2XP1A

Structure of the tandem sh2 domains from antonospora locustae transcription elongation factor spt6
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
175
structure length
175
Chain Sequence
b'SHMKYTNPRFYKHPLFKNFNVTESENYLRSSTDDFLIRKGSRHGYCVLVIKFASDVFVHMKIEEHSEHYTCSNKHFEDIDEVISVYVRPILRNLKSIKAHAKYFNSPEDAEKLLSSFDGSKVVYAFYFSRKYPGKLTFAYNNGSILEEYIGVSDMLTYNNSTFKDIDSFVAYRKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SPT6
publication title Noncanonical Tandem Sh2 Enables Interaction of Elongation Factor Spt6 with RNA Polymerase II.
pubmed doi rcsb
source organism Antonospora locustae
molecule tags Transcription
total genus 45
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2010-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14633 SH2_2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2xp1A01
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2xp1A02
1LKLA 2GSBA 3MAZA 1NZLA 1A1EA 1A1CA 2LNXA 1CSYA 2C0OA 2HDXA 2OQ1A 5EELA 4LUEA 2SRCA 1O4QA 1MILA 3QWXX 3VRNA 4K44A 2MRKA 5EHRA 2MK2A 1FU5A 2MC1A 4P9VA 1AOUF 1KA7A 4H34A 1LKKA 2L3TA 3HCKA 2MRJA 3IMJA 1LCKA 1Y57A 2PTKA 1OPKA 1ZFPE 4D8KA 2Y3AB 1O4AA 5DC0B 3HIZB 3PJPA 3OB1B 5CDWA 3BUOB 1BHHA 3N7YA 3MXYA 2H46E 1FBVA 2DVJA 1MW4A 1RJAA 3US4A 3BUMB 3VRZA 1BM2A 1PICA 2Y1MA 4NWFA 3VS2A 3VS1A 2DLZA 1O46A 1JWOA 2LQWA 1O4NA 3S9KA 3M7FA 3VRPA 1SKJA 3IN7A 4OHDA 1RPYA 1I3ZA 2IUGA 1KC2A 1A81A 1O4GA 1X0NA 5IBMA 2IUHA 1O4LA 2DX0A 4M4ZA 2CRHA 4K45A 2YSXA 5EHPA 1AB2A 1A1BA 1CWDL 2LNWA 3VRYA 2K7AB 1SHDA 3N84A 1NZVA 3S8NA 1A08A 4EIHA 1JYQA 3VS0A 3OP0A 1O4EA 1O4DA 1UUSA 5GJIA 2CBLA 5EEQA 4P9ZA 4K2RA 3KFJA 1P13A 1F1WA 1F2FA 1KSWA 2PLEA 1FBZA 1O49A 4FL2A 1O48A 5AULA 3PLFB 2EYZA 4OHEA 4F59A 1BFJA 2LQNA 3GXXA 4XZ1A 5BO4A 3VS4A 4A4CA 1X27A 3MXCA 5DF6A 2DM0A 3ZNIA 3VGOA 1AOTF 2YU7A 1JYUA 3QWYA 5D0JA 1B47A 1FMKA 2H8HA 3HHMB 2CI9A 2L6KA 4OHLA 1R1PA 4DGPA 2EOBA 2KK6A 3VS5A 5AXIA 3S8OA 2CR4A 3PSKA 3VROA 1CSZA 4TZIA 1BHHB 1O43A 4FL3A 4E93A 2EU0A 2C9WA 1YVHA 1HCTB 4A4BA 1AD5A 1O45A 3TKZA 1GHUA 1JYRA 1OO4A 2MQIA 1LCJA 2SHPA 1SPSA 1AYAA 3VRQA 3PQZA 4GWFA 4U1PA 3VS6A 2EYVA 2FCIA 3BUXB 1CJ1A 1O4CA 1WQUA 1O4RA 2EO6A 3T04A 3TL0A 1BF5A 3CWGA 2Y1NA 1BHFA 2HMHA 5IBSA 1CWEA 2RMXA 1XA6A 1KA6A 5HKZA 2K79B 3PSJA 1O4OA 2ABLA 1K9AA 3EACA 3VS7A 1M27A 1SHAA 3UF4A 2EO3A 4OHIA 1BLKA 5J3XA 5DC4A 2QMSA 2AUGA 1FHSA 2DLYA 4GPLB 4FBNA 4F5BA 1SHBA 3K2MA 