFVA 5GJHA 1NRVA 1X0NA 2FCIA 3TKZA 1Z3KA 3CBLA 1Y1UA 1SHBA 2ECDA 3HCKA 3PQZA 3VS2A 4ROJA 2GSBA 1O4QA 1F1WA 1O45A 3K2TA 1AYDA 2AUGA 2KK6A 1HCTB 3MXYA 3CXLA 3EAZA 1O4LA 3KFJA 1JYRA 2DX0A 2CBLA 2H46E 1QCFA 4DGXA 4A4CA 4D8KA 1A1AA 1P13A 1AYCA 3N8MA 3VGOA 2MRJA 3CD3A 2EL8A 3EACA 3IN8A 5AXIA 1UURA 1BF5A 5HKWA 2PNAA 1I3ZA 1AYAA 1CSYA 1AD5A 4X6SA 1JWOA 3OV1A 3BUWB 1O4MA 2C9WA 1KA7A 2Y1MA 1O4NA 3MAZA 1O46A 2PLEA 5BO4A 2LQNA 4GWFA 2H5KA 2AOAA 1G83A 1X6CA 3VS4A 3BUXB 3GXWA 1O4KA 3VRPA 3GXXA 1BMBA 1BG1A 5DF6A 2DCRA 1D1ZA 3IN7A 3LYVA 4DGPA 4GL9E 2AOBA 2EKXA 1O43A 1QG1E 5DC4A 4NWFA 4H34A 1GHUA 2LNXA 2L6KA 2ABLA 2CS0A 1XA6A 1JYQA 2LNWA 1YVLA 3VS5A 3S8OA 5AULA 2CI8A 4OHLA 3ZNIA 1ZFPE 1O4BA 1SPRA 1NZLA 2CI9A 3BUOB 1LUIA 2IZVA 1F2FA 1TCEA 4GPLB 1AYBA 2CRHA 3PSKA 2EO6A 3QWYA 2SHPA 3IMJA 1LCJA 2C0IA 2Y1NA 3BUNB 1A07A 1PICA 3HHMB 2YU7A 3VRZA 3QWXX 2MRKA 2HDVA 1M27A 2L3TA 3PJPA 5EHRA 1QADA 5J3XA 2K79B 2GE9A 1AOUF 2DVJA 1FYRA 2ETZA 1CWEA 2DLZA 1BKLA 5I6VA 2RSYA 4F5BA 1NZVA 3VS6A 1BFIA 1LKLA 1GRIA 4EIHA 1KSWA 1LUMA 3VS7A 1BLKA 5D0JA 5GJIA 5IBMA 2CR4A 1MW4A 1Y57A 2MC1A 4E93A 4L1BB 3WA4A 3VRQA 2RMXA 2YSXA 3M7FA 1D4TA 2EYVA 1FU6A 4OHHA 3TL0A 4A4BA 2IUIA 3US4A 3BUMB 3HIZB 2C0OA 4OHIA 3OP0A 1IJRA 1BHFA 1JYUA 2MK2A 1KA6A 1RJAA 3VRYA 1O4OA 2PNBA 3OB2B 1SKJA 2RORA 1A81A 2HCKA 4JEGA 5HKZA 5EG3B 3BKBA 1O4DA 1A1BA 1CWDL 2SRCA 3VRRA 1H9OA 2EO3A 2DLYA 1SHAA 5DC0B 4F59A 2DM0A 2C0TA 3VROA 5KAZA 1IS0A 3S8NA 1O48A 3NHNA 1B47A 3OB1B 4K2RA 1BM2A 3VS0A 1WQUA 4OHEA 2KNOA 3PS5A 4U17A 3K2MA 1BFJA 2LQWA 1D4WA 1KC2A 1YVHA 4EY0A 1LKKA 1OO3A 2B3OA 3S8LA 1JU5A 2HUWA 3GQIB 1O4RA 1FBVA 4QSYA 1O4CA 2LRAA 2H8HA 4XZ0A 1R1PA 2Y3AB 4K45A 2EYZA 2OZOA 2MQIA 1O42A 4LUEA 3PLFB 4XZ1A 3VS1A 1O4JA 5EEQA 1O44A 1RQQC 1SHDA 1OPKA 1AB2A 2L4KA 3OVEA 2JYQA 4P9ZA 2LCTA 5HKYA 3S9KA 1BHHB 1A1EA 1O4AA 1BHHA 1K9AA 4FBNA 1MILA 1O49A 1CSZA 2EYYA 2BBUA 3MXCA 1O4HA 1UUSA 1LCKA 2OQ1A 1R1QA 1FHSA 5IBSA 4NWGA 4FL3A 1A09A 1O47A 3PSJA
