1A1CA

C-src (sh2 domain) complexed with ace-phosphotyr-glu-(n-me(-(ch2)3-cyclopentyl))
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
b'SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C-SRC TYROSINE KINASE
publication title Peptide ligands of pp60(c-src) SH2 domains: a thermodynamic and structural study.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (transferase/peptide)
total genus 26
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1a1cA00
4GPLB 1O4EA 4F5AA 2MQIA 2RMXA 5DC0B 1UURA 1LCJA 1CWDL 2L3TA 2Y3AB 1BMBA 4OHDA 2EU0A 5CDWA 1SHAA 3PS5A 2HDXA 2IUGA 1B47A 3NHNA 2MC1A 4D8KA 3OV1A 1BF5A 3HIZB 1RPYA 5EEQA 1FHSA 3PLFB 3TKZA 3QWYA 2LCTA 3UF4A 5HKZA 2PLDA 1MW4A 4P9VA 3GXWA 2CI8A 4M4ZA 1JWOA 3BUOB 3CXLA 2H8HA 2K79B 2EO6A 2EYYA 4NWGA 3VRRA 3VS0A 2JYQA 4X6SA 4LUDA 5DC4A 2IUHA 3PFVA 3N7YA 1BKMA 1AB2A 3VRPA 2ECDA 2H5KA 2MK2A 1O4JA 4FL2A 1JYUA 3EAZA 4E68A 2CS0A 5KAZA 1H9OA 4K44A 3BUMB 3VS6A 1AYDA 3IMDA 5DC9A 1YVHA 1OO4A 1XA6A 4JEGA 3VROA 3VS3A 1Z3KA 3PQZA 4FBNA 1FBVA 3S8OA 1SPRA 1X27A 4F5BA 5EHRA 1LUKA 1QCFA 3VRZA 1FBZA 1O48A 2PLEA 3ZNIA 1O4GA 2DLZA 5D0JA 2EL8A 2MRKA 1IS0A 2DM0A 1M61A 1IJRA 1CSYA 3N8MA 5IBMA 4GL9E 1A81A 2C0OA 4A4CA 2L4KA 3MXYA 2VIFA 4K2RA 1FMKA 1O47A 1LUNA 1LKLA 1AYBA 2EO3A 1OO3A 1TZEE 1O4CA 4H34A 1O44A 1OPKA 3C7IA 1JYQA 2EYZA 3WA4A 4ROJA 1BHHA 3HCKA 1KSWA 2IZVA 5EHPA 5GJHA 1P13A 3KFJA 2RORA 4A4BA 1I3ZA 1R1PA 2HMHA 4XZ0A 1LUIA 2YU7A 4E93A 1O4IA 3CD3A 4LUEA 1PICA 1O4AA 2LNXA 2Y1MA 5AULA 1BHHB 2KNOA 4FL3A 1A1BA 1ZFPE 1G83A 2FCIA 3VRYA 4JGHA 1M27A 1Y1UA 1YVLA 1A07A 1OPLA 1KA7A 2PTKA 3UYOA 3MXCA 3CBLA 1O41A 2SHPA 1BHFA 2GE9A 3PSJA 1O49A 3T04A 2PNBA 3VS5A 3PJPA 4U1PA 5EELA 1RJAA 2CR4A 1O4MA 2EOBA 1AD5A 1JYRA 5EG3B 1FU5A 1NZLA 1CSZA 1CWEA 1QG1E 4K11A 1O4LA 2EYVA 3BUXB 1O42A 2DCRA 2OQ1A 2Y1NA 3K2MA 3OB1B 2H46E 1LUMA 5J3XA 2OZOA 2KK6A 4OHIA 3VGOA 1NZVA 4EIHA 1AOUF 4OHLA 1O4HA 4NWFA 2B3OA 1K9AA 1O45A 4H1OA 3VRQA 1X6CA 4DGXA 2AOAA 1AYCA 2LQNA 1JU5A 5DF6A 2ETZA 1O43A 3CWGA 3VRNA 1SPSA 4TZIA 1UUSA 1HCSB 3OP0A 1A1AA 1D1ZA 1A08A 3VS7A 1D4TA 3BKBA 1AOTF 1MILA 3HHMB 3S9KA 3MAZA 1Y57A 4DGPA 2K7AB 1O4RA 2QMSA 2DLYA 3OB2B 1LCKA 2ABLA 4EY0A 1O4QA 1BLKA 3N84A 1X0NA 1QADA 2DX0A 4WWQA 3VS2A 4JE4A 4K45A 2L6KA 1D4WA 5GJIA 2CI9A 3TL0A 4F59A 3OVEA 1BM2A 4U17A 1O4BA 2CRHA 5HKWA 1WQUA 4P9ZA 1SHDA 2XP1A 1HCTB 