1D4TA

Crystal structure of the xlp protein sap in complex with a slam peptide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
b'MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T CELL SIGNAL TRANSDUCTION MOLECULE SAP
publication title Crystal structures of the XLP protein SAP reveal a class of SH2 domains with extended, phosphotyrosine-independent sequence recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 27
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 1999-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1d4tA00
1A81A 3S8LA 1SPRA 3TL0A 3VRYA 2LNWA 1OO3A 4E93A 4A4CA 3VRZA 1YVLA 1FBVA 4QSYA 2RMXA 2YU7A 3N7YA 4H34A 1BMBA 1LUNA 1BM2A 4U1PA 2MRKA 4F59A 1A1BA 5DC9A 1O4AA 1O4MA 2GSBA 2LNXA 1LUKA 2PNBA 1UURA 2XP1A 1NZVA 1NZLA 1KA7A 4DGPA 2MRJA 3PSJA 2MQIA 4WWQA 1FU6A 1JU5A 1QADA 2C9WA 3PS5A 2PTKA 1O4OA 5GJHA 1RQQC 3K2MA 1H9OA 3S8NA 4DGXA 1F1WA 5EHPA 3VS0A 3CWGA 1A08A 1D4TA 1BHHB 1QCFA 3BUOB 1BKMA 3QWXX 2VIFA 1SPSA 2SRCA 2ETZA 1AYAA 1O4IA 1SKJA 4X6SA 2EOBA 1KA6A 4F5AA 3BKBA 1K9AA 2L6KA 3NHNA 1BFJA 1G83A 2CR4A 2QMSA 5DC4A 1LKLA 2EYYA 3BUWB 1O4GA 2L3TA 3US4A 5IBSA 4M4ZA 2OZOA 2HCKA 1RJAA 2HDVA 1D4WA 1O44A 3N8MA 3VS7A 3PLFB 1O48A 1KC2A 3HIZB 2CBLA 3GXWA 2Y3AB 1A1AA 1SHBA 3IN8A 3VS4A 2GE9A 5CDWA 1AOUF 3UF4A 5IBMA 3CXLA 1OO4A 2PLDA 2DX0A 4ROJA 2CIAA 5DC0B 1MILA 2L4KA 1R1QA 2CI8A 2CI9A 2EYZA 1KSWA 1UUSA 1O4KA 3PFVA 1CWDL 1LCJA 1JYUA 1O43A 3GXXA 3IMJA 2CRHA 2RSYA 4L1BB 1CSYA 5EHRA 1X27A 2AUGA 4D8KA 3T04A 2DLZA 1BFIA 4FL2A 1SHAA 2LQWA 1IS0A 5I6VA 1MW4A 2DLYA 1JYQA 3BUXB 2HDXA 3KFJA 5EG3B 3VRQA 1XA6A 2IUGA 4JE4A 4FBNA 3VS3A 1TZEE 2FCIA 2K7AB 3IMDA 3MXCA 1I3ZA 1O4FA 4EY0A 1NRVA 1O4RA 3VS1A 3CD3A 3VS5A 1BG1A 3VRNA 1O4LA 4P9VA 1O4DA 1O4PA 1CJ1A 2K79B 1BHFA 1BF5A 3PQZA 5AULA 3WA4A 1CSZA 1F2FA 3S8OA 3UYOA 2AOAA 4H1OA 4A4BA 1RPYA 3EAZA 4GWFA 1FYRA 2OQ1A 3N84A 3PSKA 5D0JA 1O4CA 1Z3KA 3OV1A 1BLJA 1FHSA 2KNOA 3OP0A 3VS6A 2ECDA 3PJPA 5EELA 4JEGA 1AOTF 1O4BA 2ABLA 1HCSB 1O4EA 1X0NA 5HKZA 2Y1MA 1R1PA 2Y1NA 1BHHA 5DF6A 1A09A 2SHPA 1O4HA 4NWFA 2LQNA 3M7FA 1ZFPE 1GHUA 1QG1E 5KAZA 5J3XA 2H46E 3HCKA 2DM0A 1AD5A 3C7IA 1M61A 2HUWA 2JYQA 2RVFA 3MAZA 4EIHA 1O47A 4K45A 1AYCA 3TKZA 5EEQA 3GQIB 1A1CA 1BKLA 1FMKA 1Y57A 2C0OA 2C0TA 2PLEA 2H5KA 2KK6A 2LCTA 5GJIA 1LKKA 2PNAA 1WQUA 4E68A 4OHDA 3VGOA 2RORA 4K11A 3BUNB 1TCEA 1X6CA 1CWEA 