chains in the Genus database with same CATH topology
4M4ZA 1OO4A 3C7IA 4E68A 1BLJA 2PTKA 3VS3A 1OPLA 1LUNA 1M61A 1O4EA 4P9VA 1AOTF 2EOBA 4H1OA 4OHDA 5DC9A 2FO0A 1BKMA 1O4FA 1O4IA 1FU5A 1A1CA 3IMDA 1HCSB 2VIFA 3UYOA 4JGHA 1RPYA 1LUKA 1FBZA 2QMSA 3UF4A 2CIAA 1SPSA 3CWGA 3T04A 3N7YA 4TZIA 2HMHA 1O41A 3N84A 4K11A 1TZEE 3VRNA 1R1SA 2PLDA 5EELA 1O4PA 1FMKA 5CDWA 4U1PA 4F5AA 2HDXA 2RVFA 2IUHA 1X27A 4LUDA 2EU0A 2IUGA 4JE4A 1CJ1A 1A08A 4WWQA 5EHPA 4FL2A 4K44A 2K7AB 1O4GA 2XP1A 3PFVA 5GJHA 1NRVA 1X0NA 2FCIA 3TKZA 1Z3KA 3CBLA 1Y1UA 1SHBA 2ECDA 3HCKA 3PQZA 3VS2A 4ROJA 2GSBA 1O4QA 1F1WA 1O45A 1AYDA 2AUGA 2KK6A 1HCTB 3MXYA 3CXLA 3EAZA 1O4LA 3KFJA 1JYRA 2DX0A 2CBLA 2H46E 1QCFA 4DGXA 4A4CA 4D8KA 1A1AA 1P13A 1AYCA 3N8MA 3VGOA 2MRJA 3CD3A 2EL8A 3EACA 3IN8A 5AXIA 1UURA 1BF5A 5HKWA 2PNAA 1I3ZA 1AYAA 1CSYA 1AD5A 4X6SA 1JWOA 3OV1A 3BUWB 1O4MA 2C9WA 1KA7A 2Y1MA 1O4NA 3MAZA 1O46A 2PLEA 5BO4A 2LQNA 4GWFA 2H5KA 2AOAA 1G83A 1X6CA 3VS4A 3BUXB 3GXWA 1O4KA 3VRPA 3GXXA 1BMBA 1BG1A 5DF6A 2DCRA 1D1ZA 3IN7A 4DGPA 4GL9E 2AOBA 2EKXA 1O43A 1QG1E 5DC4A 4NWFA 4H34A 1GHUA 2LNXA 2L6KA 2ABLA 2CS0A 1XA6A 1JYQA 2LNWA 1YVLA 3VS5A 3S8OA 5AULA 2CI8A 4OHLA 3ZNIA 1ZFPE 1O4BA 1SPRA 1NZLA 2CI9A 3BUOB 1LUIA 2IZVA 1F2FA 1TCEA 4GPLB 1AYBA 2CRHA 3PSKA 2EO6A 3QWYA 2SHPA 3IMJA 1LCJA 2C0IA 2Y1NA 3BUNB 1A07A 1PICA 3HHMB 2YU7A 3VRZA 3QWXX 2MRKA 2HDVA 1M27A 2L3TA 3PJPA 5EHRA 1QADA 5J3XA 2K79B 2GE9A 1AOUF 2DVJA 1FYRA 2ETZA 1CWEA 2DLZA 1BKLA 5I6VA 2RSYA 4F5BA 1NZVA 3VS6A 1BFIA 1LKLA 1GRIA 4EIHA 1KSWA 1LUMA 3VS7A 1BLKA 5D0JA 5GJIA 5IBMA 2CR4A 1MW4A 1Y57A 2MC1A 4E93A 4L1BB 3WA4A 3VRQA 2RMXA 2YSXA 3M7FA 1D4TA 2EYVA 1FU6A 4OHHA 3TL0A 4A4BA 2IUIA 3US4A 3BUMB 3HIZB 2C0OA 4OHIA 3OP0A 1IJRA 1BHFA 1JYUA 2MK2A 1KA6A 1RJAA 3VRYA 1O4OA 2PNBA 3OB2B 1SKJA 2RORA 1A81A 2HCKA 4JEGA 5HKZA 5EG3B 3BKBA 1O4DA 1A1BA 1CWDL 2SRCA 3VRRA 1H9OA 2EO3A 2DLYA 1SHAA 