1AYCA

Crystal structures of peptide complexes of the amino-terminal sh2 domain of the syp tyrosine phosphatase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
100
structure length
100
Chain Sequence
b'RRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN-TYROSINE PHOSPHATASE SYP (N-TERMINAL SH2 DOMAIN)
publication title Crystal structures of peptide complexes of the amino-terminal SH2 domain of the Syp tyrosine phosphatase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase(sh2 domain)
total genus 23
structure length 100
sequence length 100
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 1994-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1aycA00
1CWEA 1LCJA 1BFJA 1JU5A 3KFJA 4H34A 1SHDA 2DX0A 5DC9A 3VS4A 2EL8A 1O46A 2H46E 3OV1A 3IN7A 1D1ZA 1O4NA 3MAZA 1OO3A 2C0IA 1TZEE 1UUSA 2QMSA 1AYCA 2C9WA 3IMJA 2ABLA 1FU6A 2EOBA 1RQQC 5EHPA 1O4QA 1R1PA 2VIFA 3PFVA 4L1BB 4OHDA 1R1QA 1QADA 3CWGA 2AUGA 1D4TA 1A81A 2HDXA 5HKYA 1FYRA 3IN8A 2CI9A 1O4IA 1O4GA 1LKLA 2CBLA 4JEGA 1AOTF 1O4PA 1F1WA 1Y57A 4JGHA 4A4BA 1CSZA 2L6KA 3MXCA 1BMBA 2EU0A 2C0OA 1BHFA 2PNAA 3M7FA 4DGPA 4QSYA 1O4RA 1M61A 1O42A 1OPKA 3VS6A 5I6VA 5AULA 3OP0A 1IS0A 3VRPA 2KK6A 1Y1UA 1O4MA 5EELA 1TCEA 2PLEA 4EY0A 3CD3A 1LKKA 3ZNIA 2IUHA 3OB2B 1LUIA 5HKWA 3UF4A 1O4LA 1FBZA 4P9ZA 3VS0A 1A08A 1A1EA 2YU7A 4K44A 1Z3KA 3HIZB 1M27A 1BKMA 5IBMA 1A1CA 4D8KA 4U1PA 2EYZA 1OPLA 4JE4A 3N7YA 3VGOA 3VRYA 4OHHA 1SHAA 3PQZA 3VS5A 1YVHA 2ECDA 2RORA 1OO4A 5GJHA 2OZOA 1SKJA 2HMHA 4OHLA 2SHPA 1YVLA 3OVEA 2FCIA 3BUWB 1AYDA 1K9AA 1QG1E 3N8MA 1O4BA 5EG3B 1IJRA 2CR4A 4F5BA 1WQUA 1R1SA 1CWDL 1BFIA 1X6CA 3GXWA 2BBUA 1P13A 1AYAA 1O4OA 2IUGA 2EO6A 2LQWA 3VRRA 2LNWA 3EAZA 2ETZA 1CJ1A 1D4WA 2B3OA 2HUWA 2GSBA 3PJPA 1LUMA 2LCTA 3PS5A 1AYBA 3UYOA 1O4KA 4E68A 1NRVA 1G83A 4H1OA 1KC2A 3VS3A 2GE9A 