1KA7A

Sap/sh2d1a bound to peptide n-y-c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
107
structure length
107
Chain Sequence
MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH2 DOMAIN PROTEIN 1A
publication title A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 14
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2001-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1ka7A00
3BUXB 1FYRA 1RJAA 4U17A 2LNWA 3VROA 1AYAA 1ZFPE 2HDVA 3OVEA 4U1PA 1F1WA 2PLDA 1KA6A 4K11A 4OHDA 4OHEA 3K2MA 1O4QA 3PQZA 1KSWA 1X27A 1SHBA 1BF5A 1LKLA 4EIHA 4XZ1A 1B47A 1IJRA 1O4EA 4H1OA 1TCEA 3VGOA 1O4GA 1BFIA 1O4RA 1K9AA 3BUMB 3VS7A 1O43A 1NZVA 3CWGA 1LUNA 2RVFA 1R1PA 3VRZA 1KC2A 2ECDA 1BLKA 2L6KA 3CBLA 3OB2B 1FBVA 2K7AB 2CBLA 1GHUA 2XP1A 1QG1E 2YSXA 2GSBA 1SHAA 1A1CA 3IMJA 2FCIA 1BM2A 1CJ1A 4E68A 3CD3A 4TZIA 1FU6A 2RSYA 3PSKA 1IS0A 1O47A 1OO3A 2KK6A 4X6SA 4OHIA 2RMXA 1FBZA 1HCSB 1SPRA 4ROJA 1Y57A 3PSJA 5I6VA 1O4FA 3T04A 3S9KA 3N84A 3KFJA 4JEGA 1LKKA 1AD5A 1Z3KA 2EL8A 2PLEA 5HKWA 1SKJA 4FBNA 2LQWA 3OB1B 3S8OA 3IMDA 1X0NA 3VS5A 2AOBA 2LCTA 2EYZA 5GJIA 1TZEE 4LUDA 1I3ZA 2CIAA 3PFVA 1QADA 1LCJA 1SPSA 3VRRA 1CSYA 3BUWB 4DGXA 2DLYA 1AYBA 1O4HA 3CXLA 1D4TA 2KNOA 1M61A 4XZ0A 1JWOA 3VRNA 1O4IA 1P13A 1AYCA 1CWDL 1OPLA 4OHHA 1A1BA 1O4LA 1NRVA 2OZOA 2H5KA 1O45A 1O4BA 1AYDA 1O46A 3VS3A 2EO3A 1XA6A 1LUMA 1MW4A 1UURA 2SRCA 2EU0A 2MRKA 1O4JA 4K45A 5DC4A 1LCKA 2DM0A 2Y3AB 1O41A 4F59A 1O4AA 2OQ1A 1O4DA 4A4BA 1O4PA 1A81A 1Y1UA 2Y1MA 4JGHA 2VIFA 4GL9E 3GQIB 2PNAA 1SHDA 1BKMA 1GRIA 1JYUA 5EHPA 3US4A 2H46E 4F5BA 2B3OA 1BFJA 3MXCA 4NWGA 1F2FA 3VS1A 2DCRA 3M7FA 1A08A 5KAZA 2ABLA 1JYRA 2EKXA 3VS0A 3GXWA 1A1AA 5HKZA 3VS4A 3N8MA 1AB2A 1R1QA 4K44A 5GJHA 4JE4A 3WA4A 1O4CA 2HCKA 4QSYA 2IUGA 2YU7A 3VS6A 1MILA 1FU5A 2AUGA 2CR4A 1FMKA 1O4NA 3MAZA 3MXYA 1O4KA 5EELA 2QMSA 3EAZA 5J3XA 3IN7A 3GXXA 5EHRA 2CS0A 1M27A 2C0OA 2EO6A 3BUNB 1AOTF 2Y1NA 3VRPA 3HCKA 5D0JA 1D1ZA 2MQIA 2MC1A 2HMHA 3BKBA 1AOUF 1BMBA 2CRHA 1O44A 1O48A 3OP0A 5DC9A 5EEQA 4P9VA 2RORA 4F5AA 2C0IA 2BBUA 2JYQA 1D4WA 3IN8A 3ZNIA 2PNBA 2IUIA 1BKLA 5IBMA 3VRQA 1KA7A 4NWFA 1LUIA 4GWFA 4A4CA 2FO0A 2EYVA 1CSZA 4GPLB 1OO4A 3PJPA 1QCFA 1BG1A 3NHNA 4P9ZA 3UF4A 2HDXA 2K79B 3PS5A 3QWYA 1FHSA 1BHFA 2DLZA 5AULA 4K2RA 2CI8A 2SHPA 1YVHA 2DX0A 1O49A 2LNXA 1NZLA 2C9WA 1X6CA 1O4OA 5BO4A 3TKZA 