1KC2A 3BUWB 1GHUA 1BLJA 5BO4A 3IMJA 2LNWA 1O4PA 2RSYA 3GXXA 1F2FA 3VS1A 1FU6A 1A1EA 1R1QA 2C0TA 3PSKA 2LQWA 1RQQC 3BUNB 1NRVA 1O4DA 1FYRA 2DVJA 2C9WA 2HCKA 1O4FA 1O4NA 2EKXA 3GQIB 1A09A 2IUIA 1TCEA 1SHBA 2GSBA 5HKYA 2CIAA 5IBSA 1BFJA 3S8LA 1O46A 4QSYA 1BKLA 4XZ1A 3M7FA 1AYAA 3S8NA 4OHHA 1BG1A 2RVFA 1O4OA 5I6VA 4OHEA 3IN7A 1SKJA 2AUGA 3VS4A 2YSXA 2AOBA 2C0IA 1KA6A 3US4A 3QWXX 2PNAA 3IN8A 1R1SA 2HUWA 3EACA 2SRCA 5AXIA 1BFIA 1GRIA 2FO0A 1F1WA 4L1BB 2CBLA 1CJ1A 4GWFA 2MRJA 1LKKA 2HDVA 2BBUA 1A1CA 1O4KA
chains in the Genus database with same CATH superfamily
4GPLB 1O4EA 4F5AA 2MQIA 2RMXA 5DC0B 1UURA 1LCJA 1CWDL 2L3TA 2Y3AB 1BMBA 4OHDA 2EU0A 5CDWA 2LRAA 1SHAA 3PS5A 2HDXA 2IUGA 1B47A 3NHNA 2MC1A 4D8KA 3OV1A 1BF5A 3HIZB 1RPYA 5EEQA 1FHSA 3PLFB 3TKZA 3QWYA 2LCTA 3UF4A 5HKZA 2PLDA 1MW4A 4P9VA 3GXWA 2CI8A 4M4ZA 1JWOA 3BUOB 3CXLA 2H8HA 2K79B 2EO6A 2EYYA 4NWGA 3VRRA 3VS0A 2JYQA 4X6SA 4LUDA 5DC4A 2IUHA 3PFVA 3N7YA 1BKMA 1AB2A 3VRPA 2ECDA 2H5KA 2MK2A 1O4JA 4FL2A 1JYUA 3EAZA 4E68A 2CS0A 5KAZA 1H9OA 4K44A 3BUMB 3VS6A 1AYDA 3IMDA 5DC9A 1YVHA 1OO4A 1XA6A 4JEGA 3K2TA 3VROA 3VS3A 1Z3KA 3PQZA 4FBNA 1FBVA 3S8OA 1SPRA 1X27A 4F5BA 2KGYA 5EHRA 1LUKA 1QCFA 3VRZA 1FBZA 1O48A 2PLEA 3ZNIA 1O4GA 2DLZA 5D0JA 2EL8A 2MRKA 1IS0A 2DM0A 1M61A 1IJRA 1CSYA 3N8MA 5IBMA 4GL9E 1A81A 2C0OA 4A4CA 2L4KA 3MXYA 2VIFA 4K2RA 1FMKA 1O47A 1LUNA 1LKLA 1AYBA 2EO3A 1OO3A 1TZEE 1O4CA 4H34A 1O44A 1OPKA 3C7IA 1JYQA 2EYZA 3WA4A 4ROJA 1BHHA 3HCKA 1KSWA 2IZVA 5EHPA 5GJHA 1P13A 3KFJA 2RORA 4A4BA 1I3ZA 1R1PA 2HMHA 4XZ0A 1LUIA 2YU7A 4E93A 1O4IA 3CD3A 4LUEA 1PICA 1O4AA 2LNXA 2Y1MA 5AULA 1BHHB 2KNOA 4FL3A 1A1BA 1ZFPE 1G83A 2FCIA 3VRYA 4JGHA 1M27A 1Y1UA 1YVLA 1A07A 1OPLA 1KA7A 2PTKA 3UYOA 3MXCA 3CBLA 1O41A 2SHPA 1BHFA 2GE9A 3PSJA 1O49A 3T04A 2PNBA 3VS5A 3PJPA 4U1PA 5EELA 1RJAA 2CR4A 1O4MA 2EOBA 1AD5A 1JYRA 5EG3B 1FU5A 1NZLA 1CSZA 1CWEA 1QG1E 4K11A 1O4LA 2EYVA 3BUXB 1O42A 2DCRA 2OQ1A 2Y1NA 3K2MA 3OB1B 2H46E 1LUMA 5J3XA 2OZOA 2KK6A 4OHIA 3VGOA 1NZVA 4EIHA 1AOUF 4OHLA 1O4HA 4NWFA 2B3OA 1K9AA 1O45A 4H1OA 3VRQA 1X6CA 4DGXA 2AOAA 1AYCA 2LQNA 1JU5A 5DF6A 2ETZA 1O43A 3CWGA 3VRNA 1SPSA 4TZIA 1UUSA 1HCSB 3OP0A 1A1AA 1D1ZA 1A08A 3VS7A 1D4TA 3BKBA 1AOTF 1MILA 3HHMB 3S9KA 3MAZA 1Y57A 4DGPA 2K7AB 1O4RA 2QMSA 2DLYA 3OB2B 1LCKA 2ABLA 4EY0A 1O4QA 1BLKA 3N84A 1X0NA 1QADA 2DX0A 4WWQA 3VS2A 