4WWQA 1LUMA 3CD3A 2CI8A 4H1OA 4JEGA 2RORA 1IJRA 3BUWB 2IUIA 4DGXA 4ROJA 2C0TA 5HKYA 1BFIA 5I6VA 3OB2B 2C0IA 3VRRA 3WA4A 2IZVA 1A1AA 1O4PA 1G83A 1QCFA 2ECDA 2VIFA 1A07A 1BG1A 5DC9A 1BKLA 2FO0A 2PLDA 5KAZA 1AYDA 1D4TA 3OV1A 1AYCA 2AOAA 3BKBA 3IN8A 1HCSB 3BUNB 3CXLA 2JYQA 1M61A 3VS3A 3S8LA 3CBLA 4K11A 2KNOA 4E68A 1LUKA 3NHNA 1O47A 4QSYA 1NRVA 2HDVA 4XZ0A 2EL8A 1O4JA 1O42A 3PFVA 1UURA 3UYOA 2EKXA 2H5KA 2CIAA 2AOBA 4U17A 1SPRA 1X6CA 4L1BB 1AYBA 3OVEA 3C7IA 2B3OA 2HUWA 2GE9A 1QG1E 1Y1UA 4X6SA 2DCRA 2HCKA 4NWGA 1BKMA 1TZEE 2LCTA 3EAZA 4GL9E 1YVLA 1TCEA 1O4KA 4EY0A 2CS0A 5HKWA 3IMDA 1O44A 1FYRA 1O4IA 2BBUA 3GXWA 4OHHA 2XP1A 1BLJA 1Z3KA 3N8MA 4JGHA 1R1SA 2L4KA 2OZOA 4LUDA 1FU6A 1LUNA 1BMBA 1R1QA 1OO3A 2EYYA 1GRIA 1O4FA 3GQIB 1OPLA 1IS0A 1A09A 4JE4A 1O4BA 1O41A 1O4HA 5GJHA 1D4WA 1LUIA 1O4MA 5EG3B 4F5AA 1QADA 2PNAA 2RVFA 1H9OA 1D1ZA 1JU5A 1RQQC 2ETZA 2PNBA 2RSYA 3PS5A
chains in the Genus database with same CATH superfamily
1LKLA 2GSBA 3MAZA 1NZLA 1A1EA 1A1CA 2LNXA 1CSYA 2C0OA 2HDXA 2OQ1A 5EELA 4LUEA 2SRCA 1O4QA 1MILA 3QWXX 3VRNA 4K44A 2MRKA 5EHRA 2MK2A 1FU5A 2MC1A 4P9VA 1AOUF 1KA7A 4H34A 1LKKA 2L3TA 3HCKA 2MRJA 3IMJA 1LCKA 1Y57A 2PTKA 1OPKA 1ZFPE 4D8KA 2Y3AB 1O4AA 5DC0B 3HIZB 3PJPA 3OB1B 5CDWA 3BUOB 1BHHA 3N7YA 3MXYA 2H46E 1FBVA 2DVJA 1MW4A 1RJAA 3US4A 3BUMB 3VRZA 1BM2A 1PICA 2Y1MA 4NWFA 3VS2A 3VS1A 2DLZA 1O46A 1JWOA 2LQWA 3K2TA 1O4NA 3S9KA 3M7FA 3VRPA 1SKJA 3IN7A 4OHDA 1RPYA 1I3ZA 2IUGA 1KC2A 1A81A 1O4GA 1X0NA 5IBMA 2IUHA 1O4LA 2DX0A 4M4ZA 2CRHA 4K45A 2YSXA 5EHPA 1AB2A 1A1BA 1CWDL 2LNWA 3VRYA 2K7AB 1SHDA 3N84A 1NZVA 3S8NA 1A08A 4EIHA 1JYQA 3VS0A 3OP0A 1O4EA 1O4DA 1UUSA 5GJIA 2CBLA 5EEQA 4P9ZA 4K2RA 3KFJA 1P13A 1F1WA 1F2FA 1KSWA 2PLEA 1FBZA 1O49A 4FL2A 1O48A 5AULA 3PLFB 2EYZA 4OHEA 4F59A 1BFJA 2LQNA 3GXXA 4XZ1A 5BO4A 3VS4A 4A4CA 1X27A 3MXCA 5DF6A 2DM0A 3ZNIA 3VGOA 1AOTF 2YU7A 1JYUA 3QWYA 5D0JA 1B47A 1FMKA 2H8HA 3HHMB 2CI9A 2L6KA 4OHLA 1R1PA 4DGPA 2EOBA 2KK6A 3VS5A 5AXIA 3S8OA 2CR4A 3PSKA 3VROA 1CSZA 4TZIA 1BHHB 1O43A 4FL3A 4E93A 2EU0A 2LRAA 2C9WA 1YVHA 2KGYA 1HCTB 4A4BA 1AD5A 1O45A 3TKZA 1GHUA 1JYRA 1OO4A 2MQIA 1LCJA 2SHPA 1SPSA 1AYAA 3VRQA 3PQZA 4GWFA 4U1PA 3VS6A 2EYVA 2FCIA 3BUXB 3LYVA 1CJ1A 1O4CA 1WQUA 1O4RA 2EO6A 3T04A 3TL0A 1BF5A 3CWGA 2Y1NA 1BHFA 2HMHA 5IBSA 1CWEA 2RMXA 1XA6A 1KA6A 5HKZA 2K79B 3PSJA 1O4OA 2ABLA 1K9AA 3EACA 3VS7A 1M27A 1SHAA 3UF4A 2EO3A 4OHIA 1BLKA 