5DC0B 4F59A 2DM0A 2C0TA 3VROA 5KAZA 1IS0A 3S8NA 1O48A 3NHNA 1B47A 3OB1B 4K2RA 1BM2A 3VS0A 1WQUA 4OHEA 2KNOA 3PS5A 4U17A 3K2MA 1BFJA 2LQWA 1D4WA 1KC2A 1YVHA 4EY0A 1LKKA 1OO3A 2B3OA 3S8LA 1JU5A 2HUWA 3GQIB 1O4RA 1FBVA 4QSYA 1O4CA 2H8HA 4XZ0A 1R1PA 2Y3AB 4K45A 2EYZA 2OZOA 2MQIA 1O42A 4LUEA 3PLFB 4XZ1A 3VS1A 1O4JA 5EEQA 1O44A 1RQQC 1SHDA 1OPKA 1AB2A 2L4KA 3OVEA 2JYQA 4P9ZA 2LCTA 5HKYA 3S9KA 1BHHB 1A1EA 1O4AA 1BHHA 1K9AA 4FBNA 1MILA 1O49A 1CSZA 2EYYA 2BBUA 3MXCA 1O4HA 1UUSA 1LCKA 2OQ1A 1R1QA 1FHSA 5IBSA 4NWGA 4FL3A 1A09A 1O47A 3PSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M4Z A;  1OO4 A;  3C7I A;  4E68 A;  1BLJ A;  2PTK A;  3VS3 A;  1OPL A;  1LUN A;  1M61 A;  1O4E A;  4P9V A;  1AOT F;  2EOB A;  4H1O A;  4OHD A;  5DC9 A;  2FO0 A;  1BKM A;  1O4F A;  1O4I A;  1FU5 A;  1A1C A;  3IMD A;  1HCS B;  2VIF A;  3UYO A;  4JGH A;  1RPY A;  1LUK A;  1FBZ A;  2QMS A;  3UF4 A;  2CIA A;  1SPS A;  3CWG A;  3T04 A;  3N7Y A;  4TZI A;  2HMH A;  1O41 A;  3N84 A;  4K11 A;  1TZE E;  3VRN A;  1R1S A;  2PLD A;  5EEL A;  1O4P A;  1FMK A;  5CDW A;  4U1P A;  4F5A A;  2HDX A;  2RVF A;  2IUH A;  1X27 A;  4LUD A;  2EU0 A;  2IUG A;  4JE4 A;  1CJ1 A;  1A08 A;  4WWQ A;  5EHP A;  4FL2 A;  4K44 A;  2K7A B;  1O4G A;  2XP1 A;  3PFV A;  5GJH A;  1NRV A;  1X0N A;  2FCI A;  3TKZ A;  1Z3K A;  3CBL A;  1Y1U A;  1SHB A;  2ECD A;  3HCK A;  3PQZ A;  3VS2 A;  4ROJ A;  2GSB A;  1O4Q A;  1F1W A;  1O45 A;  1AYD A;  2AUG A;  2KK6 A;  1HCT B;  3MXY A;  3CXL A;  3EAZ A;  1O4L A;  3KFJ A;  1JYR A;  2DX0 A;  2CBL A;  2H46 E;  1QCF A;  4DGX A;  4A4C A;  4D8K A;  1A1A A;  1P13 A;  1AYC A;  3N8M A;  3VGO A;  2MRJ A;  3CD3 A;  2EL8 A;  3EAC A;  3IN8 A;  5AXI A;  1UUR A;  1BF5 A;  5HKW A;  2PNA A;  1I3Z A;  1AYA A;  1CSY A;  1AD5 A;  4X6S A;  1JWO A;  3OV1 A;  3BUW B;  1O4M A;  2C9W A;  1KA7 A;  2Y1M A;  1O4N A;  3MAZ A;  1O46 A;  2PLE A;  5BO4 A;  2LQN A;  4GWF A;  