4JE4A 4K45A 2L6KA 1D4WA 5GJIA 2CI9A 3TL0A 4F59A 3OVEA 1BM2A 4U17A 1O4BA 2CRHA 5HKWA 1WQUA 4P9ZA 1SHDA 2XP1A 1HCTB 1KC2A 3BUWB 1GHUA 1BLJA 5BO4A 3IMJA 2LNWA 1O4PA 2RSYA 3GXXA 1F2FA 3VS1A 1FU6A 1A1EA 1R1QA 2C0TA 3PSKA 2LQWA 1RQQC 3BUNB 1NRVA 1O4DA 1FYRA 2DVJA 2C9WA 2HCKA 1O4FA 1O4NA 2EKXA 3GQIB 1A09A 2IUIA 1TCEA 1SHBA 2GSBA 5HKYA 2CIAA 5IBSA 1BFJA 3S8LA 1O46A 4QSYA 1BKLA 4XZ1A 3M7FA 1AYAA 3S8NA 4OHHA 1BG1A 2RVFA 1O4OA 5I6VA 4OHEA 3IN7A 1SKJA 2AUGA 3VS4A 3LYVA 2YSXA 2AOBA 2C0IA 1KA6A 3US4A 3QWXX 2PNAA 3IN8A 1R1SA 2HUWA 3EACA 2SRCA 5AXIA 1BFIA 1GRIA 2FO0A 1F1WA 4L1BB 2CBLA 1CJ1A 4GWFA 2MRJA 1LKKA 2HDVA 2BBUA 1A1CA 1O4KA
chains in the Genus database with same CATH topology
4GPLB 1O4EA 4F5AA 2MQIA 2RMXA 5DC0B 1UURA 1LCJA 1CWDL 2L3TA 2Y3AB 1BMBA 4OHDA 2EU0A 5CDWA 1SHAA 3PS5A 2HDXA 2IUGA 1B47A 3NHNA 2MC1A 4D8KA 3OV1A 1BF5A 3HIZB 1RPYA 5EEQA 1FHSA 3PLFB 3TKZA 3QWYA 2LCTA 3UF4A 5HKZA 2PLDA 1MW4A 4P9VA 3GXWA 2CI8A 4M4ZA 1JWOA 3BUOB 3CXLA 2H8HA 2K79B 2EO6A 2EYYA 4NWGA 3VRRA 3VS0A 2JYQA 4X6SA 4LUDA 5DC4A 2IUHA 3PFVA 3N7YA 1BKMA 1AB2A 3VRPA 2ECDA 2H5KA 2MK2A 1O4JA 4FL2A 1JYUA 3EAZA 4E68A 2CS0A 5KAZA 1H9OA 4K44A 3BUMB 3VS6A 1AYDA 3IMDA 5DC9A 1YVHA 1OO4A 1XA6A 4JEGA 3VROA 3VS3A 1Z3KA 3PQZA 4FBNA 1FBVA 3S8OA 1SPRA 1X27A 4F5BA 5EHRA 1LUKA 1QCFA 3VRZA 1FBZA 1O48A 2PLEA 3ZNIA 1O4GA 2DLZA 5D0JA 2EL8A 2MRKA 1IS0A 2DM0A 1M61A 1IJRA 1CSYA 3N8MA 5IBMA 4GL9E 1A81A 2C0OA 4A4CA 2L4KA 3MXYA 2VIFA 4K2RA 1FMKA 1O47A 1LUNA 1LKLA 1AYBA 2EO3A 1OO3A 1TZEE 1O4CA 4H34A 1O44A 1OPKA 3C7IA 1JYQA 2EYZA 3WA4A 4ROJA 1BHHA 3HCKA 1KSWA 2IZVA 5EHPA 5GJHA 1P13A 3KFJA 2RORA 4A4BA 1I3ZA 1R1PA 2HMHA 4XZ0A 1LUIA 2YU7A 4E93A 1O4IA 3CD3A 4LUEA 1PICA 1O4AA 2LNXA 2Y1MA 5AULA 1BHHB 2KNOA 4FL3A 1A1BA 1ZFPE 1G83A 2FCIA 3VRYA 4JGHA 1M27A 1Y1UA 1YVLA 1A07A 1OPLA 1KA7A 2PTKA 3UYOA 3MXCA 3CBLA 1O41A 2SHPA 1BHFA 2GE9A 3PSJA 1O49A 3T04A 2PNBA 3VS5A 3PJPA 4U1PA 5EELA 1RJAA 2CR4A 1O4MA 2EOBA 1AD5A 1JYRA 5EG3B 1FU5A 1NZLA 1CSZA 1CWEA 1QG1E 4K11A 1O4LA 2EYVA 3BUXB 1O42A 2DCRA 2OQ1A 2Y1NA 3K2MA 3OB1B 2H46E 1LUMA 5J3XA 2OZOA 2KK6A 4OHIA 3VGOA 1NZVA 4EIHA 1AOUF 4OHLA 1O4HA 4NWFA 2B3OA 1K9AA 1O45A 4H1OA 3VRQA 1X6CA 4DGXA 2AOAA 1AYCA 2LQNA 1JU5A 5DF6A 2ETZA 1O43A 3CWGA 3VRNA 1SPSA 4TZIA 1UUSA 1HCSB 3OP0A 1A1AA 1D1ZA 1A08A 3VS7A 1D4TA 3BKBA 1AOTF 1MILA 3HHMB 3S9KA 3MAZA 1Y57A 4DGPA 