2H46E

Native domain-swapped dimer crystal structure of the grb2 sh2 domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
b'MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth Receptor Binding Protein 2
publication title Structural and energetic aspects of Grb2-SH2 domain-swapping.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 19
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2h46E00
1D4TA 1SPSA 1JYRA 2PNBA 5EG3B 2GSBA 5EHPA 1A1AA 1A08A 4A4BA 2LQWA 1O4FA 4K44A 3IN7A 1O46A 2MQIA 2H5KA 3OB2B 1A81A 1O48A 2RSYA 1HCTB 1MILA 3OV1A 2EOBA 1R1PA 5KAZA 3MAZA 1UURA 4DGXA 1O4BA 1AB2A 1NZVA 1O47A 1SPRA 2EYYA 1O4OA 1AYCA 2DM0A 2HMHA 2LQNA 3VS3A 2K7AB 2MK2A 1G83A 3S8LA 3IMJA 1X6CA 1O44A 3EACA 3PLFB 3CXLA 2IZVA 1BMBA 1O4DA 3BUMB 1FYRA 1BFJA 4ROJA 5EHRA 4K45A 2LNXA 3VS7A 2CI8A 3PSKA 1A1CA 1LUMA 1JYQA 3UF4A 2EYZA 4F59A 4LUDA 2EO6A 1OPLA 4QSYA 1A1BA 2JYQA 2C0OA 3T04A 2AOAA 1CSZA 2MRJA 1RQQC 5EEQA 1GHUA 1X0NA 2Y1MA 2FCIA 2EU0A 1KC2A 1R1SA 3N84A 2EO3A 4JGHA 1PICA 1FMKA 1XA6A 3VRPA 5DF6A 1BLJA 2K79B 3VRNA 2MRKA 4OHDA 5HKYA 3HCKA 1AYDA 2IUHA 2PLEA 3VRYA 1CJ1A 1BHFA 1KA6A 2RORA 5EELA 1O4NA 5BO4A 3C7IA 1CWDL 2QMSA 1SHAA 3IN8A 1O4GA 4P9ZA 3OB1B 2HDXA 3VRZA 1WQUA 2AOBA 1O4EA 2KK6A 4JE4A 2L6KA 4E68A 1A1EA 2C0TA 4E93A 1BKMA 1JU5A 1KA7A 3WA4A 1O41A 1A09A 2SRCA 3GQIB 3BUWB 2Y3AB 1LKKA 1O4KA 2LNWA 3VRRA 1BLKA 1F2FA 4H34A 1OPKA 5I6VA 4D8KA 4OHEA 2H46E 5DC0B 3GXWA 1O4RA 3HIZB 1LUKA 2CIAA 2PTKA 3MXYA 1O4QA 2EKXA 3VS5A 1AD5A 1SHBA 2DVJA 4GL9E 1CSYA 3OP0A 1SKJA 5AXIA 3N8MA 1QADA 2YSXA 2OQ1A 4U1PA 1LUIA 4L1BB 1TZEE 2CRHA 1BF5A 3VS4A 4FL2A 2ETZA 1Y1UA 2XP1A 1JWOA 2OZOA 1O42A 2VIFA 3BUXB 3VS2A 2LCTA 2CBLA 4NWGA 3EAZA 1JYUA 1D1ZA 1FU5A 2CI9A 1O43A 1R1QA 3HHMB 3S8NA 1M61A 5IBSA 2YU7A 2L4KA 3M7FA 4XZ1A 1O49A 3K2MA 2RVFA 1B47A 1FHSA 2ABLA 3S9KA 1FBZA 4JEGA 1O4CA 2PLDA 1AYBA 4WWQA 4X6SA 2Y1NA 4GPLB 4OHLA 1O4IA 3OVEA 1Y57A 5DC4A 4A4CA 4F5AA 4K11A 3UYOA 5CDWA 3VS0A 3MXCA 1BKLA 2PNAA 3PJPA 2EL8A 1O4PA 3CWGA 1H9OA 1SHDA 1BG1A 3US4A 1RJAA 2BBUA 2H8HA 3PS5A 3VROA 2L3TA 3QWXX 1O4HA 2CR4A 2C9WA 4P9VA 1BHHA 3CD3A 3TL0A 5DC9A 1LKLA 5D0JA 2AUGA 1LCJA 1BFIA 5AULA 4OHHA 1YVHA 1F1WA 3PSJA 4FBNA 4XZ0A 1YVLA 3TKZA 4OHIA 3VS6A 5GJIA 3VS1A 3VRQA 4DGPA 3CBLA 4GWFA 1O4JA 1O4AA 1I3ZA 1HCSB 1O4MA 1AYAA 1X27A 2DX0A 1OO4A 2HCKA 1BM2A 1LUNA 2IUIA 