2DVJA 1O42A 2CI9A 2MK2A 2MRJA 4EY0A 5DF6A 2AOAA 1O4MA 3C7IA 2EOBA 2LQNA 3HHMB 3QWXX 4DGPA 3UYOA 2L3TA 1BHHB 3S8LA 1PICA 5CDWA 4FL2A 1OPKA 1HCTB 5EG3B 4M4ZA 2L4KA 2ETZA 1UUSA 1WQUA 1G83A 2EYYA 3PLFB 1RQQC 2GE9A 3EACA 4FL3A 4L1BB 4WWQA 1CWEA 2C0TA 3BUOB 1BLJA 1BHHA 1YVLA 1A07A 1RPYA 4OHLA 4D8KA 3OV1A 5IBSA 3N7YA 1H9OA 1R1SA 2HUWA 5AXIA 1JU5A 3S8NA 3HIZB 4LUEA 1A09A 3VS2A 1A1EA 2IZVA 2H8HA 1JYQA 2PTKA 1LUKA 4H34A 3TL0A 4E93A 5HKYA 2IUHA 5DC0B 3VRYA
chains in the Genus database with same CATH superfamily
3BUXB 1FYRA 1RJAA 4U17A 2LNWA 3VROA 1AYAA 1ZFPE 2HDVA 3OVEA 4U1PA 1F1WA 2PLDA 1KA6A 4K11A 4OHDA 4OHEA 3K2MA 1O4QA 3PQZA 1KSWA 1X27A 1SHBA 1BF5A 1LKLA 4EIHA 4XZ1A 1B47A 1IJRA 1O4EA 4H1OA 1TCEA 3VGOA 1O4GA 1BFIA 1O4RA 1K9AA 3BUMB 3VS7A 3LYVA 1O43A 1NZVA 3CWGA 1LUNA 2RVFA 1R1PA 3VRZA 1KC2A 2ECDA 1BLKA 2L6KA 3CBLA 3OB2B 1FBVA 3K2TA 2K7AB 2CBLA 1GHUA 2XP1A 1QG1E 2YSXA 2GSBA 1SHAA 1A1CA 3IMJA 2FCIA 1BM2A 1CJ1A 4E68A 3CD3A 4TZIA 1FU6A 2RSYA 3PSKA 1IS0A 1O47A 1OO3A 2KK6A 4X6SA 4OHIA 2RMXA 1FBZA 1HCSB 1SPRA 4ROJA 1Y57A 3PSJA 5I6VA 1O4FA 3T04A 3S9KA 3N84A 3KFJA 4JEGA 1LKKA 1AD5A 1Z3KA 2EL8A 2PLEA 5HKWA 1SKJA 4FBNA 2LQWA 3OB1B 3S8OA 3IMDA 1X0NA 3VS5A 2AOBA 2LCTA 2EYZA 5GJIA 1TZEE 4LUDA 1I3ZA 2CIAA 3PFVA 1QADA 1LCJA 1SPSA 3VRRA 1CSYA 3BUWB 4DGXA 2DLYA 1AYBA 1O4HA 3CXLA 1D4TA 2KNOA 1M61A 4XZ0A 1JWOA 3VRNA 1O4IA 1P13A 1AYCA 1CWDL 1OPLA 4OHHA 1A1BA 1O4LA 1NRVA 2OZOA 2H5KA 1O45A 1O4BA 1AYDA 1O46A 3VS3A 2EO3A 1XA6A 1LUMA 1MW4A 1UURA 2SRCA 2EU0A 2MRKA 1O4JA 4K45A 5DC4A 1LCKA 2DM0A 2Y3AB 1O41A 4F59A 1O4AA 2OQ1A 1O4DA 4A4BA 1O4PA 1A81A 1Y1UA 2Y1MA 4JGHA 2VIFA 4GL9E 3GQIB 2PNAA 1SHDA 1BKMA 1GRIA 1JYUA 5EHPA 3US4A 2H46E 4F5BA 2B3OA 1BFJA 3MXCA 4NWGA 1F2FA 3VS1A 2DCRA 3M7FA 1A08A 5KAZA 2ABLA 1JYRA 2EKXA 3VS0A 3GXWA 1A1AA 5HKZA 3VS4A 3N8MA 1AB2A 1R1QA 4K44A 5GJHA 4JE4A 3WA4A 1O4CA 2HCKA 4QSYA 2IUGA 2YU7A 3VS6A 1MILA 1FU5A 2AUGA 2CR4A 1FMKA 1O4NA 3MAZA 3MXYA 1O4KA 5EELA 2QMSA 3EAZA 5J3XA 3IN7A 3GXXA 5EHRA 2CS0A 1M27A 2C0OA 2EO6A 3BUNB 1AOTF 2Y1NA 3VRPA 3HCKA 5D0JA 1D1ZA 2MQIA 2MC1A 2HMHA 3BKBA 1AOUF 1BMBA 2CRHA 1O44A 1O48A 3OP0A 5DC9A 5EEQA 4P9VA 2RORA 4F5AA 2C0IA 2BBUA 2JYQA 1D4WA 3IN8A 3ZNIA 2PNBA 2IUIA 1BKLA 5IBMA 3VRQA 1KA7A 4NWFA 1LUIA 4GWFA 4A4CA 2FO0A 2EYVA 1CSZA 4GPLB 1OO4A 3PJPA 1QCFA 1BG1A 3NHNA 4P9ZA 3UF4A 2HDXA 2K79B 