2K7AB 1O4RA 2QMSA 2DLYA 3OB2B 1LCKA 2ABLA 4EY0A 1O4QA 1BLKA 3N84A 1X0NA 1QADA 2DX0A 4WWQA 3VS2A 4JE4A 4K45A 2L6KA 1D4WA 5GJIA 2CI9A 3TL0A 4F59A 3OVEA 1BM2A 4U17A 1O4BA 2CRHA 5HKWA 1WQUA 4P9ZA 1SHDA 2XP1A 1HCTB 1KC2A 3BUWB 1GHUA 1BLJA 5BO4A 3IMJA 2LNWA 1O4PA 2RSYA 3GXXA 1F2FA 3VS1A 1FU6A 1A1EA 1R1QA 2C0TA 3PSKA 2LQWA 1RQQC 3BUNB 1NRVA 1O4DA 1FYRA 2DVJA 2C9WA 2HCKA 1O4FA 1O4NA 2EKXA 3GQIB 1A09A 2IUIA 1TCEA 1SHBA 2GSBA 5HKYA 2CIAA 5IBSA 1BFJA 3S8LA 1O46A 4QSYA 1BKLA 4XZ1A 3M7FA 1AYAA 3S8NA 4OHHA 1BG1A 2RVFA 1O4OA 5I6VA 4OHEA 3IN7A 1SKJA 2AUGA 3VS4A 2YSXA 2AOBA 2C0IA 1KA6A 3US4A 3QWXX 2PNAA 3IN8A 1R1SA 2HUWA 3EACA 2SRCA 5AXIA 1BFIA 1GRIA 2FO0A 1F1WA 4L1BB 2CBLA 1CJ1A 4GWFA 2MRJA 1LKKA 2HDVA 2BBUA 1A1CA 1O4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GPL B;  1O4E A;  4F5A A;  2MQI A;  2RMX A;  5DC0 B;  1UUR A;  1LCJ A;  1CWD L;  2L3T A;  2Y3A B;  1BMB A;  4OHD A;  2EU0 A;  5CDW A;  1SHA A;  3PS5 A;  2HDX A;  2IUG A;  1B47 A;  3NHN A;  2MC1 A;  4D8K A;  3OV1 A;  1BF5 A;  3HIZ B;  1RPY A;  5EEQ A;  1FHS A;  3PLF B;  3TKZ A;  3QWY A;  2LCT A;  3UF4 A;  5HKZ A;  2PLD A;  1MW4 A;  4P9V A;  3GXW A;  2CI8 A;  4M4Z A;  1JWO A;  3BUO B;  3CXL A;  2H8H A;  2K79 B;  2EO6 A;  2EYY A;  4NWG A;  3VRR A;  3VS0 A;  2JYQ A;  4X6S A;  4LUD A;  5DC4 A;  2IUH A;  3PFV A;  3N7Y A;  1BKM A;  1AB2 A;  3VRP A;  2ECD A;  2H5K A;  2MK2 A;  1O4J A;  4FL2 A;  1JYU A;  3EAZ A;  4E68 A;  2CS0 A;  5KAZ A;  1H9O A;  4K44 A;  3BUM B;  3VS6 A;  1AYD A;  3IMD A;  5DC9 A;  1YVH A;  1OO4 A;  1XA6 A;  4JEG A;  3VRO A;  3VS3 A;  1Z3K A;  3PQZ A;  4FBN A;  1FBV A;  3S8O A;  1SPR A;  1X27 A;  4F5B A;  5EHR A;  1LUK A;  1QCF A;  3VRZ A;  1FBZ A;  1O48 A;  2PLE A;  3ZNI A;  1O4G A;  2DLZ A;  5D0J A;  2EL8 A;  2MRK A;  1IS0 A;  2DM0 A;  1M61 A;  1IJR A;  1CSY A;  3N8M A;  5IBM A;  4GL9 E;  1A81 A;  2C0O A;  4A4C A;  2L4K A;  3MXY A;  2VIF A;  4K2R A;  1FMK A;  1O47 A;  1LUN A;  1LKL A;  1AYB A;  2EO3 A;  1OO3 A;  1TZE E;  1O4C A;  4H34 A;  1O44 A;  1OPK A;  3C7I A;  1JYQ A;  2EYZ A;  3WA4 A;  4ROJ A;  1BHH A;  3HCK A;  1KSW A;  2IZV A;  5EHP A;  5GJH A;  1P13 A;  3KFJ A;  2ROR A;  4A4B A;  1I3Z A;  1R1P A;  2HMH A;  4XZ0 A;  1LUI A;  2YU7 A;  4E93 A;  1O4I A;  3CD3 A;  4LUE A;  1PIC A;  1O4A A;  2LNX A;  2Y1M A;  5AUL A;  1BHH B;  2KNO A;  4FL3 A;  