4LUEA 1K9AA 4NWFA 1RPYA 2SHPA 1D4WA 3PQZA 3ZNIA 3IMDA 3BKBA 3KFJA 3N7YA 1IJRA 3VGOA 4EY0A 2CS0A 1KSWA 1UUSA 1AOTF 1NRVA 1FBVA 5IBMA 3GXXA 4H1OA 4TZIA 3S8OA 1O4LA 3QWYA 1Z3KA 1MW4A 1FU6A 1QG1E 4FL3A 1O45A 3BUOB 4M4ZA 2KNOA 2MC1A 1OO3A 2HUWA 2FO0A 2DCRA 1CWEA 2EYVA 4K2RA 5HKWA 2DLZA 1NZLA 1AOUF 2ECDA 3BUNB 5J3XA 1ZFPE 2C0IA 3PFVA 1QCFA 4EIHA 5HKZA 2GE9A 1IS0A 1P13A 2B3OA 1M27A 4F5BA 2DLYA 1BHHB 1LCKA 1GRIA 3NHNA 5GJHA 1A07A 2HDVA 2RMXA 2IUGA 1TCEA 4U17A
chains in the Genus database with same CATH superfamily
1D4TA 1SPSA 1JYRA 2PNBA 5EG3B 2GSBA 5EHPA 1A1AA 1A08A 4A4BA 2LQWA 1O4FA 4K44A 3IN7A 1O46A 2MQIA 2H5KA 3OB2B 1A81A 1O48A 2RSYA 1HCTB 1MILA 3OV1A 2EOBA 1R1PA 5KAZA 3MAZA 1UURA 4DGXA 1O4BA 1AB2A 1NZVA 1O47A 1SPRA 2EYYA 1O4OA 1AYCA 2DM0A 2HMHA 2LQNA 3VS3A 2K7AB 2MK2A 1G83A 3S8LA 3IMJA 1X6CA 1O44A 3EACA 3PLFB 3CXLA 2IZVA 1BMBA 1O4DA 3BUMB 1FYRA 1BFJA 4ROJA 5EHRA 4K45A 2LNXA 3VS7A 2CI8A 3PSKA 1A1CA 1LUMA 1JYQA 3UF4A 2EYZA 4F59A 4LUDA 2EO6A 1OPLA 4QSYA 1A1BA 2JYQA 2C0OA 3T04A 3LYVA 2AOAA 3K2TA 1CSZA 2MRJA 1RQQC 5EEQA 1GHUA 1X0NA 2Y1MA 2FCIA 2EU0A 1KC2A 1R1SA 3N84A 2EO3A 4JGHA 1PICA 1FMKA 1XA6A 3VRPA 5DF6A 1BLJA 2K79B 3VRNA 2KGYA 2MRKA 4OHDA 5HKYA 3HCKA 1AYDA 2IUHA 2PLEA 3VRYA 1CJ1A 1BHFA 1KA6A 2RORA 5EELA 1O4NA 5BO4A 3C7IA 1CWDL 2QMSA 1SHAA 3IN8A 1O4GA 4P9ZA 3OB1B 2HDXA 3VRZA 1WQUA 2AOBA 1O4EA 2KK6A 4JE4A 2L6KA 4E68A 1A1EA 2C0TA 4E93A 1BKMA 1JU5A 1KA7A 3WA4A 1O41A 1A09A 2SRCA 3GQIB 3BUWB 2Y3AB 1LKKA 1O4KA 2LNWA 3VRRA 1BLKA 1F2FA 4H34A 1OPKA 5I6VA 4D8KA 4OHEA 2H46E 5DC0B 3GXWA 1O4RA 3HIZB 1LUKA 2CIAA 2PTKA 3MXYA 1O4QA 2EKXA 3VS5A 1AD5A 1SHBA 2DVJA 4GL9E 1CSYA 3OP0A 1SKJA 5AXIA 3N8MA 1QADA 2YSXA 2OQ1A 4U1PA 1LUIA 4L1BB 1TZEE 2CRHA 1BF5A 3VS4A 4FL2A 2ETZA 1Y1UA 2XP1A 1JWOA 2OZOA 1O42A 2VIFA 3BUXB 3VS2A 2LCTA 2CBLA 4NWGA 3EAZA 1JYUA 1D1ZA 1FU5A 2CI9A 1O43A 1R1QA 3HHMB 3S8NA 1M61A 5IBSA 2YU7A 2L4KA 3M7FA 4XZ1A 1O49A 2LRAA 3K2MA 2RVFA 1B47A 1FHSA 2ABLA 3S9KA 1FBZA 4JEGA 1O4CA 2PLDA 1AYBA 4WWQA 4X6SA 2Y1NA 4GPLB 4OHLA 1O4IA 3OVEA 1Y57A 5DC4A 4A4CA 4F5AA 4K11A 3UYOA 5CDWA 3VS0A 3MXCA 1BKLA 2PNAA 3PJPA 2EL8A 1O4PA 3CWGA 1H9OA 1SHDA 1BG1A 3US4A 1RJAA 2BBUA 2H8HA 3PS5A 3VROA 2L3TA 3QWXX 1O4HA 2CR4A 2C9WA 4P9VA 1BHHA 3CD3A 3TL0A 5DC9A 1LKLA 5D0JA 2AUGA 1LCJA 1BFIA 5AULA 4OHHA 1YVHA 1F1WA 3PSJA 4FBNA 4XZ0A 1YVLA 3TKZA 4OHIA 