4U17A 2MK2A 3MXYA 3VROA 3EACA 1O46A 1AB2A 3QWYA 4JGHA 1Y1UA 2H8HA 1JYRA 2EL8A 1GRIA 1PICA 1SHDA 2EO6A 3S9KA 3VRRA 4XZ0A 2EO3A 1HCTB 4GPLB 5BO4A 1O42A 3ZNIA 4OHIA 5HKYA 2MC1A 1YVHA 1IJRA 1O41A 1LUMA 4LUDA 4K2RA 1B47A 4OHLA 1D1ZA 1P13A 1FU5A 4P9ZA 1AYBA 1O4QA 2IUIA 2B3OA 1M27A 2YSXA 4XZ1A 2DCRA 3VS2A 3CBLA 4K44A 1R1SA 4LUEA 4F5BA 2EU0A 5HKWA 1O49A 1BLKA 1LUIA 3BUMB 2HMHA 2EKXA 4OHHA 1A1EA 2DVJA 1LCKA 3OB1B 4FL3A 2FO0A 2EYVA 1OPLA 1JWOA 3IN7A 1O4NA 1FBZA 3HHMB 1O45A 4OHEA 3OVEA 4TZIA 2IZVA 1O4JA 4NWGA 1A07A 3VRPA 2AOBA 3OB2B 1AYDA 5AXIA 2IUHA 2BBUA 2C0IA 2CS0A 4GL9E 1OPKA
chains in the Genus database with same CATH superfamily
1A81A 3S8LA 1SPRA 3TL0A 3VRYA 2LNWA 1OO3A 4E93A 4A4CA 3VRZA 1YVLA 1FBVA 4QSYA 2RMXA 2YU7A 3N7YA 4H34A 1BMBA 1LUNA 1BM2A 4U1PA 2MRKA 4F59A 1A1BA 5DC9A 1O4AA 1O4MA 2GSBA 2LNXA 1LUKA 2PNBA 1UURA 2XP1A 1NZVA 1NZLA 1KA7A 4DGPA 2MRJA 3PSJA 2MQIA 4WWQA 1FU6A 1JU5A 1QADA 2C9WA 3PS5A 2PTKA 1O4OA 5GJHA 1RQQC 3K2MA 1H9OA 3S8NA 4DGXA 1F1WA 5EHPA 3VS0A 3CWGA 1A08A 1D4TA 1BHHB 1QCFA 3BUOB 1BKMA 3QWXX 2VIFA 1SPSA 2SRCA 2ETZA 1AYAA 1O4IA 1SKJA 4X6SA 2EOBA 1KA6A 4F5AA 3BKBA 1K9AA 2L6KA 3NHNA 1BFJA 1G83A 2CR4A 2QMSA 5DC4A 1LKLA 2EYYA 3BUWB 1O4GA 2L3TA 3US4A 5IBSA 4M4ZA 2OZOA 2HCKA 1RJAA 2HDVA 1D4WA 1O44A 3N8MA 3VS7A 3PLFB 1O48A 1KC2A 3HIZB 2CBLA 3GXWA 2Y3AB 1A1AA 1SHBA 3IN8A 3VS4A 2GE9A 3K2TA 5CDWA 1AOUF 3UF4A 5IBMA 3CXLA 1OO4A 2PLDA 2DX0A 4ROJA 2CIAA 5DC0B 1MILA 2L4KA 1R1QA 2CI8A 2CI9A 2EYZA 1KSWA 1UUSA 1O4KA 3PFVA 1CWDL 1LCJA 1JYUA 1O43A 3GXXA 3IMJA 2CRHA 2RSYA 4L1BB 1CSYA 5EHRA 1X27A 2AUGA 4D8KA 3T04A 2DLZA 1BFIA 4FL2A 1SHAA 2LQWA 1IS0A 5I6VA 1MW4A 2DLYA 1JYQA 3BUXB 2HDXA 3KFJA 5EG3B 3VRQA 1XA6A 2IUGA 4JE4A 4FBNA 3VS3A 1TZEE 2FCIA 2K7AB 3IMDA 3MXCA 1I3ZA 1O4FA 4EY0A 1NRVA 1O4RA 3VS1A 3CD3A 3VS5A 1BG1A 3VRNA 1O4LA 4P9VA 1O4DA 1O4PA 1CJ1A 2K79B 1BHFA 1BF5A 3PQZA 5AULA 3WA4A 1CSZA 1F2FA 3S8OA 3UYOA 2AOAA 4H1OA 4A4BA 1RPYA 3EAZA 4GWFA 1FYRA 2OQ1A 3N84A 3PSKA 5D0JA 1O4CA 1Z3KA 3OV1A 1BLJA 1FHSA 2KNOA 3OP0A 3VS6A 2ECDA 3PJPA 5EELA 4JEGA 1AOTF 1O4BA 2ABLA 1HCSB 1O4EA 1X0NA 5HKZA 2Y1MA 1R1PA 2Y1NA 1BHHA 5DF6A 1A09A 2SHPA 1O4HA 4NWFA 2LQNA 3M7FA 1ZFPE 1GHUA 1QG1E 5KAZA 5J3XA 2H46E 3HCKA 2DM0A 1AD5A 3C7IA 1M61A 2HUWA 2JYQA 2RVFA 3MAZA 4EIHA 1O47A 4K45A 1AYCA 3TKZA 5EEQA 3GQIB 1A1CA 1BKLA 1FMKA 1Y57A 2C0OA 2C0TA 2PLEA 2H5KA 