5J3XA 5DC4A 2QMSA 2AUGA 1FHSA 2DLYA 4GPLB 4FBNA 4F5BA 1SHBA 3K2MA 4WWQA 1LUMA 3CD3A 2CI8A 4H1OA 4JEGA 2RORA 1IJRA 3BUWB 2IUIA 4DGXA 4ROJA 2C0TA 5HKYA 1BFIA 5I6VA 3OB2B 2C0IA 3VRRA 3WA4A 2IZVA 1A1AA 1O4PA 1G83A 1QCFA 2ECDA 2VIFA 1A07A 1BG1A 5DC9A 1BKLA 2FO0A 2PLDA 5KAZA 1AYDA 1D4TA 3OV1A 1AYCA 2AOAA 3BKBA 3IN8A 1HCSB 3BUNB 3CXLA 2JYQA 1M61A 3VS3A 3S8LA 3CBLA 4K11A 2KNOA 4E68A 1LUKA 3NHNA 1O47A 4QSYA 1NRVA 2HDVA 4XZ0A 2EL8A 1O4JA 1O42A 3PFVA 1UURA 3UYOA 2EKXA 2H5KA 2CIAA 2AOBA 4U17A 1SPRA 1X6CA 4L1BB 1AYBA 3OVEA 3C7IA 2B3OA 2HUWA 2GE9A 1QG1E 1Y1UA 4X6SA 2DCRA 2HCKA 4NWGA 1BKMA 1TZEE 2LCTA 3EAZA 4GL9E 1YVLA 1TCEA 1O4KA 4EY0A 2CS0A 5HKWA 3IMDA 1O44A 1FYRA 1O4IA 2BBUA 3GXWA 4OHHA 2XP1A 1BLJA 1Z3KA 3N8MA 4JGHA 1R1SA 2L4KA 2OZOA 4LUDA 1FU6A 1LUNA 1BMBA 1R1QA 1OO3A 2EYYA 1GRIA 1O4FA 3GQIB 1OPLA 1IS0A 1A09A 4JE4A 1O4BA 1O41A 1O4HA 5GJHA 1D4WA 1LUIA 1O4MA 5EG3B 4F5AA 1QADA 2PNAA 2RVFA 1H9OA 1D1ZA 1JU5A 1RQQC 2ETZA 2PNBA 2RSYA 3PS5A
chains in the Genus database with same CATH topology
1LKLA 2GSBA 3MAZA 1NZLA 1A1EA 1A1CA 2LNXA 1CSYA 2C0OA 2HDXA 2OQ1A 5EELA 4LUEA 2SRCA 1O4QA 1MILA 3QWXX 3VRNA 4K44A 2MRKA 5EHRA 2MK2A 1FU5A 2MC1A 4P9VA 1AOUF 1KA7A 4H34A 1LKKA 2L3TA 3HCKA 2MRJA 3IMJA 1LCKA 1Y57A 2PTKA 1OPKA 1ZFPE 4D8KA 2Y3AB 1O4AA 5DC0B 3HIZB 3PJPA 3OB1B 5CDWA 3BUOB 1BHHA 3N7YA 3MXYA 2H46E 1FBVA 2DVJA 1MW4A 1RJAA 3US4A 3BUMB 3VRZA 1BM2A 1PICA 2Y1MA 4NWFA 3VS2A 3VS1A 2DLZA 1O46A 1JWOA 2LQWA 1O4NA 3S9KA 3M7FA 3VRPA 1SKJA 3IN7A 4OHDA 1RPYA 1I3ZA 2IUGA 1KC2A 1A81A 1O4GA 1X0NA 5IBMA 2IUHA 1O4LA 2DX0A 4M4ZA 2CRHA 4K45A 2YSXA 5EHPA 1AB2A 1A1BA 1CWDL 2LNWA 3VRYA 2K7AB 1SHDA 3N84A 1NZVA 3S8NA 1A08A 4EIHA 1JYQA 3VS0A 3OP0A 1O4EA 1O4DA 1UUSA 5GJIA 2CBLA 5EEQA 4P9ZA 4K2RA 3KFJA 1P13A 1F1WA 1F2FA 1KSWA 2PLEA 1FBZA 1O49A 4FL2A 1O48A 5AULA 3PLFB 2EYZA 4OHEA 4F59A 1BFJA 2LQNA 3GXXA 4XZ1A 5BO4A 3VS4A 4A4CA 1X27A 3MXCA 5DF6A 2DM0A 3ZNIA 3VGOA 1AOTF 2YU7A 1JYUA 3QWYA 5D0JA 1B47A 1FMKA 2H8HA 3HHMB 2CI9A 2L6KA 4OHLA 1R1PA 4DGPA 2EOBA 2KK6A 3VS5A 5AXIA 3S8OA 2CR4A 3PSKA 3VROA 1CSZA 4TZIA 1BHHB 1O43A 4FL3A 4E93A 2EU0A 2C9WA 1YVHA 1HCTB 4A4BA 1AD5A 1O45A 3TKZA 1GHUA 1JYRA 1OO4A 2MQIA 1LCJA 2SHPA 1SPSA 1AYAA 3VRQA 3PQZA 4GWFA 4U1PA 3VS6A 2EYVA 2FCIA 3BUXB 1CJ1A 1O4CA 1WQUA 1O4RA 2EO6A 3T04A 3TL0A 1BF5A 3CWGA 2Y1NA 1BHFA 2HMHA 5IBSA 1CWEA 2RMXA 1XA6A 1KA6A 5HKZA 2K79B 3PSJA 1O4OA 2ABLA 1K9AA 3EACA 3VS7A 