3VS6A 5GJIA 3VS1A 3VRQA 4DGPA 3CBLA 4GWFA 1O4JA 1O4AA 1I3ZA 1HCSB 1O4MA 1AYAA 1X27A 2DX0A 1OO4A 2HCKA 1BM2A 1LUNA 2IUIA 4LUEA 1K9AA 4NWFA 1RPYA 2SHPA 1D4WA 3PQZA 3ZNIA 3IMDA 3BKBA 3KFJA 3N7YA 1IJRA 3VGOA 4EY0A 2CS0A 1KSWA 1UUSA 1AOTF 1NRVA 1FBVA 5IBMA 3GXXA 4H1OA 4TZIA 3S8OA 1O4LA 3QWYA 1Z3KA 1MW4A 1FU6A 1QG1E 4FL3A 1O45A 3BUOB 4M4ZA 2KNOA 2MC1A 1OO3A 2HUWA 2FO0A 2DCRA 1CWEA 2EYVA 4K2RA 5HKWA 2DLZA 1NZLA 1AOUF 2ECDA 3BUNB 5J3XA 1ZFPE 2C0IA 3PFVA 1QCFA 4EIHA 5HKZA 2GE9A 1IS0A 1P13A 2B3OA 1M27A 4F5BA 2DLYA 1BHHB 1LCKA 1GRIA 3NHNA 5GJHA 1A07A 2HDVA 2RMXA 2IUGA 1TCEA 4U17A
chains in the Genus database with same CATH topology
1D4TA 1SPSA 1JYRA 2PNBA 5EG3B 2GSBA 5EHPA 1A1AA 1A08A 4A4BA 2LQWA 1O4FA 4K44A 3IN7A 1O46A 2MQIA 2H5KA 3OB2B 1A81A 1O48A 2RSYA 1HCTB 1MILA 3OV1A 2EOBA 1R1PA 5KAZA 3MAZA 1UURA 4DGXA 1O4BA 1AB2A 1NZVA 1O47A 1SPRA 2EYYA 1O4OA 1AYCA 2DM0A 2HMHA 2LQNA 3VS3A 2K7AB 2MK2A 1G83A 3S8LA 3IMJA 1X6CA 1O44A 3EACA 3PLFB 3CXLA 2IZVA 1BMBA 1O4DA 3BUMB 1FYRA 1BFJA 4ROJA 5EHRA 4K45A 2LNXA 3VS7A 2CI8A 3PSKA 1A1CA 1LUMA 1JYQA 3UF4A 2EYZA 4F59A 4LUDA 2EO6A 1OPLA 4QSYA 1A1BA 2JYQA 2C0OA 3T04A 2AOAA 1CSZA 2MRJA 1RQQC 5EEQA 1GHUA 1X0NA 2Y1MA 2FCIA 2EU0A 1KC2A 1R1SA 3N84A 2EO3A 4JGHA 1PICA 1FMKA 1XA6A 3VRPA 5DF6A 1BLJA 2K79B 3VRNA 2MRKA 4OHDA 5HKYA 3HCKA 1AYDA 2IUHA 2PLEA 3VRYA 1CJ1A 1BHFA 1KA6A 2RORA 5EELA 1O4NA 5BO4A 3C7IA 1CWDL 2QMSA 1SHAA 3IN8A 1O4GA 4P9ZA 3OB1B 2HDXA 3VRZA 1WQUA 2AOBA 1O4EA 2KK6A 4JE4A 2L6KA 4E68A 1A1EA 2C0TA 4E93A 1BKMA 1JU5A 1KA7A 3WA4A 1O41A 1A09A 2SRCA 3GQIB 3BUWB 2Y3AB 1LKKA 1O4KA 2LNWA 3VRRA 1BLKA 1F2FA 4H34A 1OPKA 5I6VA 4D8KA 4OHEA 2H46E 5DC0B 3GXWA 1O4RA 3HIZB 1LUKA 2CIAA 2PTKA 3MXYA 1O4QA 2EKXA 3VS5A 1AD5A 1SHBA 2DVJA 4GL9E 1CSYA 3OP0A 1SKJA 5AXIA 3N8MA 1QADA 2YSXA 2OQ1A 4U1PA 1LUIA 4L1BB 1TZEE 2CRHA 1BF5A 3VS4A 4FL2A 2ETZA 1Y1UA 2XP1A 1JWOA 2OZOA 1O42A 2VIFA 3BUXB 3VS2A 2LCTA 2CBLA 4NWGA 3EAZA 1JYUA 1D1ZA 1FU5A 2CI9A 1O43A 1R1QA 3HHMB 3S8NA 1M61A 5IBSA 2YU7A 2L4KA 3M7FA 4XZ1A 1O49A 3K2MA 2RVFA 1B47A 1FHSA 2ABLA 3S9KA 1FBZA 4JEGA 1O4CA 2PLDA 1AYBA 4WWQA 4X6SA 2Y1NA 4GPLB 4OHLA 1O4IA 3OVEA 1Y57A 5DC4A 4A4CA 4F5AA 4K11A 3UYOA 5CDWA 3VS0A 3MXCA 1BKLA 2PNAA 3PJPA 2EL8A 1O4PA 3CWGA 1H9OA 1SHDA 1BG1A 3US4A 1RJAA 2BBUA 2H8HA 3PS5A 3VROA 2L3TA 3QWXX 1O4HA 2CR4A 2C9WA 4P9VA 1BHHA 3CD3A 3TL0A 