2KK6A 2LCTA 5GJIA 1LKKA 2PNAA 1WQUA 4E68A 4OHDA 3VGOA 2RORA 4K11A 3BUNB 1TCEA 1X6CA 1CWEA 4U17A 2MK2A 3MXYA 3VROA 3EACA 1O46A 1AB2A 3QWYA 4JGHA 3LYVA 1Y1UA 2H8HA 1JYRA 2EL8A 1GRIA 1PICA 1SHDA 2EO6A 3S9KA 3VRRA 4XZ0A 2EO3A 1HCTB 4GPLB 5BO4A 1O42A 3ZNIA 4OHIA 5HKYA 2LRAA 2MC1A 1YVHA 1IJRA 1O41A 1LUMA 4LUDA 4K2RA 1B47A 4OHLA 1D1ZA 1P13A 1FU5A 4P9ZA 1AYBA 1O4QA 2IUIA 2B3OA 1M27A 2YSXA 4XZ1A 2DCRA 3VS2A 3CBLA 4K44A 1R1SA 4LUEA 4F5BA 2EU0A 5HKWA 1O49A 1BLKA 1LUIA 3BUMB 2HMHA 2EKXA 4OHHA 1A1EA 2DVJA 1LCKA 3OB1B 4FL3A 2FO0A 2EYVA 1OPLA 1JWOA 3IN7A 1O4NA 1FBZA 3HHMB 1O45A 4OHEA 3OVEA 4TZIA 2IZVA 1O4JA 4NWGA 1A07A 3VRPA 2AOBA 3OB2B 1AYDA 5AXIA 2KGYA 2IUHA 2BBUA 2C0IA 2CS0A 4GL9E 1OPKA
chains in the Genus database with same CATH topology
1A81A 3S8LA 1SPRA 3TL0A 3VRYA 2LNWA 1OO3A 4E93A 4A4CA 3VRZA 1YVLA 1FBVA 4QSYA 2RMXA 2YU7A 3N7YA 4H34A 1BMBA 1LUNA 1BM2A 4U1PA 2MRKA 4F59A 1A1BA 5DC9A 1O4AA 1O4MA 2GSBA 2LNXA 1LUKA 2PNBA 1UURA 2XP1A 1NZVA 1NZLA 1KA7A 4DGPA 2MRJA 3PSJA 2MQIA 4WWQA 1FU6A 1JU5A 1QADA 2C9WA 3PS5A 2PTKA 1O4OA 5GJHA 1RQQC 3K2MA 1H9OA 3S8NA 4DGXA 1F1WA 5EHPA 3VS0A 3CWGA 1A08A 1D4TA 1BHHB 1QCFA 3BUOB 1BKMA 3QWXX 2VIFA 1SPSA 2SRCA 2ETZA 1AYAA 1O4IA 1SKJA 4X6SA 2EOBA 1KA6A 4F5AA 3BKBA 1K9AA 2L6KA 3NHNA 1BFJA 1G83A 2CR4A 2QMSA 5DC4A 1LKLA 2EYYA 3BUWB 1O4GA 2L3TA 3US4A 5IBSA 4M4ZA 2OZOA 2HCKA 1RJAA 2HDVA 1D4WA 1O44A 3N8MA 3VS7A 3PLFB 1O48A 1KC2A 3HIZB 2CBLA 3GXWA 2Y3AB 1A1AA 1SHBA 3IN8A 3VS4A 2GE9A 5CDWA 1AOUF 3UF4A 5IBMA 3CXLA 1OO4A 2PLDA 2DX0A 4ROJA 2CIAA 5DC0B 1MILA 2L4KA 1R1QA 2CI8A 2CI9A 2EYZA 1KSWA 1UUSA 1O4KA 3PFVA 1CWDL 1LCJA 1JYUA 1O43A 3GXXA 3IMJA 2CRHA 2RSYA 4L1BB 1CSYA 5EHRA 1X27A 2AUGA 4D8KA 3T04A 2DLZA 1BFIA 4FL2A 1SHAA 2LQWA 1IS0A 5I6VA 1MW4A 2DLYA 1JYQA 3BUXB 2HDXA 3KFJA 5EG3B 3VRQA 1XA6A 2IUGA 4JE4A 4FBNA 3VS3A 1TZEE 2FCIA 2K7AB 3IMDA 3MXCA 1I3ZA 1O4FA 4EY0A 1NRVA 1O4RA 3VS1A 3CD3A 3VS5A 1BG1A 3VRNA 1O4LA 4P9VA 1O4DA 1O4PA 1CJ1A 2K79B 1BHFA 1BF5A 3PQZA 5AULA 3WA4A 1CSZA 1F2FA 3S8OA 3UYOA 2AOAA 4H1OA 4A4BA 1RPYA 3EAZA 4GWFA 1FYRA 2OQ1A 3N84A 3PSKA 5D0JA 1O4CA 1Z3KA 3OV1A 1BLJA 1FHSA 2KNOA 3OP0A 3VS6A 2ECDA 3PJPA 5EELA 4JEGA 1AOTF 1O4BA 2ABLA 1HCSB 1O4EA 1X0NA 5HKZA 2Y1MA 1R1PA 2Y1NA 1BHHA 5DF6A 1A09A 2SHPA 1O4HA 4NWFA 2LQNA 3M7FA 1ZFPE 1GHUA 1QG1E 5KAZA 5J3XA 2H46E 3HCKA 2DM0A 1AD5A 3C7IA 1M61A 2HUWA 2JYQA 2RVFA 