2H5K A;  2AOA A;  1G83 A;  1X6C A;  3VS4 A;  3BUX B;  3GXW A;  1O4K A;  3VRP A;  3GXX A;  1BMB A;  1BG1 A;  5DF6 A;  2DCR A;  1D1Z A;  3IN7 A;  4DGP A;  4GL9 E;  2AOB A;  2EKX A;  1O43 A;  1QG1 E;  5DC4 A;  4NWF A;  4H34 A;  1GHU A;  2LNX A;  2L6K A;  2ABL A;  2CS0 A;  1XA6 A;  1JYQ A;  2LNW A;  1YVL A;  3VS5 A;  3S8O A;  5AUL A;  2CI8 A;  4OHL A;  3ZNI A;  1ZFP E;  1O4B A;  1SPR A;  1NZL A;  2CI9 A;  3BUO B;  1LUI A;  2IZV A;  1F2F A;  1TCE A;  4GPL B;  1AYB A;  2CRH A;  3PSK A;  2EO6 A;  3QWY A;  2SHP A;  3IMJ A;  1LCJ A;  2C0I A;  2Y1N A;  3BUN B;  1A07 A;  1PIC A;  3HHM B;  2YU7 A;  3VRZ A;  3QWX X;  2MRK A;  2HDV A;  1M27 A;  2L3T A;  3PJP A;  5EHR A;  1QAD A;  5J3X A;  2K79 B;  2GE9 A;  1AOU F;  2DVJ A;  1FYR A;  2ETZ A;  1CWE A;  2DLZ A;  1BKL A;  5I6V A;  2RSY A;  4F5B A;  1NZV A;  3VS6 A;  1BFI A;  1LKL A;  1GRI A;  4EIH A;  1KSW A;  1LUM A;  3VS7 A;  1BLK A;  5D0J A;  5GJI A;  5IBM A;  2CR4 A;  1MW4 A;  1Y57 A;  2MC1 A;  4E93 A;  4L1B B;  3WA4 A;  3VRQ A;  2RMX A;  2YSX A;  3M7F A;  1D4T A;  2EYV A;  1FU6 A;  4OHH A;  3TL0 A;  4A4B A;  2IUI A;  3US4 A;  3BUM B;  3HIZ B;  2C0O A;  4OHI A;  3OP0 A;  1IJR A;  1BHF A;  1JYU A;  2MK2 A;  1KA6 A;  1RJA A;  3VRY A;  1O4O A;  2PNB A;  3OB2 B;  1SKJ A;  2ROR A;  1A81 A;  2HCK A;  4JEG A;  5HKZ A;  5EG3 B;  3BKB A;  1O4D A;  1A1B A;  1CWD L;  2SRC A;  3VRR A;  1H9O A;  2EO3 A;  2DLY A;  1SHA A;  5DC0 B;  4F59 A;  2DM0 A;  2C0T A;  3VRO A;  5KAZ A;  1IS0 A;  3S8N A;  1O48 A;  3NHN A;  1B47 A;  3OB1 B;  4K2R A;  1BM2 A;  3VS0 A;  1WQU A;  4OHE A;  2KNO A;  3PS5 A;  4U17 A;  3K2M A;  1BFJ A;  2LQW A;  1D4W A;  1KC2 A;  1YVH A;  4EY0 A;  1LKK A;  1OO3 A;  2B3O A;  3S8L A;  1JU5 A;  2HUW A;  3GQI B;  1O4R A;  1FBV A;  4QSY A;  1O4C A;  2H8H A;  4XZ0 A;  1R1P A;  2Y3A B;  4K45 A;  2EYZ A;  2OZO A;  2MQI A;  1O42 A;  4LUE A;  3PLF B;  4XZ1 A;  3VS1 A;  1O4J A;  5EEQ A;  