1M27A 1SHAA 3UF4A 2EO3A 4OHIA 1BLKA 5J3XA 5DC4A 2QMSA 2AUGA 1FHSA 2DLYA 4GPLB 4FBNA 4F5BA 1SHBA 3K2MA 4WWQA 1LUMA 3CD3A 2CI8A 4H1OA 4JEGA 2RORA 1IJRA 3BUWB 2IUIA 4DGXA 4ROJA 2C0TA 5HKYA 1BFIA 5I6VA 3OB2B 2C0IA 3VRRA 3WA4A 2IZVA 1A1AA 1O4PA 1G83A 1QCFA 2ECDA 2VIFA 1A07A 1BG1A 5DC9A 1BKLA 2FO0A 2PLDA 5KAZA 1AYDA 1D4TA 3OV1A 1AYCA 2AOAA 3BKBA 3IN8A 1HCSB 3BUNB 3CXLA 2JYQA 1M61A 3VS3A 3S8LA 3CBLA 4K11A 2KNOA 4E68A 1LUKA 3NHNA 1O47A 4QSYA 1NRVA 2HDVA 4XZ0A 2EL8A 1O4JA 1O42A 3PFVA 1UURA 3UYOA 2EKXA 2H5KA 2CIAA 2AOBA 4U17A 1SPRA 1X6CA 4L1BB 1AYBA 3OVEA 3C7IA 2B3OA 2HUWA 2GE9A 1QG1E 1Y1UA 4X6SA 2DCRA 2HCKA 4NWGA 1BKMA 1TZEE 2LCTA 3EAZA 4GL9E 1YVLA 1TCEA 1O4KA 4EY0A 2CS0A 5HKWA 3IMDA 1O44A 1FYRA 1O4IA 2BBUA 3GXWA 4OHHA 2XP1A 1BLJA 1Z3KA 3N8MA 4JGHA 1R1SA 2L4KA 2OZOA 4LUDA 1FU6A 1LUNA 1BMBA 1R1QA 1OO3A 2EYYA 1GRIA 1O4FA 3GQIB 1OPLA 1IS0A 1A09A 4JE4A 1O4BA 1O41A 1O4HA 5GJHA 1D4WA 1LUIA 1O4MA 5EG3B 4F5AA 1QADA 2PNAA 2RVFA 1H9OA 1D1ZA 1JU5A 1RQQC 2ETZA 2PNBA 2RSYA 3PS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LKL A;  2GSB A;  3MAZ A;  1NZL A;  1A1E A;  1A1C A;  2LNX A;  1CSY A;  2C0O A;  2HDX A;  2OQ1 A;  5EEL A;  4LUE A;  2SRC A;  1O4Q A;  1MIL A;  3QWX X;  3VRN A;  4K44 A;  2MRK A;  5EHR A;  2MK2 A;  1FU5 A;  2MC1 A;  4P9V A;  1AOU F;  1KA7 A;  4H34 A;  1LKK A;  2L3T A;  3HCK A;  2MRJ A;  3IMJ A;  1LCK A;  1Y57 A;  2PTK A;  1OPK A;  1ZFP E;  4D8K A;  2Y3A B;  1O4A A;  5DC0 B;  3HIZ B;  3PJP A;  3OB1 B;  5CDW A;  3BUO B;  1BHH A;  3N7Y A;  3MXY A;  2H46 E;  1FBV A;  2DVJ A;  1MW4 A;  1RJA A;  3US4 A;  3BUM B;  3VRZ A;  1BM2 A;  1PIC A;  2Y1M A;  4NWF A;  3VS2 A;  3VS1 A;  2DLZ A;  1O46 A;  1JWO A;  2LQW A;  1O4N A;  3S9K A;  3M7F A;  3VRP A;  1SKJ A;  3IN7 A;  4OHD A;  1RPY A;  1I3Z A;  2IUG A;  1KC2 A;  1A81 A;  1O4G A;  1X0N A;  5IBM A;  2IUH A;  1O4L A;  2DX0 A;  4M4Z A;  2CRH A;  4K45 A;  2YSX A;  5EHP A;  1AB2 A;  1A1B A;  1CWD L;  2LNW A;  3VRY A;  2K7A B;  1SHD A;  3N84 A;  1NZV A;  3S8N A;  1A08 A;  4EIH A;  1JYQ A;  3VS0 A;  3OP0 A;  1O4E A;  1O4D A;  1UUS A;  5GJI A;  2CBL A;  5EEQ A;  4P9Z A;  4K2R A;  3KFJ A;  1P13 A;  1F1W A;  1F2F A;  1KSW A;  2PLE A;  1FBZ A;  1O49 A;  4FL2 A;  1O48 A;  5AUL A;  3PLF B;  2EYZ A;  4OHE A;  4F59 A;  1BFJ A;  2LQN A;  3GXX A;  4XZ1 A;  5BO4 A;  3VS4 A;  4A4C A;  1X27 A;  3MXC A;  5DF6 A;  2DM0 A;  3ZNI A;  3VGO A;  