3MAZA 4EIHA 1O47A 4K45A 1AYCA 3TKZA 5EEQA 3GQIB 1A1CA 1BKLA 1FMKA 1Y57A 2C0OA 2C0TA 2PLEA 2H5KA 2KK6A 2LCTA 5GJIA 1LKKA 2PNAA 1WQUA 4E68A 4OHDA 3VGOA 2RORA 4K11A 3BUNB 1TCEA 1X6CA 1CWEA 4U17A 2MK2A 3MXYA 3VROA 3EACA 1O46A 1AB2A 3QWYA 4JGHA 1Y1UA 2H8HA 1JYRA 2EL8A 1GRIA 1PICA 1SHDA 2EO6A 3S9KA 3VRRA 4XZ0A 2EO3A 1HCTB 4GPLB 5BO4A 1O42A 3ZNIA 4OHIA 5HKYA 2MC1A 1YVHA 1IJRA 1O41A 1LUMA 4LUDA 4K2RA 1B47A 4OHLA 1D1ZA 1P13A 1FU5A 4P9ZA 1AYBA 1O4QA 2IUIA 2B3OA 1M27A 2YSXA 4XZ1A 2DCRA 3VS2A 3CBLA 4K44A 1R1SA 4LUEA 4F5BA 2EU0A 5HKWA 1O49A 1BLKA 1LUIA 3BUMB 2HMHA 2EKXA 4OHHA 1A1EA 2DVJA 1LCKA 3OB1B 4FL3A 2FO0A 2EYVA 1OPLA 1JWOA 3IN7A 1O4NA 1FBZA 3HHMB 1O45A 4OHEA 3OVEA 4TZIA 2IZVA 1O4JA 4NWGA 1A07A 3VRPA 2AOBA 3OB2B 1AYDA 5AXIA 2IUHA 2BBUA 2C0IA 2CS0A 4GL9E 1OPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A81 A;  3S8L A;  1SPR A;  3TL0 A;  3VRY A;  2LNW A;  1OO3 A;  4E93 A;  4A4C A;  3VRZ A;  1YVL A;  1FBV A;  4QSY A;  2RMX A;  2YU7 A;  3N7Y A;  4H34 A;  1BMB A;  1LUN A;  1BM2 A;  4U1P A;  2MRK A;  4F59 A;  1A1B A;  5DC9 A;  1O4A A;  1O4M A;  2GSB A;  2LNX A;  1LUK A;  2PNB A;  1UUR A;  2XP1 A;  1NZV A;  1NZL A;  1KA7 A;  4DGP A;  2MRJ A;  3PSJ A;  2MQI A;  4WWQ A;  1FU6 A;  1JU5 A;  1QAD A;  2C9W A;  3PS5 A;  2PTK A;  1O4O A;  5GJH A;  1RQQ C;  3K2M A;  1H9O A;  3S8N A;  4DGX A;  1F1W A;  5EHP A;  3VS0 A;  3CWG A;  1A08 A;  1D4T A;  1BHH B;  1QCF A;  3BUO B;  1BKM A;  3QWX X;  2VIF A;  1SPS A;  2SRC A;  2ETZ A;  1AYA A;  1O4I A;  1SKJ A;  4X6S A;  2EOB A;  1KA6 A;  4F5A A;  3BKB A;  1K9A A;  2L6K A;  3NHN A;  1BFJ A;  1G83 A;  2CR4 A;  2QMS A;  5DC4 A;  1LKL A;  2EYY A;  3BUW B;  1O4G A;  2L3T A;  3US4 A;  5IBS A;  4M4Z A;  2OZO A;  2HCK A;  1RJA A;  2HDV A;  1D4W A;  1O44 A;  3N8M A;  3VS7 A;  3PLF B;  1O48 A;  1KC2 A;  3HIZ B;  2CBL A;  3GXW A;  2Y3A B;  1A1A A;  1SHB A;  3IN8 A;  3VS4 A;  2GE9 A;  5CDW A;  1AOU F;  3UF4 A;  5IBM A;  3CXL A;  1OO4 A;  2PLD A;  2DX0 A;  4ROJ A;  2CIA A;  5DC0 B;  1MIL A;  2L4K A;  1R1Q A;  2CI8 A;  2CI9 A;  2EYZ A;  1KSW A;  1UUS A;  1O4K A;  3PFV A;  1CWD L;  1LCJ A;  1JYU A;  1O43 A;  3GXX A;  3IMJ A;  2CRH A;  2RSY A;  4L1B B;  1CSY A;  5EHR A;  1X27 A;  2AUG A;  4D8K A;  3T04 A;  2DLZ A;  1BFI A;  4FL2 A;  1SHA A;  2LQW A;  1IS0 A;  5I6V A;  1MW4 A;  2DLY A;  1JYQ A;  3BUX B;  2HDX