1O44 A;  1RQQ C;  1SHD A;  1OPK A;  1AB2 A;  2L4K A;  3OVE A;  2JYQ A;  4P9Z A;  2LCT A;  5HKY A;  3S9K A;  1BHH B;  1A1E A;  1O4A A;  1BHH A;  1K9A A;  4FBN A;  1MIL A;  1O49 A;  1CSZ A;  2EYY A;  2BBU A;  3MXC A;  1O4H A;  1UUS A;  1LCK A;  2OQ1 A;  1R1Q A;  1FHS A;  5IBS A;  4NWG A;  4FL3 A;  1A09 A;  1O47 A;  3PSJ A; 
#chains in the Genus database with same CATH topology
 4M4Z A;  1OO4 A;  3C7I A;  4E68 A;  1BLJ A;  2PTK A;  3VS3 A;  1OPL A;  1LUN A;  1M61 A;  1O4E A;  4P9V A;  1AOT F;  2KGY A;  2EOB A;  4H1O A;  4OHD A;  5DC9 A;  2FO0 A;  1BKM A;  1O4F A;  1O4I A;  1FU5 A;  1A1C A;  3IMD A;  1HCS B;  2VIF A;  3UYO A;  4JGH A;  1RPY A;  1LUK A;  1FBZ A;  2QMS A;  3UF4 A;  2CIA A;  1SPS A;  3CWG A;  3T04 A;  3N7Y A;  4TZI A;  2HMH A;  1O41 A;  3N84 A;  4K11 A;  1TZE E;  3VRN A;  1R1S A;  2PLD A;  5EEL A;  1O4P A;  1FMK A;  5CDW A;  4U1P A;  4F5A A;  2HDX A;  2RVF A;  2IUH A;  1X27 A;  4LUD A;  2EU0 A;  2IUG A;  4JE4 A;  1CJ1 A;  1A08 A;  4WWQ A;  5EHP A;  4FL2 A;  4K44 A;  2K7A B;  1O4G A;  2XP1 A;  3PFV A;  5GJH A;  1NRV A;  1X0N A;  2FCI A;  3TKZ A;  1Z3K A;  3CBL A;  1Y1U A;  1SHB A;  2ECD A;  3HCK A;  3PQZ A;  3VS2 A;  4ROJ A;  2GSB A;  1O4Q A;  1F1W A;  1O45 A;  3K2T A;  1AYD A;  2AUG A;  2KK6 A;  1HCT B;  3MXY A;  3CXL A;  3EAZ A;  1O4L A;  3KFJ A;  1JYR A;  2DX0 A;  2CBL A;  2H46 E;  1QCF A;  4DGX A;  4A4C A;  4D8K A;  1A1A A;  1P13 A;  1AYC A;  3N8M A;  3VGO A;  2MRJ A;  3CD3 A;  2EL8 A;  3EAC A;  3IN8 A;  5AXI A;  1UUR A;  1BF5 A;  5HKW A;  2PNA A;  1I3Z A;  1AYA A;  1CSY A;  1AD5 A;  4X6S A;  1JWO A;  3OV1 A;  3BUW B;  1O4M A;  2C9W A;  1KA7 A;  2Y1M A;  1O4N A;  3MAZ A;  1O46 A;  2PLE A;  5BO4 A;  2LQN A;  4GWF A;  2H5K A;  2AOA A;  1G83 A;  1X6C A;  3VS4 A;  3BUX B;  3GXW A;  1O4K A;  3VRP A;  3GXX A;  1BMB A;  1BG1 A;  5DF6 A;  2DCR A;  1D1Z A;  3IN7 A;  3LYV A;  4DGP A;  4GL9 E;  2AOB A;  2EKX A;  