1AOT F;  2YU7 A;  1JYU A;  3QWY A;  5D0J A;  1B47 A;  1FMK A;  2H8H A;  3HHM B;  2CI9 A;  2L6K A;  4OHL A;  1R1P A;  4DGP A;  2EOB A;  2KK6 A;  3VS5 A;  5AXI A;  3S8O A;  2CR4 A;  3PSK A;  3VRO A;  1CSZ A;  4TZI A;  1BHH B;  1O43 A;  4FL3 A;  4E93 A;  2EU0 A;  2C9W A;  1YVH A;  1HCT B;  4A4B A;  1AD5 A;  1O45 A;  3TKZ A;  1GHU A;  1JYR A;  1OO4 A;  2MQI A;  1LCJ A;  2SHP A;  1SPS A;  1AYA A;  3VRQ A;  3PQZ A;  4GWF A;  4U1P A;  3VS6 A;  2EYV A;  2FCI A;  3BUX B;  1CJ1 A;  1O4C A;  1WQU A;  1O4R A;  2EO6 A;  3T04 A;  3TL0 A;  1BF5 A;  3CWG A;  2Y1N A;  1BHF A;  2HMH A;  5IBS A;  1CWE A;  2RMX A;  1XA6 A;  1KA6 A;  5HKZ A;  2K79 B;  3PSJ A;  1O4O A;  2ABL A;  1K9A A;  3EAC A;  3VS7 A;  1M27 A;  1SHA A;  3UF4 A;  2EO3 A;  4OHI A;  1BLK A;  5J3X A;  5DC4 A;  2QMS A;  2AUG A;  1FHS A;  2DLY A;  4GPL B;  4FBN A;  4F5B A;  1SHB A;  3K2M A;  4WWQ A;  1LUM A;  3CD3 A;  2CI8 A;  4H1O A;  4JEG A;  2ROR A;  1IJR A;  3BUW B;  2IUI A;  4DGX A;  4ROJ A;  2C0T A;  5HKY A;  1BFI A;  5I6V A;  3OB2 B;  2C0I A;  3VRR A;  3WA4 A;  2IZV A;  1A1A A;  1O4P A;  1G83 A;  1QCF A;  2ECD A;  2VIF A;  1A07 A;  1BG1 A;  5DC9 A;  1BKL A;  2FO0 A;  2PLD A;  5KAZ A;  1AYD A;  1D4T A;  3OV1 A;  1AYC A;  2AOA A;  3BKB A;  3IN8 A;  1HCS B;  3BUN B;  3CXL A;  2JYQ A;  1M61 A;  3VS3 A;  3S8L A;  3CBL A;  4K11 A;  2KNO A;  4E68 A;  1LUK A;  3NHN A;  1O47 A;  4QSY A;  1NRV A;  2HDV A;  4XZ0 A;  2EL8 A;  1O4J A;  1O42 A;  3PFV A;  1UUR A;  3UYO A;  2EKX A;  2H5K A;  2CIA A;  2AOB A;  4U17 A;  1SPR A;  1X6C A;  4L1B B;  1AYB A;  3OVE A;  3C7I A;  2B3O A;  2HUW A;  2GE9 A;  1QG1 E;  1Y1U A;  4X6S A;  2DCR A;  2HCK A;  4NWG A;  1BKM A;  1TZE E;  2LCT A;  3EAZ A;  4GL9 E;  1YVL A;  1TCE A;  1O4K A;  4EY0 A;  2CS0 A;  5HKW A;  3IMD A;  1O44 A;  1FYR A;  1O4I A;  2BBU A;  3GXW A;  4OHH A;  2XP1 A;  1BLJ A;  1Z3K A;  3N8M A;  4JGH A;  1R1S A;  2L4K A;  2OZO A;  4LUD A;  1FU6 A;  1LUN A;  1BMB A;  1R1Q A;  1OO3 A;  2EYY A;  1GRI A;  1O4F A;  3GQI B;  1OPL A;  1IS0 A;  1A09 A;  4JE4 A;  1O4B A;  1O41 A;  1O4H A;  5GJH A;  1D4W A;  1LUI A;  1O4M A;  5EG3 B;  4F5A A;  1QAD A;  2PNA A;  2RVF A;  1H9O A;  1D1Z A;  1JU5 A;  1RQQ C;  2ETZ A;  2PNB A;  2RSY A;  3PS5 A; 
#chains in the Genus database with same CATH topology