A;  3KFJ A;  5EG3 B;  3VRQ A;  1XA6 A;  2IUG A;  4JE4 A;  4FBN A;  3VS3 A;  1TZE E;  2FCI A;  2K7A B;  3IMD A;  3MXC A;  1I3Z A;  1O4F A;  4EY0 A;  1NRV A;  1O4R A;  3VS1 A;  3CD3 A;  3VS5 A;  1BG1 A;  3VRN A;  1O4L A;  4P9V A;  1O4D A;  1O4P A;  1CJ1 A;  2K79 B;  1BHF A;  1BF5 A;  3PQZ A;  5AUL A;  3WA4 A;  1CSZ A;  1F2F A;  3S8O A;  3UYO A;  2AOA A;  4H1O A;  4A4B A;  1RPY A;  3EAZ A;  4GWF A;  1FYR A;  2OQ1 A;  3N84 A;  3PSK A;  5D0J A;  1O4C A;  1Z3K A;  3OV1 A;  1BLJ A;  1FHS A;  2KNO A;  3OP0 A;  3VS6 A;  2ECD A;  3PJP A;  5EEL A;  4JEG A;  1AOT F;  1O4B A;  2ABL A;  1HCS B;  1O4E A;  1X0N A;  5HKZ A;  2Y1M A;  1R1P A;  2Y1N A;  1BHH A;  5DF6 A;  1A09 A;  2SHP A;  1O4H A;  4NWF A;  2LQN A;  3M7F A;  1ZFP E;  1GHU A;  1QG1 E;  5KAZ A;  5J3X A;  2H46 E;  3HCK A;  2DM0 A;  1AD5 A;  3C7I A;  1M61 A;  2HUW A;  2JYQ A;  2RVF A;  3MAZ A;  4EIH A;  1O47 A;  4K45 A;  1AYC A;  3TKZ A;  5EEQ A;  3GQI B;  1A1C A;  1BKL A;  1FMK A;  1Y57 A;  2C0O A;  2C0T A;  2PLE A;  2H5K A;  2KK6 A;  2LCT A;  5GJI A;  1LKK A;  2PNA A;  1WQU A;  4E68 A;  4OHD A;  3VGO A;  2ROR A;  4K11 A;  3BUN B;  1TCE A;  1X6C A;  1CWE A;  4U17 A;  2MK2 A;  3MXY A;  3VRO A;  3EAC A;  1O46 A;  1AB2 A;  3QWY A;  4JGH A;  1Y1U A;  2H8H A;  1JYR A;  2EL8 A;  1GRI A;  1PIC A;  1SHD A;  2EO6 A;  3S9K A;  3VRR A;  4XZ0 A;  2EO3 A;  1HCT B;  4GPL B;  5BO4 A;  1O42 A;  3ZNI A;  4OHI A;  5HKY A;  2MC1 A;  1YVH A;  1IJR A;  1O41 A;  1LUM A;  4LUD A;  4K2R A;  1B47 A;  4OHL A;  1D1Z A;  1P13 A;  1FU5 A;  4P9Z A;  1AYB A;  1O4Q A;  2IUI A;  2B3O A;  1M27 A;  2YSX A;  4XZ1 A;  2DCR A;  3VS2 A;  3CBL A;  4K44 A;  1R1S A;  4LUE A;  4F5B A;  2EU0 A;  5HKW A;  1O49 A;  1BLK A;  1LUI A;  3BUM B;  2HMH A;  2EKX A;  4OHH A;  1A1E A;  2DVJ A;  1LCK A;  3OB1 B;  4FL3 A;  2FO0 A;  2EYV A;  1OPL A;  1JWO A;  3IN7 A;  1O4N A;  1FBZ A;  3HHM B;  1O45 A;  4OHE A;  3OVE A;  4TZI A;  2IZV A;  1O4J A;  4NWG A;  1A07 A;  3VRP A;  2AOB A;  3OB2 B;  1AYD A;  5AXI A;  2IUH A;  2BBU A;  2C0I A;  2CS0 A;  4GL9 E;  1OPK A; 
#chains in the Genus database with same CATH topology