1A1B A;  1ZFP E;  1G83 A;  2FCI A;  3VRY A;  4JGH A;  1M27 A;  1Y1U A;  1YVL A;  1A07 A;  1OPL A;  1KA7 A;  2PTK A;  3UYO A;  3MXC A;  3CBL A;  1O41 A;  2SHP A;  1BHF A;  2GE9 A;  3PSJ A;  1O49 A;  3T04 A;  2PNB A;  3VS5 A;  3PJP A;  4U1P A;  5EEL A;  1RJA A;  2CR4 A;  1O4M A;  2EOB A;  1AD5 A;  1JYR A;  5EG3 B;  1FU5 A;  1NZL A;  1CSZ A;  1CWE A;  1QG1 E;  4K11 A;  1O4L A;  2EYV A;  3BUX B;  1O42 A;  2DCR A;  2OQ1 A;  2Y1N A;  3K2M A;  3OB1 B;  2H46 E;  1LUM A;  5J3X A;  2OZO A;  2KK6 A;  4OHI A;  3VGO A;  1NZV A;  4EIH A;  1AOU F;  4OHL A;  1O4H A;  4NWF A;  2B3O A;  1K9A A;  1O45 A;  4H1O A;  3VRQ A;  1X6C A;  4DGX A;  2AOA A;  1AYC A;  2LQN A;  1JU5 A;  5DF6 A;  2ETZ A;  1O43 A;  3CWG A;  3VRN A;  1SPS A;  4TZI A;  1UUS A;  1HCS B;  3OP0 A;  1A1A A;  1D1Z A;  1A08 A;  3VS7 A;  1D4T A;  3BKB A;  1AOT F;  1MIL A;  3HHM B;  3S9K A;  3MAZ A;  1Y57 A;  4DGP A;  2K7A B;  1O4R A;  2QMS A;  2DLY A;  3OB2 B;  1LCK A;  2ABL A;  4EY0 A;  1O4Q A;  1BLK A;  3N84 A;  1X0N A;  1QAD A;  2DX0 A;  4WWQ A;  3VS2 A;  4JE4 A;  4K45 A;  2L6K A;  1D4W A;  5GJI A;  2CI9 A;  3TL0 A;  4F59 A;  3OVE A;  1BM2 A;  4U17 A;  1O4B A;  2CRH A;  5HKW A;  1WQU A;  4P9Z A;  1SHD A;  2XP1 A;  1HCT B;  1KC2 A;  3BUW B;  1GHU A;  1BLJ A;  5BO4 A;  3IMJ A;  2LNW A;  1O4P A;  2RSY A;  3GXX A;  1F2F A;  3VS1 A;  1FU6 A;  1A1E A;  1R1Q A;  2C0T A;  3PSK A;  2LQW A;  1RQQ C;  3BUN B;  1NRV A;  1O4D A;  1FYR A;  2DVJ A;  2C9W A;  2HCK A;  1O4F A;  1O4N A;  2EKX A;  3GQI B;  1A09 A;  2IUI A;  1TCE A;  1SHB A;  2GSB A;  5HKY A;  2CIA A;  5IBS A;  1BFJ A;  3S8L A;  1O46 A;  4QSY A;  1BKL A;  4XZ1 A;  3M7F A;  1AYA A;  3S8N A;  4OHH A;  1BG1 A;  2RVF A;  1O4O A;  5I6V A;  4OHE A;  3IN7 A;  1SKJ A;  2AUG A;  3VS4 A;  2YSX A;  2AOB A;  2C0I A;  1KA6 A;  3US4 A;  3QWX X;  2PNA A;  3IN8 A;  1R1S A;  2HUW A;  3EAC A;  2SRC A;  5AXI A;  1BFI A;  1GRI A;  2FO0 A;  1F1W A;  4L1B B;  2CBL A;  1CJ1 A;  4GWF A;  2MRJ A;  1LKK A;  2HDV A;  2BBU A;  1A1C A;  1O4K A; 
#chains in the Genus database with same CATH topology
 4GPL B;  1O4E A;  4F5A A;  2MQI A;  2RMX A;  5DC0 B;  1UUR A;  1LCJ A;  1CWD L;  2L3T A;  2Y3A B;  1BMB A;  4OHD A;  2EU0 A;  5CDW A;  2LRA A;  1SHA A;  3PS5 A;  2HDX A;  2IUG A;  1B47 A;  3NHN A;  2MC1 A;  4D8K A;  3OV1 A;  1BF5 A;  3HIZ B;  1RPY A;  5EEQ A;  1FHS A;  3PLF B;  3TKZ A;  3QWY A;  2LCT A;  3UF4 A;  5HKZ A;  2PLD A;  1MW4 A;  4P9V A;  3GXW A;  2CI8 A;  4M4Z A;  1JWO A;  3BUO B;  3CXL A;  2H8H A;  2K79 B;  2EO6 A;  2EYY A;  4NWG A;  3VRR A;  3VS0 A;  2JYQ A;  4X6S A;  4LUD A;  5DC4 A;  2IUH A;  3PFV A;  3N7Y A;  1BKM A;  1AB2 A;  3VRP A;  2ECD A;  2H5K A;  2MK2 A;  1O4J A;  4FL2 A;  1JYU A;  3EAZ A;  4E68 A;  2CS0 A;  5KAZ A;  1H9O A;  4K44 A;  3BUM B;  3VS6 A;  1AYD A;  3IMD A;  5DC9 A;  1YVH A;  1OO4 A;  1XA6 A;  4JEG A;  3K2T A;  3VRO A;  3VS3 A;  1Z3K A;  3PQZ A;  4FBN A;  1FBV A;  3S8O A;  1SPR A;  1X27 A;  4F5B A;  2KGY A;  5EHR A;  1LUK A;  1QCF A;  3VRZ A;  1FBZ A;  1O48 A;  2PLE A;  3ZNI A;  1O4G A;  2DLZ A;  5D0J A;  2EL8 A;  2MRK A;  1IS0 A;  2DM0 A;  1M61 A;  1IJR A;  1CSY A;  3N8M A;  5IBM A;  4GL9 E;  1A81 A;  2C0O A;  4A4C A;  2L4K A;  3MXY A;  2VIF A;  4K2R A;  1FMK A;  1O47 A;  1LUN A;  1LKL A;  1AYB A;  2EO3 A;  1OO3 A;  1TZE E;  1O4C A;  4H34 A;  1O44 A;  1OPK A;  3C7I A;  1JYQ A;  2EYZ A;  3WA4 A;  4ROJ A;  1BHH A;  3HCK A;  1KSW A;  2IZV A;  5EHP A;  5GJH A;  1P13 A;  3KFJ A;  2ROR A;  4A4B A;  1I3Z A;  1R1P A;  2HMH A;  4XZ0 A;  1LUI A;  2YU7 A;  4E93 A;  1O4I A;  3CD3 A;  4LUE A;  1PIC A;  1O4A A;  2LNX A;  2Y1M A;  5AUL A;  1BHH B;  2KNO A;  4FL3 A;  1A1B A;  1ZFP E;  1G83 A;  2FCI A;  3VRY A;  4JGH A;  1M27 A;  1Y1U A;  1YVL A;  1A07 A;  1OPL A;  1KA7 A;  2PTK A;  3UYO A;  3MXC A;  3CBL A;  1O41 A;  2SHP A;  1BHF A;  2GE9 A;  3PSJ A;  1O49 A;  3T04 A;  2PNB A;  3VS5 A;  3PJP A;  4U1P A;  5EEL A;  1RJA A;  2CR4 A;  1O4M A;  2EOB A;  1AD5 A;  1JYR A;  5EG3 B;  1FU5 A;  1NZL A;  1CSZ A;  1CWE A;  1QG1 E;  4K11 A;  1O4L A;  2EYV A;  3BUX B;  1O42 A;  2DCR A;  2OQ1 A;  2Y1N A;  3K2M A;  3OB1 B;  2H46 E;  1LUM A;  5J3X A;  2OZO A;  2KK6 A;  4OHI A;  3VGO A;  1NZV A;  4EIH A;  1AOU F;  4OHL A;  1O4H A;  4NWF A;  2B3O A;  1K9A A;  1O45 A;  4H1O A;  3VRQ A;  1X6C A;  4DGX A;  2AOA A;  1AYC A;  2LQN A;  1JU5 A;  5DF6 A;  2ETZ A;  1O43 A;  3CWG A;  3VRN A;  1SPS A;  4TZI A;  1UUS A;  1HCS B;  3OP0 A;  1A1A A;  1D1Z A;  1A08 A;  3VS7 A;  1D4T A;  3BKB A;  1AOT F;  1MIL A;  3HHM B;  3S9K A;  3MAZ A;  1Y57 A;  4DGP A;  2K7A B;  1O4R A;  2QMS A;  2DLY A;  3OB2 B;  1LCK A;  2ABL A;  4EY0 A;  1O4Q A;  1BLK A;  3N84 A;  1X0N A;  1QAD A;  