 1LKL A;  2GSB A;  3MAZ A;  1NZL A;  1A1E A;  1A1C A;  2LNX A;  1CSY A;  2C0O A;  2HDX A;  2OQ1 A;  5EEL A;  4LUE A;  2SRC A;  1O4Q A;  1MIL A;  3QWX X;  3VRN A;  4K44 A;  2MRK A;  5EHR A;  2MK2 A;  1FU5 A;  2MC1 A;  4P9V A;  1AOU F;  1KA7 A;  4H34 A;  1LKK A;  2L3T A;  3HCK A;  2MRJ A;  3IMJ A;  1LCK A;  1Y57 A;  2PTK A;  1OPK A;  1ZFP E;  4D8K A;  2Y3A B;  1O4A A;  5DC0 B;  3HIZ B;  3PJP A;  3OB1 B;  5CDW A;  3BUO B;  1BHH A;  3N7Y A;  3MXY A;  2H46 E;  1FBV A;  2DVJ A;  1MW4 A;  1RJA A;  3US4 A;  3BUM B;  3VRZ A;  1BM2 A;  1PIC A;  2Y1M A;  4NWF A;  3VS2 A;  3VS1 A;  2DLZ A;  1O46 A;  1JWO A;  2LQW A;  3K2T A;  1O4N A;  3S9K A;  3M7F A;  3VRP A;  1SKJ A;  3IN7 A;  4OHD A;  1RPY A;  1I3Z A;  2IUG A;  1KC2 A;  1A81 A;  1O4G A;  1X0N A;  5IBM A;  2IUH A;  1O4L A;  2DX0 A;  4M4Z A;  2CRH A;  4K45 A;  2YSX A;  5EHP A;  1AB2 A;  1A1B A;  1CWD L;  2LNW A;  3VRY A;  2K7A B;  1SHD A;  3N84 A;  1NZV A;  3S8N A;  1A08 A;  4EIH A;  1JYQ A;  3VS0 A;  3OP0 A;  1O4E A;  1O4D A;  1UUS A;  5GJI A;  2CBL A;  5EEQ A;  4P9Z A;  4K2R A;  3KFJ A;  1P13 A;  1F1W A;  1F2F A;  1KSW A;  2PLE A;  1FBZ A;  1O49 A;  4FL2 A;  1O48 A;  5AUL A;  3PLF B;  2EYZ A;  4OHE A;  4F59 A;  1BFJ A;  2LQN A;  3GXX A;  4XZ1 A;  5BO4 A;  3VS4 A;  4A4C A;  1X27 A;  3MXC A;  5DF6 A;  2DM0 A;  3ZNI A;  3VGO A;  1AOT F;  2YU7 A;  1JYU A;  3QWY A;  5D0J A;  1B47 A;  1FMK A;  2H8H A;  3HHM B;  2CI9 A;  2L6K A;  4OHL A;  1R1P A;  4DGP A;  2EOB A;  2KK6 A;  3VS5 A;  5AXI A;  3S8O A;  2CR4 A;  3PSK A;  3VRO A;  1CSZ A;  4TZI A;  1BHH B;  1O43 A;  4FL3 A;  4E93 A;  2EU0 A;  2LRA A;  2C9W A;  1YVH A;  2KGY A;  1HCT B;  4A4B A;  1AD5 A;  1O45 A;  3TKZ A;  1GHU A;  1JYR A;  1OO4 A;  2MQI A;  1LCJ A;  2SHP A;  1SPS A;  1AYA A;  3VRQ A;  3PQZ A;  4GWF A;  4U1P A;  3VS6 A;  2EYV A;  2FCI A;  3BUX B;  3LYV A;  1CJ1 A;  1O4C A;  1WQU A;  1O4R A;  2EO6 A;  3T04 A;  3TL0 A;  1BF5 A;  3CWG A;  2Y1N A;  1BHF A;  2HMH A;  5IBS A;  1CWE A;  2RMX A;  1XA6 A;  1KA6 A;  5HKZ A;  2K79 B;  3PSJ A;  1O4O A;  2ABL A;  1K9A A;  3EAC A;  3VS7 A;  1M27 A;  1SHA A;  3UF4 A;  2EO3 A;  4OHI A;  1BLK A;  5J3X A;  5DC4 A;  2QMS A;  2AUG A;  1FHS A;  2DLY A;  4GPL B;  4FBN A;  4F5B A;  1SHB A;  3K2M A;  4WWQ A;  1LUM A;  3CD3 A;  2CI8 A;  4H1O A;  4JEG A;  2ROR A;  1IJR A;  3BUW B;  2IUI A;  4DGX A;  4ROJ A;  2C0T A;  5HKY A;  1BFI A;  5I6V A;  3OB2 B;  2C0I A;  3VRR A;  3WA4 A;  2IZV A;  1A1A A;  1O4P A;  1G83 A;  1QCF A;  2ECD A;  2VIF