3PS5A 3QWYA 1FHSA 1BHFA 2DLZA 5AULA 4K2RA 2CI8A 2SHPA 1YVHA 2DX0A 1O49A 2LNXA 1NZLA 2C9WA 1X6CA 1O4OA 5BO4A 2LRAA 3TKZA 2DVJA 1O42A 2CI9A 2MK2A 2MRJA 4EY0A 5DF6A 2AOAA 1O4MA 3C7IA 2EOBA 2LQNA 3HHMB 3QWXX 4DGPA 3UYOA 2L3TA 1BHHB 3S8LA 1PICA 5CDWA 4FL2A 1OPKA 1HCTB 5EG3B 4M4ZA 2L4KA 2ETZA 1UUSA 1WQUA 1G83A 2EYYA 3PLFB 1RQQC 2GE9A 3EACA 4FL3A 4L1BB 4WWQA 1CWEA 2C0TA 3BUOB 1BLJA 2KGYA 1BHHA 1YVLA 1A07A 1RPYA 4OHLA 4D8KA 3OV1A 5IBSA 3N7YA 1H9OA 1R1SA 2HUWA 5AXIA 1JU5A 3S8NA 3HIZB 4LUEA 1A09A 3VS2A 1A1EA 2IZVA 2H8HA 1JYQA 2PTKA 1LUKA 4H34A 3TL0A 4E93A 5HKYA 2IUHA 5DC0B 3VRYA
chains in the Genus database with same CATH topology
3BUXB 1FYRA 1RJAA 4U17A 2LNWA 3VROA 1AYAA 1ZFPE 2HDVA 3OVEA 4U1PA 1F1WA 2PLDA 1KA6A 4K11A 4OHDA 4OHEA 3K2MA 1O4QA 3PQZA 1KSWA 1X27A 1SHBA 1BF5A 1LKLA 4EIHA 4XZ1A 1B47A 1IJRA 1O4EA 4H1OA 1TCEA 3VGOA 1O4GA 1BFIA 1O4RA 1K9AA 3BUMB 3VS7A 1O43A 1NZVA 3CWGA 1LUNA 2RVFA 1R1PA 3VRZA 1KC2A 2ECDA 1BLKA 2L6KA 3CBLA 3OB2B 1FBVA 2K7AB 2CBLA 1GHUA 2XP1A 1QG1E 2YSXA 2GSBA 1SHAA 1A1CA 3IMJA 2FCIA 1BM2A 1CJ1A 4E68A 3CD3A 4TZIA 1FU6A 2RSYA 3PSKA 1IS0A 1O47A 1OO3A 2KK6A 4X6SA 4OHIA 2RMXA 1FBZA 1HCSB 1SPRA 4ROJA 1Y57A 3PSJA 5I6VA 1O4FA 3T04A 3S9KA 3N84A 3KFJA 4JEGA 1LKKA 1AD5A 1Z3KA 2EL8A 2PLEA 5HKWA 1SKJA 4FBNA 2LQWA 3OB1B 3S8OA 3IMDA 1X0NA 3VS5A 2AOBA 2LCTA 2EYZA 5GJIA 1TZEE 4LUDA 1I3ZA 2CIAA 3PFVA 1QADA 1LCJA 1SPSA 3VRRA 1CSYA 3BUWB 4DGXA 2DLYA 1AYBA 1O4HA 3CXLA 1D4TA 2KNOA 1M61A 4XZ0A 1JWOA 3VRNA 1O4IA 1P13A 1AYCA 1CWDL 1OPLA 4OHHA 1A1BA 1O4LA 1NRVA 2OZOA 2H5KA 1O45A 1O4BA 1AYDA 1O46A 3VS3A 2EO3A 1XA6A 1LUMA 1MW4A 1UURA 2SRCA 2EU0A 2MRKA 1O4JA 4K45A 5DC4A 1LCKA 2DM0A 2Y3AB 1O41A 4F59A 1O4AA 2OQ1A 1O4DA 4A4BA 1O4PA 1A81A 1Y1UA 2Y1MA 4JGHA 2VIFA 4GL9E 3GQIB 2PNAA 1SHDA 1BKMA 1GRIA 1JYUA 5EHPA 3US4A 2H46E 4F5BA 2B3OA 1BFJA 3MXCA 4NWGA 1F2FA 3VS1A 2DCRA 3M7FA 1A08A 5KAZA 2ABLA 1JYRA 2EKXA 3VS0A 3GXWA 1A1AA 5HKZA 3VS4A 3N8MA 1AB2A 1R1QA 4K44A 5GJHA 4JE4A 3WA4A 1O4CA 2HCKA 4QSYA 2IUGA 2YU7A 3VS6A 1MILA 1FU5A 2AUGA 2CR4A 1FMKA 1O4NA 3MAZA 3MXYA 1O4KA 5EELA 2QMSA 3EAZA 5J3XA 3IN7A 3GXXA 5EHRA 2CS0A 1M27A 2C0OA 2EO6A 3BUNB 1AOTF 2Y1NA 3VRPA 3HCKA 5D0JA 1D1ZA 2MQIA 2MC1A 2HMHA 3BKBA 1AOUF 1BMBA 2CRHA 1O44A 1O48A 3OP0A 5DC9A 5EEQA 4P9VA 2RORA 4F5AA 2C0IA 2BBUA 2JYQA 1D4WA 3IN8A 3ZNIA 2PNBA 2IUIA 1BKLA 5IBMA 3VRQA 