2DX0 A;  4WWQ A;  3VS2 A;  4JE4 A;  4K45 A;  2L6K A;  1D4W A;  5GJI A;  2CI9 A;  3TL0 A;  4F59 A;  3OVE A;  1BM2 A;  4U17 A;  1O4B A;  2CRH A;  5HKW A;  1WQU A;  4P9Z A;  1SHD A;  2XP1 A;  1HCT B;  1KC2 A;  3BUW B;  1GHU A;  1BLJ A;  5BO4 A;  3IMJ A;  2LNW A;  1O4P A;  2RSY A;  3GXX A;  1F2F A;  3VS1 A;  1FU6 A;  1A1E A;  1R1Q A;  2C0T A;  3PSK A;  2LQW A;  1RQQ C;  3BUN B;  1NRV A;  1O4D A;  1FYR A;  2DVJ A;  2C9W A;  2HCK A;  1O4F A;  1O4N A;  2EKX A;  3GQI B;  1A09 A;  2IUI A;  1TCE A;  1SHB A;  2GSB A;  5HKY A;  2CIA A;  5IBS A;  1BFJ A;  3S8L A;  1O46 A;  4QSY A;  1BKL A;  4XZ1 A;  3M7F A;  1AYA A;  3S8N A;  4OHH A;  1BG1 A;  2RVF A;  1O4O A;  5I6V A;  4OHE A;  3IN7 A;  1SKJ A;  2AUG A;  3VS4 A;  3LYV A;  2YSX A;  2AOB A;  2C0I A;  1KA6 A;  3US4 A;  3QWX X;  2PNA A;  3IN8 A;  1R1S A;  2HUW A;  3EAC A;  2SRC A;  5AXI A;  1BFI A;  1GRI A;  2FO0 A;  1F1W A;  4L1B B;  2CBL A;  1CJ1 A;  4GWF A;  2MRJ A;  1LKK A;  2HDV A;  2BBU A;  1A1C A;  1O4K A; 
#chains in the Genus database with same CATH homology
 4GPL B;  1O4E A;  4F5A A;  2MQI A;  2RMX A;  5DC0 B;  1UUR A;  1LCJ A;  1CWD L;  2L3T A;  2Y3A B;  1BMB A;  4OHD A;  2EU0 A;  5CDW A;  1SHA A;  3PS5 A;  2HDX A;  2IUG A;  1B47 A;  3NHN A;  2MC1 A;  4D8K A;  3OV1 A;  1BF5 A;  3HIZ B;  1RPY A;  5EEQ A;  1FHS A;  3PLF B;  3TKZ A;  3QWY A;  2LCT A;  3UF4 A;  5HKZ A;  2PLD A;  1MW4 A;  4P9V A;  3GXW A;  2CI8 A;  4M4Z A;  1JWO A;  3BUO B;  3CXL A;  2H8H A;  2K79 B;  2EO6 A;  2EYY A;  4NWG A;  3VRR A;  3VS0 A;  2JYQ A;  4X6S A;  4LUD A;  5DC4 A;  2IUH A;  3PFV A;  3N7Y A;  1BKM A;  1AB2 A;  3VRP A;  2ECD A;  2H5K A;  2MK2 A;  1O4J A;  4FL2 A;  1JYU A;  3EAZ A;  4E68 A;  2CS0 A;  5KAZ A;  1H9O A;  4K44 A;  3BUM B;  3VS6 A;  1AYD A;  3IMD A;  5DC9 A;  1YVH A;  1OO4 A;  1XA6 A;  4JEG A;  3VRO A;  3VS3 A;  1Z3K A;  3PQZ A;  4FBN A;  1FBV A;  3S8O A;  1SPR A;  1X27 A;  4F5B A;  5EHR A;  1LUK A;  1QCF A;  3VRZ A;  1FBZ A;  1O48 A;  2PLE A;  3ZNI A;  1O4G A;  2DLZ A;  5D0J A;  2EL8 A;  2MRK A;  1IS0 A;  2DM0 A;  1M61 A;  1IJR A;  1CSY A;  3N8M A;  5IBM A;  4GL9 E;  1A81 A;  2C0O A;  4A4C A;  2L4K A;  3MXY A;  2VIF A;  4K2R A;  1FMK A;  1O47 A;  1LUN A;  1LKL A;  1AYB A;  2EO3 A;  1OO3 A;  1TZE E;  1O4C A;  4H34 A;  1O44 A;  1OPK A;  3C7I A;  1JYQ A;  2EYZ A;  3WA4 A;  4ROJ A;  1BHH A;  3HCK A;  1KSW A;  2IZV A;  5EHP A;  5GJH A;  1P13 A;  3KFJ A;  2ROR A;  4A4B A;  1I3Z A;  1R1P A;  2HMH A;  4XZ0 A;  1LUI A;  2YU7 A;  4E93 A;  1O4I A;  3CD3 A;  4LUE A;  1PIC A;  1O4A A;  2LNX A;  2Y1M A;  5AUL A;  1BHH B;  2KNO A;  4FL3 A;  1A1B A;  1ZFP E;  1G83 A;  2FCI A;  3VRY A;  4JGH A;  1M27 A;  1Y1U A;  1YVL A;  1A07 A;  1OPL A;  1KA7 A;  2PTK A;  3UYO A;  3MXC A;  3CBL A;  1O41 A;  2SHP A;  1BHF A;  2GE9 A;  3PSJ A;  1O49 A;  3T04 A;  2PNB A;  3VS5 A;  3PJP A;  4U1P A;  5EEL A;  1RJA A;  2CR4 A;  1O4M A;  2EOB A;  1AD5 A;  1JYR A;  5EG3 B;  1FU5 A;  1NZL A;  1CSZ A;  1CWE A;  1QG1 E;  4K11 A;  1O4L A;  2EYV A;  3BUX B;  1O42 A;  2DCR A;  2OQ1 A;  2Y1N A;  3K2M A;  3OB1 B;  2H46 E;  1LUM A;  5J3X A;  2OZO A;  2KK6 A;  4OHI A;  3VGO A;  1NZV A;  4EIH A;  1AOU F;  4OHL A;  1O4H A;  4NWF A;  2B3O A;  1K9A A;  1O45 A;  4H1O A;  3VRQ A;  1X6C A;  4DGX A;  2AOA A;  1AYC A;  2LQN A;  1JU5 A;  5DF6 A;  2ETZ A;  1O43 A;  3CWG A;  3VRN A;  1SPS A;  4TZI A;  1UUS A;  1HCS B;  3OP0 A;  1A1A A;  1D1Z A;  1A08 A;  3VS7 A;  1D4T A;  3BKB A;  1AOT F;  1MIL A;  3HHM B;  3S9K A;  3MAZ A;  1Y57 A;  4DGP A;  2K7A B;  1O4R A;  2QMS A;  2DLY A;  3OB2 B;  1LCK A;  2ABL A;  4EY0 A;  1O4Q A;  1BLK A;  3N84 A;  1X0N A;  1QAD A;  2DX0 A;  4WWQ A;  3VS2 A;  4JE4 A;  4K45 A;  2L6K A;  1D4W A;  5GJI A;  2CI9 A;  3TL0 A;  4F59 A;  3OVE A;  1BM2 A;  4U17 A;  1O4B A;  2CRH A;  5HKW A;  1WQU A;  4P9Z A;  1SHD A;  2XP1 A;  1HCT B;  1KC2 A;  3BUW B;  1GHU A;  1BLJ A;  5BO4 A;  3IMJ A;  2LNW A;  1O4P A;  2RSY A;  3GXX A;  1F2F A;  3VS1 A;  1FU6 A;  1A1E A;  1R1Q A;  2C0T A;  3PSK A;  2LQW A;  1RQQ C;  3BUN B;  1NRV A;  1O4D A;  1FYR A;  2DVJ A;  2C9W A;  2HCK A;  1O4F A;  1O4N A;  2EKX A;  3GQI B;  1A09 A;  2IUI A;  1TCE A;  1SHB A;  2GSB A;  5HKY A;  2CIA A;  5IBS A;  1BFJ A;  3S8L A;  1O46 A;  4QSY A;  1BKL A;  4XZ1 A;  3M7F A;  1AYA A;  3S8N A;  4OHH A;  1BG1 A;  2RVF A;  1O4O A;  5I6V A;  4OHE A;  3IN7 A;  1SKJ A;  2AUG A;  3VS4 A;  2YSX A;  2AOB A;  2C0I A;  1KA6 A;  3US4 A;  3QWX X;  2PNA A;  3IN8 A;  1R1S A;  2HUW A;  3EAC A;  2SRC A;  5AXI A;  1BFI A;  1GRI A;  2FO0 A;  1F1W A;  4L1B B;  2CBL A;  1CJ1 A;  4GWF A;  2MRJ A;  1LKK A;  2HDV A;  2BBU A;  1A1C A;  1O4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...