 1A81 A;  3S8L A;  1SPR A;  3TL0 A;  3VRY A;  2LNW A;  1OO3 A;  4E93 A;  4A4C A;  3VRZ A;  1YVL A;  1FBV A;  4QSY A;  2RMX A;  2YU7 A;  3N7Y A;  4H34 A;  1BMB A;  1LUN A;  1BM2 A;  4U1P A;  2MRK A;  4F59 A;  1A1B A;  5DC9 A;  1O4A A;  1O4M A;  2GSB A;  2LNX A;  1LUK A;  2PNB A;  1UUR A;  2XP1 A;  1NZV A;  1NZL A;  1KA7 A;  4DGP A;  2MRJ A;  3PSJ A;  2MQI A;  4WWQ A;  1FU6 A;  1JU5 A;  1QAD A;  2C9W A;  3PS5 A;  2PTK A;  1O4O A;  5GJH A;  1RQQ C;  3K2M A;  1H9O A;  3S8N A;  4DGX A;  1F1W A;  5EHP A;  3VS0 A;  3CWG A;  1A08 A;  1D4T A;  1BHH B;  1QCF A;  3BUO B;  1BKM A;  3QWX X;  2VIF A;  1SPS A;  2SRC A;  2ETZ A;  1AYA A;  1O4I A;  1SKJ A;  4X6S A;  2EOB A;  1KA6 A;  4F5A A;  3BKB A;  1K9A A;  2L6K A;  3NHN A;  1BFJ A;  1G83 A;  2CR4 A;  2QMS A;  5DC4 A;  1LKL A;  2EYY A;  3BUW B;  1O4G A;  2L3T A;  3US4 A;  5IBS A;  4M4Z A;  2OZO A;  2HCK A;  1RJA A;  2HDV A;  1D4W A;  1O44 A;  3N8M A;  3VS7 A;  3PLF B;  1O48 A;  1KC2 A;  3HIZ B;  2CBL A;  3GXW A;  2Y3A B;  1A1A A;  1SHB A;  3IN8 A;  3VS4 A;  2GE9 A;  3K2T A;  5CDW A;  1AOU F;  3UF4 A;  5IBM A;  3CXL A;  1OO4 A;  2PLD A;  2DX0 A;  4ROJ A;  2CIA A;  5DC0 B;  1MIL A;  2L4K A;  1R1Q A;  2CI8 A;  2CI9 A;  2EYZ A;  1KSW A;  1UUS A;  1O4K A;  3PFV A;  1CWD L;  1LCJ A;  1JYU A;  1O43 A;  3GXX A;  3IMJ A;  2CRH A;  2RSY A;  4L1B B;  1CSY A;  5EHR A;  1X27 A;  2AUG A;  4D8K A;  3T04 A;  2DLZ A;  1BFI A;  4FL2 A;  1SHA A;  2LQW A;  1IS0 A;  5I6V A;  1MW4 A;  2DLY A;  1JYQ A;  3BUX B;  2HDX A;  3KFJ A;  5EG3 B;  3VRQ A;  1XA6 A;  2IUG A;  4JE4 A;  4FBN A;  3VS3 A;  1TZE E;  2FCI A;  2K7A B;  3IMD A;  3MXC A;  1I3Z A;  1O4F A;  4EY0 A;  1NRV A;  1O4R A;  3VS1 A;  3CD3 A;  3VS5 A;  1BG1 A;  3VRN A;  1O4L A;  4P9V A;  1O4D A;  1O4P A;  1CJ1 A;  2K79 B;  1BHF A;  1BF5 A;  3PQZ A;  5AUL A;  3WA4 A;  1CSZ A;  1F2F A;  3S8O A;  3UYO A;  2AOA A;  4H1O A;  4A4B A;  1RPY A;  3EAZ A;  4GWF A;  1FYR A;  2OQ1 A;  3N84 A;  3PSK A;  5D0J A;  1O4C A;  1Z3K A;  3OV1 A;  1BLJ A;  1FHS A;  2KNO A;  3OP0 A;  3VS6 A;  2ECD A;  3PJP A;  5EEL A;  4JEG A;  1AOT F;  1O4B A;  2ABL A;  1HCS B;  1O4E A;  1X0N A;  5HKZ A;  2Y1M A;  1R1P A;  2Y1N A;  1BHH A;  5DF6 A;  1A09 A;  2SHP A;  1O4H A;  4NWF A;  2LQN A;  3M7F A;  1ZFP E;  1GHU A;  1QG1 E;  5KAZ A;  5J3X A;  2H46 E;  3HCK A;  2DM0 A;  1AD5 A;  3C7I A;  1M61 A;  2HUW A;  2JYQ A;  2RVF A;  3MAZ A;  4EIH A;  1O47 A;  4K45 A;  1AYC A;  3TKZ A;  5EEQ A;  3GQI B;  1A1C A;  1BKL A;  1FMK A;  1Y57 A;  2C0O A;  2C0T A;  2PLE A;  2H5K A;  2KK6 A;  2LCT A;  5GJI A;  1LKK A;  2PNA