5DC9A 1LKLA 5D0JA 2AUGA 1LCJA 1BFIA 5AULA 4OHHA 1YVHA 1F1WA 3PSJA 4FBNA 4XZ0A 1YVLA 3TKZA 4OHIA 3VS6A 5GJIA 3VS1A 3VRQA 4DGPA 3CBLA 4GWFA 1O4JA 1O4AA 1I3ZA 1HCSB 1O4MA 1AYAA 1X27A 2DX0A 1OO4A 2HCKA 1BM2A 1LUNA 2IUIA 4LUEA 1K9AA 4NWFA 1RPYA 2SHPA 1D4WA 3PQZA 3ZNIA 3IMDA 3BKBA 3KFJA 3N7YA 1IJRA 3VGOA 4EY0A 2CS0A 1KSWA 1UUSA 1AOTF 1NRVA 1FBVA 5IBMA 3GXXA 4H1OA 4TZIA 3S8OA 1O4LA 3QWYA 1Z3KA 1MW4A 1FU6A 1QG1E 4FL3A 1O45A 3BUOB 4M4ZA 2KNOA 2MC1A 1OO3A 2HUWA 2FO0A 2DCRA 1CWEA 2EYVA 4K2RA 5HKWA 2DLZA 1NZLA 1AOUF 2ECDA 3BUNB 5J3XA 1ZFPE 2C0IA 3PFVA 1QCFA 4EIHA 5HKZA 2GE9A 1IS0A 1P13A 2B3OA 1M27A 4F5BA 2DLYA 1BHHB 1LCKA 1GRIA 3NHNA 5GJHA 1A07A 2HDVA 2RMXA 2IUGA 1TCEA 4U17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D4T A;  1SPS A;  1JYR A;  2PNB A;  5EG3 B;  2GSB A;  5EHP A;  1A1A A;  1A08 A;  4A4B A;  2LQW A;  1O4F A;  4K44 A;  3IN7 A;  1O46 A;  2MQI A;  2H5K A;  3OB2 B;  1A81 A;  1O48 A;  2RSY A;  1HCT B;  1MIL A;  3OV1 A;  2EOB A;  1R1P A;  5KAZ A;  3MAZ A;  1UUR A;  4DGX A;  1O4B A;  1AB2 A;  1NZV A;  1O47 A;  1SPR A;  2EYY A;  1O4O A;  1AYC A;  2DM0 A;  2HMH A;  2LQN A;  3VS3 A;  2K7A B;  2MK2 A;  1G83 A;  3S8L A;  3IMJ A;  1X6C A;  1O44 A;  3EAC A;  3PLF B;  3CXL A;  2IZV A;  1BMB A;  1O4D A;  3BUM B;  1FYR A;  1BFJ A;  4ROJ A;  5EHR A;  4K45 A;  2LNX A;  3VS7 A;  2CI8 A;  3PSK A;  1A1C A;  1LUM A;  1JYQ A;  3UF4 A;  2EYZ A;  4F59 A;  4LUD A;  2EO6 A;  1OPL A;  4QSY A;  1A1B A;  2JYQ A;  2C0O A;  3T04 A;  2AOA A;  1CSZ A;  2MRJ A;  1RQQ C;  5EEQ A;  1GHU A;  1X0N A;  2Y1M A;  2FCI A;  2EU0 A;  1KC2 A;  1R1S A;  3N84 A;  2EO3 A;  4JGH A;  1PIC A;  1FMK A;  1XA6 A;  3VRP A;  5DF6 A;  1BLJ A;  2K79 B;  3VRN A;  2MRK A;  4OHD A;  5HKY A;  3HCK A;  1AYD A;  2IUH A;  2PLE A;  3VRY A;  1CJ1 A;  1BHF A;  1KA6 A;  2ROR A;  5EEL A;  1O4N A;  5BO4 A;  3C7I A;  1CWD L;  2QMS A;  1SHA A;  3IN8 A;  1O4G A;  4P9Z A;  3OB1 B;  2HDX A;  3VRZ A;  1WQU A;  2AOB A;  1O4E A;  2KK6 A;  4JE4 A;  2L6K A;  4E68 A;  1A1E A;  2C0T A;  4E93 A;  1BKM A;  1JU5 A;  1KA7 A;  3WA4 A;  1O41 A;  1A09 A;  2SRC A;  3GQI B;  3BUW B;  2Y3A B;  1LKK A;  1O4K A;  2LNW A;  3VRR A;  1BLK A;  1F2F A;  4H34 A;  1OPK A;  5I6V A;  4D8K A;  4OHE A;  2H46 E;  5DC0 B;  3GXW A;  1O4R A;  3HIZ B;  1LUK A;  2CIA A;  2PTK A;  3MXY A;  1O4Q A;  2EKX