1KA7A 4NWFA 1LUIA 4GWFA 4A4CA 2FO0A 2EYVA 1CSZA 4GPLB 1OO4A 3PJPA 1QCFA 1BG1A 3NHNA 4P9ZA 3UF4A 2HDXA 2K79B 3PS5A 3QWYA 1FHSA 1BHFA 2DLZA 5AULA 4K2RA 2CI8A 2SHPA 1YVHA 2DX0A 1O49A 2LNXA 1NZLA 2C9WA 1X6CA 1O4OA 5BO4A 3TKZA 2DVJA 1O42A 2CI9A 2MK2A 2MRJA 4EY0A 5DF6A 2AOAA 1O4MA 3C7IA 2EOBA 2LQNA 3HHMB 3QWXX 4DGPA 3UYOA 2L3TA 1BHHB 3S8LA 1PICA 5CDWA 4FL2A 1OPKA 1HCTB 5EG3B 4M4ZA 2L4KA 2ETZA 1UUSA 1WQUA 1G83A 2EYYA 3PLFB 1RQQC 2GE9A 3EACA 4FL3A 4L1BB 4WWQA 1CWEA 2C0TA 3BUOB 1BLJA 1BHHA 1YVLA 1A07A 1RPYA 4OHLA 4D8KA 3OV1A 5IBSA 3N7YA 1H9OA 1R1SA 2HUWA 5AXIA 1JU5A 3S8NA 3HIZB 4LUEA 1A09A 3VS2A 1A1EA 2IZVA 2H8HA 1JYQA 2PTKA 1LUKA 4H34A 3TL0A 4E93A 5HKYA 2IUHA 5DC0B 3VRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BUX B;  1FYR A;  1RJA A;  4U17 A;  2LNW A;  3VRO A;  1AYA A;  1ZFP E;  2HDV A;  3OVE A;  4U1P A;  1F1W A;  2PLD A;  1KA6 A;  4K11 A;  4OHD A;  4OHE A;  3K2M A;  1O4Q A;  3PQZ A;  1KSW A;  1X27 A;  1SHB A;  1BF5 A;  1LKL A;  4EIH A;  4XZ1 A;  1B47 A;  1IJR A;  1O4E A;  4H1O A;  1TCE A;  3VGO A;  1O4G A;  1BFI A;  1O4R A;  1K9A A;  3BUM B;  3VS7 A;  1O43 A;  1NZV A;  3CWG A;  1LUN A;  2RVF A;  1R1P A;  3VRZ A;  1KC2 A;  2ECD A;  1BLK A;  2L6K A;  3CBL A;  3OB2 B;  1FBV A;  2K7A B;  2CBL A;  1GHU A;  2XP1 A;  1QG1 E;  2YSX A;  2GSB A;  1SHA A;  1A1C A;  3IMJ A;  2FCI A;  1BM2 A;  1CJ1 A;  4E68 A;  3CD3 A;  4TZI A;  1FU6 A;  2RSY A;  3PSK A;  1IS0 A;  1O47 A;  1OO3 A;  2KK6 A;  4X6S A;  4OHI A;  2RMX A;  1FBZ A;  1HCS B;  1SPR A;  4ROJ A;  1Y57 A;  3PSJ A;  5I6V A;  1O4F A;  3T04 A;  3S9K A;  3N84 A;  3KFJ A;  4JEG A;  1LKK A;  1AD5 A;  1Z3K A;  2EL8 A;  2PLE A;  5HKW A;  1SKJ A;  4FBN A;  2LQW A;  3OB1 B;  3S8O A;  3IMD A;  1X0N A;  3VS5 A;  2AOB A;  2LCT A;  2EYZ A;  5GJI A;  1TZE E;  4LUD A;  1I3Z A;  2CIA A;  3PFV A;  1QAD A;  1LCJ A;  1SPS A;  3VRR A;  1CSY A;  3BUW B;  4DGX A;  2DLY A;  1AYB A;  1O4H A;  3CXL A;  1D4T A;  2KNO A;  1M61 A;  4XZ0 A;  1JWO A;  3VRN A;  1O4I A;  1P13 A;  1AYC A;  1CWD L;  1OPL A;  4OHH A;  1A1B A;  1O4L A;  1NRV A;  2OZO A;  2H5K A;  1O45 A;  1O4B A;  1AYD A;  1O46 A;  3VS3 A;  2EO3 A;  1XA6 A;  1LUM A;  1MW4 A;  1UUR A;  2SRC A;  2EU0 A;  2MRK A;  1O4J A;  4K45 A;  5DC4 A;  1LCK A;  2DM0 A;  2Y3A B;  1O41 A;  4F59 A;  1O4A A;  2OQ1 A;  1O4D A;  4A4B A;  1O4P A;  