A;  1A07 A;  1BG1 A;  5DC9 A;  1BKL A;  2FO0 A;  2PLD A;  5KAZ A;  1AYD A;  1D4T A;  3OV1 A;  1AYC A;  2AOA A;  3BKB A;  3IN8 A;  1HCS B;  3BUN B;  3CXL A;  2JYQ A;  1M61 A;  3VS3 A;  3S8L A;  3CBL A;  4K11 A;  2KNO A;  4E68 A;  1LUK A;  3NHN A;  1O47 A;  4QSY A;  1NRV A;  2HDV A;  4XZ0 A;  2EL8 A;  1O4J A;  1O42 A;  3PFV A;  1UUR A;  3UYO A;  2EKX A;  2H5K A;  2CIA A;  2AOB A;  4U17 A;  1SPR A;  1X6C A;  4L1B B;  1AYB A;  3OVE A;  3C7I A;  2B3O A;  2HUW A;  2GE9 A;  1QG1 E;  1Y1U A;  4X6S A;  2DCR A;  2HCK A;  4NWG A;  1BKM A;  1TZE E;  2LCT A;  3EAZ A;  4GL9 E;  1YVL A;  1TCE A;  1O4K A;  4EY0 A;  2CS0 A;  5HKW A;  3IMD A;  1O44 A;  1FYR A;  1O4I A;  2BBU A;  3GXW A;  4OHH A;  2XP1 A;  1BLJ A;  1Z3K A;  3N8M A;  4JGH A;  1R1S A;  2L4K A;  2OZO A;  4LUD A;  1FU6 A;  1LUN A;  1BMB A;  1R1Q A;  1OO3 A;  2EYY A;  1GRI A;  1O4F A;  3GQI B;  1OPL A;  1IS0 A;  1A09 A;  4JE4 A;  1O4B A;  1O41 A;  1O4H A;  5GJH A;  1D4W A;  1LUI A;  1O4M A;  5EG3 B;  4F5A A;  1QAD A;  2PNA A;  2RVF A;  1H9O A;  1D1Z A;  1JU5 A;  1RQQ C;  2ETZ A;  2PNB A;  2RSY A;  3PS5 A; 
#chains in the Genus database with same CATH homology
 1LKL A;  2GSB A;  3MAZ A;  1NZL A;  1A1E A;  1A1C A;  2LNX A;  1CSY A;  2C0O A;  2HDX A;  2OQ1 A;  5EEL A;  4LUE A;  2SRC A;  1O4Q A;  1MIL A;  3QWX X;  3VRN A;  4K44 A;  2MRK A;  5EHR A;  2MK2 A;  1FU5 A;  2MC1 A;  4P9V A;  1AOU F;  1KA7 A;  4H34 A;  1LKK A;  2L3T A;  3HCK A;  2MRJ A;  3IMJ A;  1LCK A;  1Y57 A;  2PTK A;  1OPK A;  1ZFP E;  4D8K A;  2Y3A B;  1O4A A;  5DC0 B;  3HIZ B;  3PJP A;  3OB1 B;  5CDW A;  3BUO B;  1BHH A;  3N7Y A;  3MXY A;  2H46 E;  1FBV A;  2DVJ A;  1MW4 A;  1RJA A;  3US4 A;  3BUM B;  3VRZ A;  1BM2 A;  1PIC A;  2Y1M A;  4NWF A;  3VS2 A;  3VS1 A;  2DLZ A;  1O46 A;  1JWO A;  2LQW A;  1O4N A;  3S9K A;  3M7F A;  3VRP A;  1SKJ A;  3IN7 A;  4OHD A;  1RPY A;  1I3Z A;  2IUG A;  1KC2 A;  1A81 A;  1O4G A;  1X0N A;  5IBM A;  2IUH A;  1O4L A;  2DX0 A;  4M4Z A;  2CRH A;  4K45 A;  2YSX A;  5EHP A;  1AB2 A;  1A1B A;  1CWD L;  2LNW A;  3VRY A;  2K7A B;  1SHD A;  3N84 A;  1NZV A;  3S8N A;  1A08 A;  4EIH A;  1JYQ A;  3VS0 A;  3OP0 A;  1O4E A;  1O4D A;  1UUS A;  5GJI A;  2CBL A;  5EEQ A;  4P9Z A;  4K2R A;  3KFJ A;  1P13 A;  1F1W A;  1F2F A;  1KSW A;  2PLE A;  1FBZ A;  1O49 A;  4FL2 A;  1O48 A;  5AUL A;  3PLF B;  2EYZ A;  4OHE A;  4F59 A;  1BFJ A;  2LQN A;  