A;  3VS5 A;  1AD5 A;  1SHB A;  2DVJ A;  4GL9 E;  1CSY A;  3OP0 A;  1SKJ A;  5AXI A;  3N8M A;  1QAD A;  2YSX A;  2OQ1 A;  4U1P A;  1LUI A;  4L1B B;  1TZE E;  2CRH A;  1BF5 A;  3VS4 A;  4FL2 A;  2ETZ A;  1Y1U A;  2XP1 A;  1JWO A;  2OZO A;  1O42 A;  2VIF A;  3BUX B;  3VS2 A;  2LCT A;  2CBL A;  4NWG A;  3EAZ A;  1JYU A;  1D1Z A;  1FU5 A;  2CI9 A;  1O43 A;  1R1Q A;  3HHM B;  3S8N A;  1M61 A;  5IBS A;  2YU7 A;  2L4K A;  3M7F A;  4XZ1 A;  1O49 A;  3K2M A;  2RVF A;  1B47 A;  1FHS A;  2ABL A;  3S9K A;  1FBZ A;  4JEG A;  1O4C A;  2PLD A;  1AYB A;  4WWQ A;  4X6S A;  2Y1N A;  4GPL B;  4OHL A;  1O4I A;  3OVE A;  1Y57 A;  5DC4 A;  4A4C A;  4F5A A;  4K11 A;  3UYO A;  5CDW A;  3VS0 A;  3MXC A;  1BKL A;  2PNA A;  3PJP A;  2EL8 A;  1O4P A;  3CWG A;  1H9O A;  1SHD A;  1BG1 A;  3US4 A;  1RJA A;  2BBU A;  2H8H A;  3PS5 A;  3VRO A;  2L3T A;  3QWX X;  1O4H A;  2CR4 A;  2C9W A;  4P9V A;  1BHH A;  3CD3 A;  3TL0 A;  5DC9 A;  1LKL A;  5D0J A;  2AUG A;  1LCJ A;  1BFI A;  5AUL A;  4OHH A;  1YVH A;  1F1W A;  3PSJ A;  4FBN A;  4XZ0 A;  1YVL A;  3TKZ A;  4OHI A;  3VS6 A;  5GJI A;  3VS1 A;  3VRQ A;  4DGP A;  3CBL A;  4GWF A;  1O4J A;  1O4A A;  1I3Z A;  1HCS B;  1O4M A;  1AYA A;  1X27 A;  2DX0 A;  1OO4 A;  2HCK A;  1BM2 A;  1LUN A;  2IUI A;  4LUE A;  1K9A A;  4NWF A;  1RPY A;  2SHP A;  1D4W A;  3PQZ A;  3ZNI A;  3IMD A;  3BKB A;  3KFJ A;  3N7Y A;  1IJR A;  3VGO A;  4EY0 A;  2CS0 A;  1KSW A;  1UUS A;  1AOT F;  1NRV A;  1FBV A;  5IBM A;  3GXX A;  4H1O A;  4TZI A;  3S8O A;  1O4L A;  3QWY A;  1Z3K A;  1MW4 A;  1FU6 A;  1QG1 E;  4FL3 A;  1O45 A;  3BUO B;  4M4Z A;  2KNO A;  2MC1 A;  1OO3 A;  2HUW A;  2FO0 A;  2DCR A;  1CWE A;  2EYV A;  4K2R A;  5HKW A;  2DLZ A;  1NZL A;  1AOU F;  2ECD A;  3BUN B;  5J3X A;  1ZFP E;  2C0I A;  3PFV A;  1QCF A;  4EIH A;  5HKZ A;  2GE9 A;  1IS0 A;  1P13 A;  2B3O A;  1M27 A;  4F5B A;  2DLY A;  1BHH B;  1LCK A;  1GRI A;  3NHN A;  5GJH A;  1A07 A;  2HDV A;  2RMX A;  2IUG A;  1TCE A;  4U17 A; 
#chains in the Genus database with same CATH topology