4F5AA 1BM2A 3GXXA 4E93A 1B47A 3MXYA 2SRCA 1RJAA 3VS7A 1JYRA 1BHHB 1JWOA 1A1BA 1SHBA 2DCRA 4GPLB 3CXLA 5GJIA 1F2FA 1GRIA 2IUIA 1BG1A 5IBSA 4F59A 1XA6A 3NHNA 5D0JA 1MW4A 1ZFPE 2HCKA 5DC0B 5EHRA 1O4AA 3OB1B 1HCTB 1O4CA 2K7AB 2HDVA 2LQNA 1KA7A 4U17A 3US4A 2H5KA 2LNXA 3CBLA 2Y1NA 3K2MA 5BO4A 4DGXA 5CDWA 1FU5A 1NZLA 3TKZA 3VRZA 4XZ1A 5KAZA 2CI8A 4K2RA 2EYYA 3GQIB 1O4DA 4M4ZA 4NWFA 2C0TA 3IMDA 1HCSB 3PSKA 1FBVA 1JYQA 3EACA 3HHMB 2MRJA 1O47A 1GHUA 2AOBA 1KA6A 1PICA 2Y1MA 1UURA 1BHHA 1AOUF 2EYVA 1KSWA 2CIAA 1O45A 4EIHA 4GWFA 4FL3A 3VS2A 3QWYA 1O4HA 2EO3A 2YSXA 1AD5A 2PTKA 4A4CA 1LUKA 4ROJA 2XP1A 3VRQA 1BKLA 1O4FA 4XZ0A 4K45A 5DC4A 2CS0A 3BUMB 2DLZA 5AXIA 1H9OA 5EEQA 1BLJA 3T04A 2PNBA 1LUNA 2MQIA 3S8NA 1RPYA 2EKXA 2DM0A 2DLYA 4GL9E 3QWXX 3VRNA 4LUEA 5J3XA 1QCFA 4P9VA 2AOAA 1NZVA 4NWGA 3WA4A 2Y3AB 1O41A 1O43A 2KNOA 4LUDA 1O44A 1FMKA 2MC1A 4WWQA 2PLDA 3S8OA 3S9KA 2MRKA 2DVJA 1O49A 1CSYA 2RSYA 3TL0A 2L3TA 1BF5A 1SPSA 4X6SA 1MILA 4TZIA 3N84A 2CRHA 3BKBA 1A07A 2MK2A 3BUXB 1LCKA 2K79B 2RVFA 1FHSA 1A09A 4OHIA 1O4EA 1O48A 1SPRA 3C7IA 1BLKA 3VS1A 2JYQA 1AB2A 1A1AA 2IZVA 2RMXA 5HKZA 1X27A 4FL2A 4FBNA 3BUOB 3BUNB 4OHEA 1X0NA 1I3ZA 1O4JA 4K11A 3VROA 2FO0A 2H8HA 3PLFB 3PSJA 2OQ1A 3S8LA 2L4KA 5DF6A 1JYUA 3HCKA
chains in the Genus database with same CATH superfamily
1CWEA 1LCJA 1BFJA 1JU5A 3KFJA 4H34A 1SHDA 2DX0A 5DC9A 3VS4A 2EL8A 1O46A 2H46E 3OV1A 3IN7A 1D1ZA 1O4NA 3MAZA 1OO3A 2C0IA 1TZEE 1UUSA 2QMSA 1AYCA 2C9WA 3IMJA 2ABLA 1FU6A 2EOBA 1RQQC 5EHPA 1O4QA 1R1PA 2VIFA 3PFVA 4L1BB 4OHDA 1R1QA 1QADA 3CWGA 2AUGA 1D4TA 1A81A 2HDXA 5HKYA 1FYRA 3IN8A 2CI9A 1O4IA 1O4GA 1LKLA 2CBLA 4JEGA 1AOTF 1O4PA 1F1WA 1Y57A 3LYVA 4JGHA 4A4BA 1CSZA 2L6KA 3MXCA 1BMBA 2EU0A 2C0OA 1BHFA 2PNAA 3M7FA 4DGPA 4QSYA 1O4RA 1M61A 1O42A 1OPKA 3VS6A 5I6VA 5AULA 3OP0A 1IS0A 3VRPA 2KK6A 1Y1UA 