1O43 A;  1QG1 E;  5DC4 A;  4NWF A;  4H34 A;  1GHU A;  2LNX A;  2L6K A;  2ABL A;  2CS0 A;  1XA6 A;  1JYQ A;  2LNW A;  1YVL A;  3VS5 A;  3S8O A;  5AUL A;  2CI8 A;  4OHL A;  3ZNI A;  1ZFP E;  1O4B A;  1SPR A;  1NZL A;  2CI9 A;  3BUO B;  1LUI A;  2IZV A;  1F2F A;  1TCE A;  4GPL B;  1AYB A;  2CRH A;  3PSK A;  2EO6 A;  3QWY A;  2SHP A;  3IMJ A;  1LCJ A;  2C0I A;  2Y1N A;  3BUN B;  1A07 A;  1PIC A;  3HHM B;  2YU7 A;  3VRZ A;  3QWX X;  2MRK A;  2HDV A;  1M27 A;  2L3T A;  3PJP A;  5EHR A;  1QAD A;  5J3X A;  2K79 B;  2GE9 A;  1AOU F;  2DVJ A;  1FYR A;  2ETZ A;  1CWE A;  2DLZ A;  1BKL A;  5I6V A;  2RSY A;  4F5B A;  1NZV A;  3VS6 A;  1BFI A;  1LKL A;  1GRI A;  4EIH A;  1KSW A;  1LUM A;  3VS7 A;  1BLK A;  5D0J A;  5GJI A;  5IBM A;  2CR4 A;  1MW4 A;  1Y57 A;  2MC1 A;  4E93 A;  4L1B B;  3WA4 A;  3VRQ A;  2RMX A;  2YSX A;  3M7F A;  1D4T A;  2EYV A;  1FU6 A;  4OHH A;  3TL0 A;  4A4B A;  2IUI A;  3US4 A;  3BUM B;  3HIZ B;  2C0O A;  4OHI A;  3OP0 A;  1IJR A;  1BHF A;  1JYU A;  2MK2 A;  1KA6 A;  1RJA A;  3VRY A;  1O4O A;  2PNB A;  3OB2 B;  1SKJ A;  2ROR A;  1A81 A;  2HCK A;  4JEG A;  5HKZ A;  5EG3 B;  3BKB A;  1O4D A;  1A1B A;  1CWD L;  2SRC A;  3VRR A;  1H9O A;  2EO3 A;  2DLY A;  1SHA A;  5DC0 B;  4F59 A;  2DM0 A;  2C0T A;  3VRO A;  5KAZ A;  1IS0 A;  3S8N A;  1O48 A;  3NHN A;  1B47 A;  3OB1 B;  4K2R A;  1BM2 A;  3VS0 A;  1WQU A;  4OHE A;  2KNO A;  3PS5 A;  4U17 A;  3K2M A;  1BFJ A;  2LQW A;  1D4W A;  1KC2 A;  1YVH A;  4EY0 A;  1LKK A;  1OO3 A;  2B3O A;  3S8L A;  1JU5 A;  2HUW A;  3GQI B;  1O4R A;  1FBV A;  4QSY A;  1O4C A;  2LRA A;  2H8H A;  4XZ0 A;  1R1P A;  2Y3A B;  4K45 A;  2EYZ A;  2OZO A;  2MQI A;  1O42 A;  4LUE A;  3PLF B;  4XZ1 A;  3VS1 A;  1O4J A;  5EEQ A;  1O44 A;  1RQQ C;  1SHD A;  1OPK A;  1AB2 A;  2L4K A;  3OVE A;  2JYQ A;  4P9Z A;  2LCT A;  5HKY A;  3S9K A;  1BHH B;  1A1E A;  1O4A A;  1BHH A;  1K9A A;  4FBN A;  1MIL A;  1O49 A;  1CSZ A;  2EYY A;  2BBU A;  3MXC A;  1O4H A;  1UUS A;  1LCK A;  2OQ1 A;  1R1Q A;  1FHS A;  5IBS A;  4NWG A;  4FL3 A;  1A09 A;  1O47 A;  3PSJ A; 