 1D4T A;  1SPS A;  1JYR A;  2PNB A;  5EG3 B;  2GSB A;  5EHP A;  1A1A A;  1A08 A;  4A4B A;  2LQW A;  1O4F A;  4K44 A;  3IN7 A;  1O46 A;  2MQI A;  2H5K A;  3OB2 B;  1A81 A;  1O48 A;  2RSY A;  1HCT B;  1MIL A;  3OV1 A;  2EOB A;  1R1P A;  5KAZ A;  3MAZ A;  1UUR A;  4DGX A;  1O4B A;  1AB2 A;  1NZV A;  1O47 A;  1SPR A;  2EYY A;  1O4O A;  1AYC A;  2DM0 A;  2HMH A;  2LQN A;  3VS3 A;  2K7A B;  2MK2 A;  1G83 A;  3S8L A;  3IMJ A;  1X6C A;  1O44 A;  3EAC A;  3PLF B;  3CXL A;  2IZV A;  1BMB A;  1O4D A;  3BUM B;  1FYR A;  1BFJ A;  4ROJ A;  5EHR A;  4K45 A;  2LNX A;  3VS7 A;  2CI8 A;  3PSK A;  1A1C A;  1LUM A;  1JYQ A;  3UF4 A;  2EYZ A;  4F59 A;  4LUD A;  2EO6 A;  1OPL A;  4QSY A;  1A1B A;  2JYQ A;  2C0O A;  3T04 A;  3LYV A;  2AOA A;  3K2T A;  1CSZ A;  2MRJ A;  1RQQ C;  5EEQ A;  1GHU A;  1X0N A;  2Y1M A;  2FCI A;  2EU0 A;  1KC2 A;  1R1S A;  3N84 A;  2EO3 A;  4JGH A;  1PIC A;  1FMK A;  1XA6 A;  3VRP A;  5DF6 A;  1BLJ A;  2K79 B;  3VRN A;  2KGY A;  2MRK A;  4OHD A;  5HKY A;  3HCK A;  1AYD A;  2IUH A;  2PLE A;  3VRY A;  1CJ1 A;  1BHF A;  1KA6 A;  2ROR A;  5EEL A;  1O4N A;  5BO4 A;  3C7I A;  1CWD L;  2QMS A;  1SHA A;  3IN8 A;  1O4G A;  4P9Z A;  3OB1 B;  2HDX A;  3VRZ A;  1WQU A;  2AOB A;  1O4E A;  2KK6 A;  4JE4 A;  2L6K A;  4E68 A;  1A1E A;  2C0T A;  4E93 A;  1BKM A;  1JU5 A;  1KA7 A;  3WA4 A;  1O41 A;  1A09 A;  2SRC A;  3GQI B;  3BUW B;  2Y3A B;  1LKK A;  1O4K A;  2LNW A;  3VRR A;  1BLK A;  1F2F A;  4H34 A;  1OPK A;  5I6V A;  4D8K A;  4OHE A;  2H46 E;  5DC0 B;  3GXW A;  1O4R A;  3HIZ B;  1LUK A;  2CIA A;  2PTK A;  3MXY A;  1O4Q A;  2EKX A;  3VS5 A;  1AD5 A;  1SHB A;  2DVJ A;  4GL9 E;  1CSY A;  3OP0 A;  1SKJ A;  5AXI A;  3N8M A;  1QAD A;  2YSX A;  2OQ1 A;  4U1P A;  1LUI A;  4L1B B;  1TZE E;  2CRH A;  1BF5 A;  3VS4 A;  4FL2 A;  2ETZ A;  1Y1U A;  2XP1 A;  1JWO A;  2OZO A;  1O42 A;  2VIF A;  3BUX B;  3VS2 A;  2LCT A;  2CBL A;  4NWG A;  3EAZ A;  1JYU A;  1D1Z A;  1FU5 A;  2CI9 A;  1O43 A;  1R1Q A;  3HHM B;  3S8N A;  1M61 A;  5IBS A;  2YU7 A;  2L4K A;  3M7F A;  4XZ1 A;  1O49 A;  2LRA A;  3K2M A;  2RVF A;  1B47 A;  1FHS A;  2ABL A;  3S9K A;  1FBZ A;  4JEG A;  1O4C A;  2PLD A;  1AYB A;  4WWQ A;  4X6S A;  2Y1N A;  4GPL B;  4OHL A;  1O4I A;  3OVE A;  1Y57 A;  5DC4 A;  4A4C A;  4F5A A;  4K11 A;  3UYO A;  5CDW A;  3VS0 A;  3MXC A;  1BKL A;  2PNA A;  3PJP A;  2EL8 A;  1O4P A;  3CWG A;  1H9O A;  1SHD A;  1BG1 A;  3US4 A;  1RJA A;  2BBU A;  2H8H A;  3PS5 A;  3VRO A;  2L3T A;  3QWX X;  1O4H A;  2CR4 A;  2C9W A;  4P9V A;  1BHH A;  3CD3 A;  3TL0 A;  5DC9 A;  1LKL A;  5D0J A;  2AUG A;  1LCJ A;  1BFI A;  5AUL