3GXX A;  4XZ1 A;  5BO4 A;  3VS4 A;  4A4C A;  1X27 A;  3MXC A;  5DF6 A;  2DM0 A;  3ZNI A;  3VGO A;  1AOT F;  2YU7 A;  1JYU A;  3QWY A;  5D0J A;  1B47 A;  1FMK A;  2H8H A;  3HHM B;  2CI9 A;  2L6K A;  4OHL A;  1R1P A;  4DGP A;  2EOB A;  2KK6 A;  3VS5 A;  5AXI A;  3S8O A;  2CR4 A;  3PSK A;  3VRO A;  1CSZ A;  4TZI A;  1BHH B;  1O43 A;  4FL3 A;  4E93 A;  2EU0 A;  2C9W A;  1YVH A;  1HCT B;  4A4B A;  1AD5 A;  1O45 A;  3TKZ A;  1GHU A;  1JYR A;  1OO4 A;  2MQI A;  1LCJ A;  2SHP A;  1SPS A;  1AYA A;  3VRQ A;  3PQZ A;  4GWF A;  4U1P A;  3VS6 A;  2EYV A;  2FCI A;  3BUX B;  1CJ1 A;  1O4C A;  1WQU A;  1O4R A;  2EO6 A;  3T04 A;  3TL0 A;  1BF5 A;  3CWG A;  2Y1N A;  1BHF A;  2HMH A;  5IBS A;  1CWE A;  2RMX A;  1XA6 A;  1KA6 A;  5HKZ A;  2K79 B;  3PSJ A;  1O4O A;  2ABL A;  1K9A A;  3EAC A;  3VS7 A;  1M27 A;  1SHA A;  3UF4 A;  2EO3 A;  4OHI A;  1BLK A;  5J3X A;  5DC4 A;  2QMS A;  2AUG A;  1FHS A;  2DLY A;  4GPL B;  4FBN A;  4F5B A;  1SHB A;  3K2M A;  4WWQ A;  1LUM A;  3CD3 A;  2CI8 A;  4H1O A;  4JEG A;  2ROR A;  1IJR A;  3BUW B;  2IUI A;  4DGX A;  4ROJ A;  2C0T A;  5HKY A;  1BFI A;  5I6V A;  3OB2 B;  2C0I A;  3VRR A;  3WA4 A;  2IZV A;  1A1A A;  1O4P A;  1G83 A;  1QCF A;  2ECD A;  2VIF A;  1A07 A;  1BG1 A;  5DC9 A;  1BKL A;  2FO0 A;  2PLD A;  5KAZ A;  1AYD A;  1D4T A;  3OV1 A;  1AYC A;  2AOA A;  3BKB A;  3IN8 A;  1HCS B;  3BUN B;  3CXL A;  2JYQ A;  1M61 A;  3VS3 A;  3S8L A;  3CBL A;  4K11 A;  2KNO A;  4E68 A;  1LUK A;  3NHN A;  1O47 A;  4QSY A;  1NRV A;  2HDV A;  4XZ0 A;  2EL8 A;  1O4J A;  1O42 A;  3PFV A;  1UUR A;  3UYO A;  2EKX A;  2H5K A;  2CIA A;  2AOB A;  4U17 A;  1SPR A;  1X6C A;  4L1B B;  1AYB A;  3OVE A;  3C7I A;  2B3O A;  2HUW A;  2GE9 A;  1QG1 E;  1Y1U A;  4X6S A;  2DCR A;  2HCK A;  4NWG A;  1BKM A;  1TZE E;  2LCT A;  3EAZ A;  4GL9 E;  1YVL A;  1TCE A;  1O4K A;  4EY0 A;  2CS0 A;  5HKW A;  3IMD A;  1O44 A;  1FYR A;  1O4I A;  2BBU A;  3GXW A;  4OHH A;  2XP1 A;  1BLJ A;  1Z3K A;  3N8M A;  4JGH A;  1R1S A;  2L4K A;  2OZO A;  4LUD A;  1FU6 A;  1LUN A;  1BMB A;  1R1Q A;  1OO3 A;  2EYY A;  1GRI A;  1O4F A;  3GQI B;  1OPL A;  1IS0 A;  1A09 A;  4JE4 A;  1O4B A;  1O41 A;  1O4H A;  5GJH A;  1D4W A;  1LUI A;  1O4M A;  5EG3 B;  4F5A A;  1QAD A;  2PNA A;  2RVF A;  1H9O A;  1D1Z A;  1JU5 A;  1RQQ C;  2ETZ A;  2PNB A;  2RSY A;  3PS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...