A;  1WQU A;  4E68 A;  4OHD A;  3VGO A;  2ROR A;  4K11 A;  3BUN B;  1TCE A;  1X6C A;  1CWE A;  4U17 A;  2MK2 A;  3MXY A;  3VRO A;  3EAC A;  1O46 A;  1AB2 A;  3QWY A;  4JGH A;  3LYV A;  1Y1U A;  2H8H A;  1JYR A;  2EL8 A;  1GRI A;  1PIC A;  1SHD A;  2EO6 A;  3S9K A;  3VRR A;  4XZ0 A;  2EO3 A;  1HCT B;  4GPL B;  5BO4 A;  1O42 A;  3ZNI A;  4OHI A;  5HKY A;  2LRA A;  2MC1 A;  1YVH A;  1IJR A;  1O41 A;  1LUM A;  4LUD A;  4K2R A;  1B47 A;  4OHL A;  1D1Z A;  1P13 A;  1FU5 A;  4P9Z A;  1AYB A;  1O4Q A;  2IUI A;  2B3O A;  1M27 A;  2YSX A;  4XZ1 A;  2DCR A;  3VS2 A;  3CBL A;  4K44 A;  1R1S A;  4LUE A;  4F5B A;  2EU0 A;  5HKW A;  1O49 A;  1BLK A;  1LUI A;  3BUM B;  2HMH A;  2EKX A;  4OHH A;  1A1E A;  2DVJ A;  1LCK A;  3OB1 B;  4FL3 A;  2FO0 A;  2EYV A;  1OPL A;  1JWO A;  3IN7 A;  1O4N A;  1FBZ A;  3HHM B;  1O45 A;  4OHE A;  3OVE A;  4TZI A;  2IZV A;  1O4J A;  4NWG A;  1A07 A;  3VRP A;  2AOB A;  3OB2 B;  1AYD A;  5AXI A;  2KGY A;  2IUH A;  2BBU A;  2C0I A;  2CS0 A;  4GL9 E;  1OPK A; 
#chains in the Genus database with same CATH homology
 1A81 A;  3S8L A;  1SPR A;  3TL0 A;  3VRY A;  2LNW A;  1OO3 A;  4E93 A;  4A4C A;  3VRZ A;  1YVL A;  1FBV A;  4QSY A;  2RMX A;  2YU7 A;  3N7Y A;  4H34 A;  1BMB A;  1LUN A;  1BM2 A;  4U1P A;  2MRK A;  4F59 A;  1A1B A;  5DC9 A;  1O4A A;  1O4M A;  2GSB A;  2LNX A;  1LUK A;  2PNB A;  1UUR A;  2XP1 A;  1NZV A;  1NZL A;  1KA7 A;  4DGP A;  2MRJ A;  3PSJ A;  2MQI A;  4WWQ A;  1FU6 A;  1JU5 A;  1QAD A;  2C9W A;  3PS5 A;  2PTK A;  1O4O A;  5GJH A;  1RQQ C;  3K2M A;  1H9O A;  3S8N A;  4DGX A;  1F1W A;  5EHP A;  3VS0 A;  3CWG A;  1A08 A;  1D4T A;  1BHH B;  1QCF A;  3BUO B;  1BKM A;  3QWX X;  2VIF A;  1SPS A;  2SRC A;  2ETZ A;  1AYA A;  1O4I A;  1SKJ A;  4X6S A;  2EOB A;  1KA6 A;  4F5A A;  3BKB A;  1K9A A;  2L6K A;  3NHN A;  1BFJ A;  1G83 A;  2CR4 A;  2QMS A;  5DC4 A;  1LKL A;  2EYY A;  3BUW B;  1O4G A;  2L3T A;  3US4 A;  5IBS A;  4M4Z A;  2OZO A;  2HCK A;  1RJA A;  2HDV A;  1D4W A;  1O44 A;  3N8M A;  3VS7 A;  3PLF B;  1O48 A;  1KC2 A;  3HIZ B;  2CBL A;  3GXW A;  2Y3A B;  1A1A A;  1SHB A;  3IN8 A;  3VS4 A;  2GE9 A;  5CDW A;  1AOU F;  3UF4 A;  5IBM A;  3CXL A;  1OO4 A;  2PLD A;  2DX0 A;  4ROJ A;  2CIA A;  5DC0 B;  1MIL A;  2L4K A;  1R1Q A;  2CI8 A;  2CI9 A;  2EYZ A;  1KSW A;  1UUS A;  1O4K A;  3PFV A;  1CWD L;  1LCJ A;  1JYU A;  1O43 A;  3GXX A;  3IMJ A;  2CRH A;  2RSY A;  4L1B B;  1CSY A;  5EHR A;  1X27 A;  2AUG A;  4D8K A;  3T04 A;  2DLZ A;  1BFI A;  4FL2 A;  1SHA A;  2LQW A;  1IS0 A;  5I6V A;  1MW4 A;  2DLY A;  1JYQ A;  3BUX B;  2HDX A;  3KFJ A;  5EG3 B;  3VRQ A;  1XA6 A;  2IUG A;  4JE4 A;  4FBN A;  3VS3 A;  1TZE E;  2FCI A;  2K7A B;  3IMD A;  3MXC A;  1I3Z A;  1O4F A;  4EY0 A;  1NRV A;  1O4R A;  3VS1 A;  3CD3 A;  3VS5 A;  1BG1 A;  3VRN A;  1O4L A;  4P9V A;  1O4D A;  1O4P A;  1CJ1 A;  2K79 B;  1BHF A;  1BF5 A;  3PQZ A;  5AUL A;  3WA4 A;  1CSZ A;  1F2F A;  3S8O A;  3UYO A;  2AOA A;  4H1O A;  4A4B A;  1RPY A;  3EAZ A;  4GWF A;  1FYR A;  2OQ1 A;  3N84 A;  3PSK A;  5D0J A;  1O4C A;  1Z3K A;  3OV1 A;  1BLJ A;  1FHS A;  2KNO A;  3OP0 A;  3VS6 A;  2ECD A;  3PJP A;  5EEL A;  4JEG A;  1AOT F;  1O4B A;  2ABL A;  1HCS B;  1O4E A;  1X0N A;  5HKZ A;  2Y1M A;  1R1P A;  2Y1N A;  1BHH A;  5DF6 A;  1A09 A;  2SHP A;  1O4H A;  4NWF A;  2LQN A;  3M7F A;  1ZFP E;  1GHU A;  1QG1 E;  5KAZ A;  5J3X A;  2H46 E;  3HCK A;  2DM0 A;  1AD5 A;  3C7I A;  1M61 A;  2HUW A;  2JYQ A;  2RVF A;  3MAZ A;  4EIH A;  1O47 A;  4K45 A;  1AYC A;  3TKZ A;  5EEQ A;  3GQI B;  1A1C A;  1BKL A;  1FMK A;  1Y57 A;  2C0O A;  2C0T A;  2PLE A;  2H5K A;  2KK6 A;  2LCT A;  5GJI A;  1LKK A;  2PNA A;  1WQU A;  4E68 A;  4OHD A;  3VGO A;  2ROR A;  4K11 A;  3BUN B;  1TCE A;  1X6C A;  1CWE A;  4U17 A;  2MK2 A;  3MXY A;  3VRO A;  3EAC A;  1O46 A;  1AB2 A;  3QWY A;  4JGH A;  1Y1U A;  2H8H A;  1JYR A;  2EL8 A;  1GRI A;  1PIC A;  1SHD A;  2EO6 A;  3S9K A;  3VRR A;  4XZ0 A;  2EO3 A;  1HCT B;  4GPL B;  5BO4 A;  1O42 A;  3ZNI A;  4OHI A;  5HKY A;  2MC1 A;  1YVH A;  1IJR A;  1O41 A;  1LUM A;  4LUD A;  4K2R A;  1B47 A;  4OHL A;  1D1Z A;  1P13 A;  1FU5 A;  4P9Z A;  1AYB A;  1O4Q A;  2IUI A;  2B3O A;  1M27 A;  2YSX A;  4XZ1 A;  2DCR A;  3VS2 A;  3CBL A;  4K44 A;  1R1S A;  4LUE A;  4F5B A;  2EU0 A;  5HKW A;  1O49 A;  1BLK A;  1LUI A;  3BUM B;  2HMH A;  2EKX A;  4OHH A;  1A1E A;  2DVJ A;  1LCK A;  3OB1 B;  4FL3 A;  2FO0 A;  2EYV A;  1OPL A;  1JWO A;  3IN7 A;  1O4N A;  1FBZ A;  3HHM B;  1O45 A;  4OHE A;  3OVE A;  4TZI A;  2IZV A;  1O4J A;  4NWG A;  1A07 A;  3VRP A;  2AOB A;  3OB2 B;  1AYD A;  5AXI A;  2IUH A;  2BBU A;  2C0I A;  2CS0 A;  4GL9 E;  1OPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...