A;  4OHH A;  1YVH A;  1F1W A;  3PSJ A;  4FBN A;  4XZ0 A;  1YVL A;  3TKZ A;  4OHI A;  3VS6 A;  5GJI A;  3VS1 A;  3VRQ A;  4DGP A;  3CBL A;  4GWF A;  1O4J A;  1O4A A;  1I3Z A;  1HCS B;  1O4M A;  1AYA A;  1X27 A;  2DX0 A;  1OO4 A;  2HCK A;  1BM2 A;  1LUN A;  2IUI A;  4LUE A;  1K9A A;  4NWF A;  1RPY A;  2SHP A;  1D4W A;  3PQZ A;  3ZNI A;  3IMD A;  3BKB A;  3KFJ A;  3N7Y A;  1IJR A;  3VGO A;  4EY0 A;  2CS0 A;  1KSW A;  1UUS A;  1AOT F;  1NRV A;  1FBV A;  5IBM A;  3GXX A;  4H1O A;  4TZI A;  3S8O A;  1O4L A;  3QWY A;  1Z3K A;  1MW4 A;  1FU6 A;  1QG1 E;  4FL3 A;  1O45 A;  3BUO B;  4M4Z A;  2KNO A;  2MC1 A;  1OO3 A;  2HUW A;  2FO0 A;  2DCR A;  1CWE A;  2EYV A;  4K2R A;  5HKW A;  2DLZ A;  1NZL A;  1AOU F;  2ECD A;  3BUN B;  5J3X A;  1ZFP E;  2C0I A;  3PFV A;  1QCF A;  4EIH A;  5HKZ A;  2GE9 A;  1IS0 A;  1P13 A;  2B3O A;  1M27 A;  4F5B A;  2DLY A;  1BHH B;  1LCK A;  1GRI A;  3NHN A;  5GJH A;  1A07 A;  2HDV A;  2RMX A;  2IUG A;  1TCE A;  4U17 A; 
#chains in the Genus database with same CATH homology
 1D4T A;  1SPS A;  1JYR A;  2PNB A;  5EG3 B;  2GSB A;  5EHP A;  1A1A A;  1A08 A;  4A4B A;  2LQW A;  1O4F A;  4K44 A;  3IN7 A;  1O46 A;  2MQI A;  2H5K A;  3OB2 B;  1A81 A;  1O48 A;  2RSY A;  1HCT B;  1MIL A;  3OV1 A;  2EOB A;  1R1P A;  5KAZ A;  3MAZ A;  1UUR A;  4DGX A;  1O4B A;  1AB2 A;  1NZV A;  1O47 A;  1SPR A;  2EYY A;  1O4O A;  1AYC A;  2DM0 A;  2HMH A;  2LQN A;  3VS3 A;  2K7A B;  2MK2 A;  1G83 A;  3S8L A;  3IMJ A;  1X6C A;  1O44 A;  3EAC A;  3PLF B;  3CXL A;  2IZV A;  1BMB A;  1O4D A;  3BUM B;  1FYR A;  1BFJ A;  4ROJ A;  5EHR A;  4K45 A;  2LNX A;  3VS7 A;  2CI8 A;  3PSK A;  1A1C A;  1LUM A;  1JYQ A;  3UF4 A;  2EYZ A;  4F59 A;  4LUD A;  2EO6 A;  1OPL A;  4QSY A;  1A1B A;  2JYQ A;  2C0O A;  3T04 A;  2AOA A;  1CSZ A;  2MRJ A;  1RQQ C;  5EEQ A;  1GHU A;  1X0N A;  2Y1M A;  2FCI A;  2EU0 A;  1KC2 A;  1R1S A;  3N84 A;  2EO3 A;  4JGH A;  1PIC A;  1FMK A;  1XA6 A;  3VRP A;  5DF6 A;  1BLJ A;  2K79 B;  3VRN A;  2MRK A;  4OHD A;  5HKY A;  3HCK A;  1AYD A;  2IUH A;  2PLE A;  3VRY A;  1CJ1 A;  1BHF A;  1KA6 A;  2ROR A;  5EEL A;  1O4N A;  5BO4 A;  3C7I A;  1CWD L;  2QMS A;  1SHA A;  3IN8 A;  1O4G A;  4P9Z A;  3OB1 B;  2HDX A;  3VRZ A;  1WQU A;  2AOB A;  1O4E A;  2KK6 A;  4JE4 A;  2L6K A;  4E68 A;  1A1E A;  2C0T A;  4E93 A;  1BKM