1A81 A;  1Y1U A;  2Y1M A;  4JGH A;  2VIF A;  4GL9 E;  3GQI B;  2PNA A;  1SHD A;  1BKM A;  1GRI A;  1JYU A;  5EHP A;  3US4 A;  2H46 E;  4F5B A;  2B3O A;  1BFJ A;  3MXC A;  4NWG A;  1F2F A;  3VS1 A;  2DCR A;  3M7F A;  1A08 A;  5KAZ A;  2ABL A;  1JYR A;  2EKX A;  3VS0 A;  3GXW A;  1A1A A;  5HKZ A;  3VS4 A;  3N8M A;  1AB2 A;  1R1Q A;  4K44 A;  5GJH A;  4JE4 A;  3WA4 A;  1O4C A;  2HCK A;  4QSY A;  2IUG A;  2YU7 A;  3VS6 A;  1MIL A;  1FU5 A;  2AUG A;  2CR4 A;  1FMK A;  1O4N A;  3MAZ A;  3MXY A;  1O4K A;  5EEL A;  2QMS A;  3EAZ A;  5J3X A;  3IN7 A;  3GXX A;  5EHR A;  2CS0 A;  1M27 A;  2C0O A;  2EO6 A;  3BUN B;  1AOT F;  2Y1N A;  3VRP A;  3HCK A;  5D0J A;  1D1Z A;  2MQI A;  2MC1 A;  2HMH A;  3BKB A;  1AOU F;  1BMB A;  2CRH A;  1O44 A;  1O48 A;  3OP0 A;  5DC9 A;  5EEQ A;  4P9V A;  2ROR A;  4F5A A;  2C0I A;  2BBU A;  2JYQ A;  1D4W A;  3IN8 A;  3ZNI A;  2PNB A;  2IUI A;  1BKL A;  5IBM A;  3VRQ A;  1KA7 A;  4NWF A;  1LUI A;  4GWF A;  4A4C A;  2FO0 A;  2EYV A;  1CSZ A;  4GPL B;  1OO4 A;  3PJP A;  1QCF A;  1BG1 A;  3NHN A;  4P9Z A;  3UF4 A;  2HDX A;  2K79 B;  3PS5 A;  3QWY A;  1FHS A;  1BHF A;  2DLZ A;  5AUL A;  4K2R A;  2CI8 A;  2SHP A;  1YVH A;  2DX0 A;  1O49 A;  2LNX A;  1NZL A;  2C9W A;  1X6C A;  1O4O A;  5BO4 A;  3TKZ A;  2DVJ A;  1O42 A;  2CI9 A;  2MK2 A;  2MRJ A;  4EY0 A;  5DF6 A;  2AOA A;  1O4M A;  3C7I A;  2EOB A;  2LQN A;  3HHM B;  3QWX X;  4DGP A;  3UYO A;  2L3T A;  1BHH B;  3S8L A;  1PIC A;  5CDW A;  4FL2 A;  1OPK A;  1HCT B;  5EG3 B;  4M4Z A;  2L4K A;  2ETZ A;  1UUS A;  1WQU A;  1G83 A;  2EYY A;  3PLF B;  1RQQ C;  2GE9 A;  3EAC A;  4FL3 A;  4L1B B;  4WWQ A;  1CWE A;  2C0T A;  3BUO B;  1BLJ A;  1BHH A;  1YVL A;  1A07 A;  1RPY A;  4OHL A;  4D8K A;  3OV1 A;  5IBS A;  3N7Y A;  1H9O A;  1R1S A;  2HUW A;  5AXI A;  1JU5 A;  3S8N A;  3HIZ B;  4LUE A;  1A09 A;  3VS2 A;  1A1E A;  2IZV A;  2H8H A;  1JYQ A;  2PTK A;  1LUK A;  4H34 A;  3TL0 A;  4E93 A;  5HKY A;  2IUH A;  5DC0 B;  3VRY A; 
#chains in the Genus database with same CATH topology