#chains in the Genus database with same CATH homology
 4M4Z A;  1OO4 A;  3C7I A;  4E68 A;  1BLJ A;  2PTK A;  3VS3 A;  1OPL A;  1LUN A;  1M61 A;  1O4E A;  4P9V A;  1AOT F;  2EOB A;  4H1O A;  4OHD A;  5DC9 A;  2FO0 A;  1BKM A;  1O4F A;  1O4I A;  1FU5 A;  1A1C A;  3IMD A;  1HCS B;  2VIF A;  3UYO A;  4JGH A;  1RPY A;  1LUK A;  1FBZ A;  2QMS A;  3UF4 A;  2CIA A;  1SPS A;  3CWG A;  3T04 A;  3N7Y A;  4TZI A;  2HMH A;  1O41 A;  3N84 A;  4K11 A;  1TZE E;  3VRN A;  1R1S A;  2PLD A;  5EEL A;  1O4P A;  1FMK A;  5CDW A;  4U1P A;  4F5A A;  2HDX A;  2RVF A;  2IUH A;  1X27 A;  4LUD A;  2EU0 A;  2IUG A;  4JE4 A;  1CJ1 A;  1A08 A;  4WWQ A;  5EHP A;  4FL2 A;  4K44 A;  2K7A B;  1O4G A;  2XP1 A;  3PFV A;  5GJH A;  1NRV A;  1X0N A;  2FCI A;  3TKZ A;  1Z3K A;  3CBL A;  1Y1U A;  1SHB A;  2ECD A;  3HCK A;  3PQZ A;  3VS2 A;  4ROJ A;  2GSB A;  1O4Q A;  1F1W A;  1O45 A;  1AYD A;  2AUG A;  2KK6 A;  1HCT B;  3MXY A;  3CXL A;  3EAZ A;  1O4L A;  3KFJ A;  1JYR A;  2DX0 A;  2CBL A;  2H46 E;  1QCF A;  4DGX A;  4A4C A;  4D8K A;  1A1A A;  1P13 A;  1AYC A;  3N8M A;  3VGO A;  2MRJ A;  3CD3 A;  2EL8 A;  3EAC A;  3IN8 A;  5AXI A;  1UUR A;  1BF5 A;  5HKW A;  2PNA A;  1I3Z A;  1AYA A;  1CSY A;  1AD5 A;  4X6S A;  1JWO A;  3OV1 A;  3BUW B;  1O4M A;  2C9W A;  1KA7 A;  2Y1M A;  1O4N A;  3MAZ A;  1O46 A;  2PLE A;  5BO4 A;  2LQN A;  4GWF A;  2H5K A;  2AOA A;  1G83 A;  1X6C A;  3VS4 A;  3BUX B;  3GXW A;  1O4K A;  3VRP A;  3GXX A;  1BMB A;  1BG1 A;  5DF6 A;  2DCR A;  1D1Z A;  3IN7 A;  4DGP A;  4GL9 E;  2AOB A;  2EKX A;  1O43 A;  1QG1 E;  5DC4 A;  4NWF A;  4H34 A;  1GHU A;  2LNX A;  2L6K A;  2ABL A;  2CS0 A;  1XA6 A;  1JYQ A;  2LNW A;  1YVL A;  3VS5 A;  3S8O A;  5AUL A;  2CI8 A;  4OHL A;  3ZNI A;  1ZFP E;  1O4B A;  1SPR A;  1NZL A;  2CI9 A;  3BUO B;  1LUI A;  2IZV A;  1F2F A;  1TCE A;  4GPL B;  1AYB A;  2CRH A;  3PSK A;  2EO6 A;  3QWY A;  2SHP A;  3IMJ A;  1LCJ A;  2C0I A;  2Y1N A;  3BUN B;  1A07 A;  1PIC A;  3HHM B;  2YU7 A;  3VRZ A;  3QWX X;  2MRK A;  2HDV A;  1M27 A;  2L3T A;  3PJP A;  5EHR A;  1QAD A;  5J3X A;  2K79 B;  2GE9 A;  1AOU F;  2DVJ A;  1FYR A;  2ETZ A;  1CWE A;  2DLZ A;  1BKL A;  5I6V A;  2RSY A;  4F5B A;  1NZV A;  3VS6 A;  1BFI A;  1LKL A;  1GRI A;  4EIH A;  1KSW A;  1LUM A;  3VS7 A;  1BLK A;  5D0J A;  5GJI A;  5IBM A;  2CR4 A;  1MW4 A;  1Y57 A;  2MC1 A;  4E93 A;  4L1B B;  3WA4 A;  3VRQ A;  2RMX A;  2YSX A;  3M7F A;  1D4T A;  2EYV A;  1FU6 A;  4OHH A;  3TL0 A;  4A4B A;  2IUI A;  3US4 A;  3BUM B;  3HIZ B;  2C0O A;  4OHI A;  3OP0 A;  1IJR A;  1BHF A;  1JYU A;  2MK2 A;  1KA6 A;  1RJA A;  3VRY A;  1O4O A;  2PNB A;  3OB2 B;  1SKJ A;  2ROR A;  1A81 A;  2HCK A;  4JEG A;  5HKZ A;  5EG3 B;  3BKB A;  1O4D A;  1A1B A;  1CWD L;  2SRC A;  3VRR A;  1H9O A;  2EO3 A;  2DLY A;  1SHA A;  5DC0 B;  4F59 A;  2DM0 A;  2C0T A;  3VRO A;  5KAZ A;  1IS0 A;  3S8N A;  1O48 A;  3NHN A;  1B47 A;  3OB1 B;  4K2R A;  1BM2 A;  3VS0 A;  1WQU A;  4OHE A;  2KNO A;  3PS5 A;  4U17 A;  3K2M A;  1BFJ A;  2LQW A;  1D4W A;  1KC2 A;  1YVH A;  4EY0 A;  1LKK A;  1OO3 A;  2B3O A;  3S8L A;  1JU5 A;  2HUW A;  3GQI B;  1O4R A;  1FBV A;  4QSY A;  1O4C A;  2H8H A;  4XZ0 A;  1R1P A;  2Y3A B;  4K45 A;  2EYZ A;  2OZO A;  2MQI A;  1O42 A;  4LUE A;  3PLF B;  4XZ1 A;  3VS1 A;  1O4J A;  5EEQ A;  1O44 A;  1RQQ C;  1SHD A;  1OPK A;  1AB2 A;  2L4K A;  3OVE A;  2JYQ A;  4P9Z A;  2LCT A;  5HKY A;  3S9K A;  1BHH B;  1A1E A;  1O4A A;  1BHH A;  1K9A A;  4FBN A;  1MIL A;  1O49 A;  1CSZ A;  2EYY A;  2BBU A;  3MXC A;  1O4H A;  1UUS A;  1LCK A;  2OQ1 A;  1R1Q A;  1FHS A;  5IBS A;  4NWG A;  4FL3 A;  1A09 A;  1O47 A;  3PSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...