A;  1JU5 A;  1KA7 A;  3WA4 A;  1O41 A;  1A09 A;  2SRC A;  3GQI B;  3BUW B;  2Y3A B;  1LKK A;  1O4K A;  2LNW A;  3VRR A;  1BLK A;  1F2F A;  4H34 A;  1OPK A;  5I6V A;  4D8K A;  4OHE A;  2H46 E;  5DC0 B;  3GXW A;  1O4R A;  3HIZ B;  1LUK A;  2CIA A;  2PTK A;  3MXY A;  1O4Q A;  2EKX A;  3VS5 A;  1AD5 A;  1SHB A;  2DVJ A;  4GL9 E;  1CSY A;  3OP0 A;  1SKJ A;  5AXI A;  3N8M A;  1QAD A;  2YSX A;  2OQ1 A;  4U1P A;  1LUI A;  4L1B B;  1TZE E;  2CRH A;  1BF5 A;  3VS4 A;  4FL2 A;  2ETZ A;  1Y1U A;  2XP1 A;  1JWO A;  2OZO A;  1O42 A;  2VIF A;  3BUX B;  3VS2 A;  2LCT A;  2CBL A;  4NWG A;  3EAZ A;  1JYU A;  1D1Z A;  1FU5 A;  2CI9 A;  1O43 A;  1R1Q A;  3HHM B;  3S8N A;  1M61 A;  5IBS A;  2YU7 A;  2L4K A;  3M7F A;  4XZ1 A;  1O49 A;  3K2M A;  2RVF A;  1B47 A;  1FHS A;  2ABL A;  3S9K A;  1FBZ A;  4JEG A;  1O4C A;  2PLD A;  1AYB A;  4WWQ A;  4X6S A;  2Y1N A;  4GPL B;  4OHL A;  1O4I A;  3OVE A;  1Y57 A;  5DC4 A;  4A4C A;  4F5A A;  4K11 A;  3UYO A;  5CDW A;  3VS0 A;  3MXC A;  1BKL A;  2PNA A;  3PJP A;  2EL8 A;  1O4P A;  3CWG A;  1H9O A;  1SHD A;  1BG1 A;  3US4 A;  1RJA A;  2BBU A;  2H8H A;  3PS5 A;  3VRO A;  2L3T A;  3QWX X;  1O4H A;  2CR4 A;  2C9W A;  4P9V A;  1BHH A;  3CD3 A;  3TL0 A;  5DC9 A;  1LKL A;  5D0J A;  2AUG A;  1LCJ A;  1BFI A;  5AUL A;  4OHH A;  1YVH A;  1F1W A;  3PSJ A;  4FBN A;  4XZ0 A;  1YVL A;  3TKZ A;  4OHI A;  3VS6 A;  5GJI A;  3VS1 A;  3VRQ A;  4DGP A;  3CBL A;  4GWF A;  1O4J A;  1O4A A;  1I3Z A;  1HCS B;  1O4M A;  1AYA A;  1X27 A;  2DX0 A;  1OO4 A;  2HCK A;  1BM2 A;  1LUN A;  2IUI A;  4LUE A;  1K9A A;  4NWF A;  1RPY A;  2SHP A;  1D4W A;  3PQZ A;  3ZNI A;  3IMD A;  3BKB A;  3KFJ A;  3N7Y A;  1IJR A;  3VGO A;  4EY0 A;  2CS0 A;  1KSW A;  1UUS A;  1AOT F;  1NRV A;  1FBV A;  5IBM A;  3GXX A;  4H1O A;  4TZI A;  3S8O A;  1O4L A;  3QWY A;  1Z3K A;  1MW4 A;  1FU6 A;  1QG1 E;  4FL3 A;  1O45 A;  3BUO B;  4M4Z A;  2KNO A;  2MC1 A;  1OO3 A;  2HUW A;  2FO0 A;  2DCR A;  1CWE A;  2EYV A;  4K2R A;  5HKW A;  2DLZ A;  1NZL A;  1AOU F;  2ECD A;  3BUN B;  5J3X A;  1ZFP E;  2C0I A;  3PFV A;  1QCF A;  4EIH A;  5HKZ A;  2GE9 A;  1IS0 A;  1P13 A;  2B3O A;  1M27 A;  4F5B A;  2DLY A;  1BHH B;  1LCK A;  1GRI A;  3NHN A;  5GJH A;  1A07 A;  2HDV A;  2RMX A;  2IUG A;  1TCE A;  4U17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...