 3BUX B;  1FYR A;  1RJA A;  4U17 A;  2LNW A;  3VRO A;  1AYA A;  1ZFP E;  2HDV A;  3OVE A;  4U1P A;  1F1W A;  2PLD A;  1KA6 A;  4K11 A;  4OHD A;  4OHE A;  3K2M A;  1O4Q A;  3PQZ A;  1KSW A;  1X27 A;  1SHB A;  1BF5 A;  1LKL A;  4EIH A;  4XZ1 A;  1B47 A;  1IJR A;  1O4E A;  4H1O A;  1TCE A;  3VGO A;  1O4G A;  1BFI A;  1O4R A;  1K9A A;  3BUM B;  3VS7 A;  3LYV A;  1O43 A;  1NZV A;  3CWG A;  1LUN A;  2RVF A;  1R1P A;  3VRZ A;  1KC2 A;  2ECD A;  1BLK A;  2L6K A;  3CBL A;  3OB2 B;  1FBV A;  3K2T A;  2K7A B;  2CBL A;  1GHU A;  2XP1 A;  1QG1 E;  2YSX A;  2GSB A;  1SHA A;  1A1C A;  3IMJ A;  2FCI A;  1BM2 A;  1CJ1 A;  4E68 A;  3CD3 A;  4TZI A;  1FU6 A;  2RSY A;  3PSK A;  1IS0 A;  1O47 A;  1OO3 A;  2KK6 A;  4X6S A;  4OHI A;  2RMX A;  1FBZ A;  1HCS B;  1SPR A;  4ROJ A;  1Y57 A;  3PSJ A;  5I6V A;  1O4F A;  3T04 A;  3S9K A;  3N84 A;  3KFJ A;  4JEG A;  1LKK A;  1AD5 A;  1Z3K A;  2EL8 A;  2PLE A;  5HKW A;  1SKJ A;  4FBN A;  2LQW A;  3OB1 B;  3S8O A;  3IMD A;  1X0N A;  3VS5 A;  2AOB A;  2LCT A;  2EYZ A;  5GJI A;  1TZE E;  4LUD A;  1I3Z A;  2CIA A;  3PFV A;  1QAD A;  1LCJ A;  1SPS A;  3VRR A;  1CSY A;  3BUW B;  4DGX A;  2DLY A;  1AYB A;  1O4H A;  3CXL A;  1D4T A;  2KNO A;  1M61 A;  4XZ0 A;  1JWO A;  3VRN A;  1O4I A;  1P13 A;  1AYC A;  1CWD L;  1OPL A;  4OHH A;  1A1B A;  1O4L A;  1NRV A;  2OZO A;  2H5K A;  1O45 A;  1O4B A;  1AYD A;  1O46 A;  3VS3 A;  2EO3 A;  1XA6 A;  1LUM A;  1MW4 A;  1UUR A;  2SRC A;  2EU0 A;  2MRK A;  1O4J A;  4K45 A;  5DC4 A;  1LCK A;  2DM0 A;  2Y3A B;  1O41 A;  4F59 A;  1O4A A;  2OQ1 A;  1O4D A;  4A4B A;  1O4P A;  1A81 A;  1Y1U A;  2Y1M A;  4JGH A;  2VIF A;  4GL9 E;  3GQI B;  2PNA A;  1SHD A;  1BKM A;  1GRI A;  1JYU A;  5EHP A;  3US4 A;  2H46 E;  4F5B A;  2B3O A;  1BFJ A;  3MXC A;  4NWG A;  1F2F A;  3VS1 A;  2DCR A;  3M7F A;  1A08 A;  5KAZ A;  2ABL A;  1JYR A;  2EKX A;  3VS0 A;  3GXW A;  1A1A A;  5HKZ A;  3VS4 A;  3N8M A;  1AB2 A;  1R1Q A;  4K44 A;  5GJH A;  4JE4 A;  3WA4 A;  1O4C A;  2HCK A;  4QSY A;  2IUG A;  2YU7 A;  3VS6 A;  1MIL A;  1FU5 A;  2AUG A;  2CR4 A;  1FMK A;  1O4N A;  3MAZ A;  3MXY A;  1O4K A;  5EEL A;  2QMS A;  3EAZ A;  5J3X A;  3IN7 A;  3GXX A;  5EHR A;  2CS0 A;  1M27 A;  2C0O A;  2EO6 A;  3BUN B;  1AOT F;  2Y1N A;  3VRP A;  3HCK A;  5D0J A;  1D1Z A;  2MQI A;  2MC1 A;  2HMH A;  3BKB A;  1AOU F;  1BMB A;  2CRH A;  1O44 A;  1O48 A;  3OP0 A;  5DC9 A;  5EEQ A;  4P9V A;  2ROR A;  4F5A A;  2C0I A;  2BBU A;  2JYQ A;  1D4W A;  3IN8 A;  3ZNI A;  2PNB A;  2IUI A;  1BKL A;  5IBM A;  3VRQ A;  1KA7 A;  4NWF A;  1LUI A;  4GWF A;  4A4C A;  2FO0 A;  2EYV A;  1CSZ A;  4GPL B;  1OO4 A;  3PJP A;  1QCF A;  1BG1 A;  3NHN A;  4P9Z A;  3UF4 A;  2HDX A;  2K79 B;  3PS5 A;  3QWY A;  1FHS A;  1BHF A;  2DLZ A;  5AUL A;  4K2R A;  2CI8 A;  2SHP A;  1YVH A;  2DX0 A;  1O49 A;  2LNX A;  1NZL A;  2C9W A;  1X6C A;  1O4O A;  5BO4 A;  2LRA A;  3TKZ A;  2DVJ A;  1O42 A;  2CI9 A;  2MK2 A;  2MRJ A;  4EY0 A;  5DF6 A;  2AOA A;  1O4M A;  3C7I A;  2EOB A;  2LQN A;  3HHM B;  3QWX X;  4DGP A;  3UYO A;  2L3T A;  1BHH B;  3S8L A;  1PIC A;  5CDW A;  4FL2 A;  1OPK A;  1HCT B;  5EG3 B;  4M4Z A;  2L4K A;  2ETZ A;  1UUS A;  1WQU A;  1G83 A;  2EYY A;  3PLF B;  1RQQ C;  2GE9 A;  3EAC A;  4FL3 A;  4L1B B;  4WWQ A;  1CWE A;  2C0T A;  3BUO B;  1BLJ A;  2KGY A;  1BHH A;  1YVL A;  1A07 A;  1RPY A;  4OHL A;  4D8K A;  3OV1 A;  5IBS A;  3N7Y A;  1H9O A;  1R1S A;  2HUW A;  5AXI A;  1JU5 A;  3S8N A;  3HIZ B;  4LUE A;  1A09 A;  3VS2 A;  1A1E A;  2IZV A;  2H8H A;  1JYQ A;  2PTK A;  1LUK A;  4H34 A;  3TL0 A;  4E93 A;  5HKY A;  2IUH A;  5DC0 B;  3VRY A; 
#chains in the Genus database with same CATH homology
 3BUX B;  1FYR A;  1RJA A;  4U17 A;  2LNW A;  3VRO A;  1AYA A;  1ZFP E;  2HDV A;  3OVE A;  4U1P A;  1F1W A;  2PLD A;  1KA6 A;  4K11 A;  4OHD A;  4OHE A;  3K2M A;  1O4Q A;  3PQZ A;  1KSW A;  1X27 A;  1SHB A;  1BF5 A;  1LKL A;  4EIH A;  4XZ1 A;  1B47 A;  1IJR A;  1O4E A;  4H1O A;  1TCE A;  3VGO A;  1O4G A;  1BFI A;  1O4R A;  1K9A A;  3BUM B;  3VS7 A;  1O43 A;  1NZV A;  3CWG A;  1LUN A;  2RVF A;  1R1P A;  3VRZ A;  1KC2 A;  2ECD A;  1BLK A;  2L6K A;  3CBL A;  3OB2 B;  1FBV A;  2K7A B;  2CBL A;  1GHU A;  2XP1 A;  1QG1 E;  2YSX A;  2GSB A;  1SHA A;  1A1C A;  3IMJ A;  2FCI A;  1BM2 A;  1CJ1 A;  4E68 A;  3CD3 A;  4TZI A;  1FU6 A;  2RSY A;  3PSK A;  1IS0 A;  1O47 A;  1OO3 A;  2KK6 A;  4X6S A;  4OHI A;  2RMX A;  1FBZ A;  1HCS B;  1SPR A;  4ROJ A;  1Y57 A;  3PSJ A;  5I6V A;  1O4F A;  3T04 A;  3S9K A;  3N84 A;  3KFJ A;  4JEG A;  1LKK A;  1AD5 A;  1Z3K A;  2EL8 A;  2PLE A;  5HKW A;  1SKJ A;  4FBN A;  2LQW A;  3OB1 B;  3S8O A;  3IMD A;  1X0N A;  3VS5 A;  2AOB A;  2LCT A;  2EYZ A;  5GJI A;  1TZE E;  4LUD A;  1I3Z A;  2CIA A;  3PFV A;  1QAD A;  1LCJ A;  1SPS A;  3VRR A;  1CSY A;  3BUW B;  4DGX A;  2DLY A;  1AYB A;  1O4H A;  3CXL A;  1D4T A;  2KNO A;  1M61 A;  4XZ0 A;  1JWO A;  3VRN A;  1O4I A;  1P13 A;  1AYC A;  1CWD L;  1OPL A;  4OHH A;  1A1B A;  1O4L A;  1NRV A;  2OZO A;  2H5K A;  1O45 A;  1O4B A;  1AYD A;  1O46 A;  3VS3 A;  2EO3 A;  1XA6 A;  1LUM A;  1MW4 A;  1UUR A;  2SRC A;  2EU0 A;  2MRK A;  1O4J A;  4K45 A;  5DC4 A;  1LCK A;  2DM0 A;  2Y3A B;  1O41 A;  4F59 A;  1O4A A;  2OQ1 A;  1O4D A;  4A4B A;  1O4P A;  1A81 A;  1Y1U A;  2Y1M A;  4JGH A;  2VIF A;  4GL9 E;  3GQI B;  2PNA A;  1SHD A;  1BKM A;  1GRI A;  1JYU A;  5EHP A;  3US4 A;  2H46 E;  4F5B A;  2B3O A;  1BFJ A;  3MXC A;  4NWG A;  1F2F A;  3VS1 A;  2DCR A;  3M7F A;  1A08 A;  5KAZ A;  2ABL A;  1JYR A;  2EKX A;  3VS0 A;  3GXW A;  1A1A A;  5HKZ A;  3VS4 A;  3N8M A;  1AB2 A;  1R1Q A;  4K44 A;  5GJH A;  4JE4 A;  3WA4 A;  1O4C A;  2HCK A;  4QSY A;  2IUG A;  2YU7 A;  3VS6 A;  1MIL A;  1FU5 A;  2AUG A;  2CR4 A;  1FMK A;  1O4N A;  3MAZ A;  3MXY A;  1O4K A;  5EEL A;  2QMS A;  3EAZ A;  5J3X A;  3IN7 A;  3GXX A;  5EHR A;  2CS0 A;  1M27 A;  2C0O A;  2EO6 A;  3BUN B;  1AOT F;  2Y1N A;  3VRP A;  3HCK A;  5D0J A;  1D1Z A;  2MQI A;  2MC1 A;  2HMH A;  3BKB A;  1AOU F;  1BMB A;  2CRH A;  1O44 A;  1O48 A;  3OP0 A;  5DC9 A;  5EEQ A;  4P9V A;  2ROR A;  4F5A A;  2C0I A;  2BBU A;  2JYQ A;  1D4W A;  3IN8 A;  3ZNI A;  2PNB A;  2IUI A;  1BKL A;  5IBM A;  3VRQ A;  1KA7 A;  4NWF A;  1LUI A;  4GWF A;  4A4C A;  2FO0 A;  2EYV A;  1CSZ A;  4GPL B;  1OO4 A;  3PJP A;  1QCF A;  1BG1 A;  3NHN A;  4P9Z A;  3UF4 A;  2HDX A;  2K79 B;  3PS5 A;  3QWY A;  1FHS A;  1BHF A;  2DLZ A;  5AUL A;  4K2R A;  2CI8 A;  2SHP A;  1YVH A;  2DX0 A;  1O49 A;  2LNX A;  1NZL A;  2C9W A;  1X6C A;  1O4O A;  5BO4 A;  3TKZ A;  2DVJ A;  1O42 A;  2CI9 A;  2MK2 A;  2MRJ A;  4EY0 A;  5DF6 A;  2AOA A;  1O4M A;  3C7I A;  2EOB A;  2LQN A;  3HHM B;  3QWX X;  4DGP A;  3UYO A;  2L3T A;  1BHH B;  3S8L A;  1PIC A;  5CDW A;  4FL2 A;  1OPK A;  1HCT B;  5EG3 B;  4M4Z A;  2L4K A;  2ETZ A;  1UUS A;  1WQU A;  1G83 A;  2EYY A;  3PLF B;  1RQQ C;  2GE9 A;  3EAC A;  4FL3 A;  4L1B B;  4WWQ A;  1CWE A;  2C0T A;  3BUO B;  1BLJ A;  1BHH A;  1YVL A;  1A07 A;  1RPY A;  4OHL A;  4D8K A;  3OV1 A;  5IBS A;  3N7Y A;  1H9O A;  1R1S A;  2HUW A;  5AXI A;  1JU5 A;  3S8N A;  3HIZ B;  4LUE A;  1A09 A;  3VS2 A;  1A1E A;  2IZV A;  2H8H A;  1JYQ A;  2PTK A;  1LUK A;  4H34 A;  3TL0 A;  4E93 A;  5HKY A;  2IUH A;  5DC0 B;  3VRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...