1O4MA 5EELA 1TCEA 2PLEA 4EY0A 3CD3A 1LKKA 3ZNIA 2IUHA 3OB2B 1LUIA 5HKWA 3UF4A 1O4LA 1FBZA 4P9ZA 3VS0A 3K2TA 1A08A 1A1EA 2YU7A 4K44A 1Z3KA 3HIZB 1M27A 1BKMA 5IBMA 1A1CA 4D8KA 4U1PA 2EYZA 1OPLA 4JE4A 3N7YA 3VGOA 3VRYA 4OHHA 1SHAA 3PQZA 3VS5A 1YVHA 2ECDA 2RORA 1OO4A 5GJHA 2OZOA 1SKJA 2HMHA 4OHLA 2SHPA 1YVLA 3OVEA 2FCIA 3BUWB 1AYDA 1K9AA 1QG1E 3N8MA 1O4BA 5EG3B 1IJRA 2CR4A 4F5BA 1WQUA 1R1SA 1CWDL 1BFIA 1X6CA 3GXWA 2BBUA 1P13A 1AYAA 1O4OA 2IUGA 2EO6A 2LQWA 3VRRA 2LNWA 3EAZA 2ETZA 1CJ1A 1D4WA 2B3OA 2HUWA 2GSBA 3PJPA 1LUMA 2LCTA 3PS5A 1AYBA 3UYOA 1O4KA 4E68A 1NRVA 1G83A 4H1OA 1KC2A 3VS3A 2GE9A 4F5AA 1BM2A 3GXXA 4E93A 1B47A 3MXYA 2SRCA 1RJAA 3VS7A 1JYRA 1BHHB 1JWOA 1A1BA 1SHBA 2DCRA 4GPLB 3CXLA 5GJIA 1F2FA 1GRIA 2IUIA 1BG1A 5IBSA 4F59A 1XA6A 3NHNA 5D0JA 1MW4A 1ZFPE 2HCKA 5DC0B 5EHRA 1O4AA 3OB1B 1HCTB 1O4CA 2K7AB 2HDVA 2LQNA 1KA7A 4U17A 3US4A 2H5KA 2LNXA 3CBLA 2Y1NA 3K2MA 5BO4A 4DGXA 5CDWA 1FU5A 1NZLA 3TKZA 3VRZA 4XZ1A 5KAZA 2KGYA 2CI8A 4K2RA 2EYYA 3GQIB 1O4DA 4M4ZA 4NWFA 2C0TA 3IMDA 1HCSB 3PSKA 1FBVA 1JYQA 3EACA 3HHMB 2MRJA 2LRAA 1O47A 1GHUA 2AOBA 1KA6A 1PICA 2Y1MA 1UURA 1BHHA 1AOUF 2EYVA 1KSWA 2CIAA 1O45A 4EIHA 4GWFA 4FL3A 3VS2A 3QWYA 1O4HA 2EO3A 2YSXA 1AD5A 2PTKA 4A4CA 1LUKA 4ROJA 2XP1A 3VRQA 1BKLA 1O4FA 4XZ0A 4K45A 5DC4A 2CS0A 3BUMB 2DLZA 5AXIA 1H9OA 5EEQA 1BLJA 3T04A 2PNBA 1LUNA 2MQIA 3S8NA 1RPYA 2EKXA 2DM0A 2DLYA 4GL9E 3QWXX 3VRNA 4LUEA 5J3XA 1QCFA 4P9VA 2AOAA 1NZVA 4NWGA 3WA4A 2Y3AB 1O41A 1O43A 2KNOA 4LUDA 1O44A 1FMKA 2MC1A 4WWQA 2PLDA 3S8OA 3S9KA 2MRKA 2DVJA 1O49A 1CSYA 2RSYA 3TL0A 2L3TA 1BF5A 1SPSA 4X6SA 1MILA 4TZIA 3N84A 2CRHA 3BKBA 1A07A 2MK2A 3BUXB 1LCKA 2K79B 2RVFA 1FHSA 1A09A 4OHIA 1O4EA 1O48A 1SPRA 3C7IA 1BLKA 3VS1A 2JYQA 1AB2A 1A1AA 2IZVA 2RMXA 5HKZA 1X27A 4FL2A 4FBNA 3BUOB 3BUNB 4OHEA 1X0NA 1I3ZA 1O4JA 4K11A 3VROA 2FO0A 2H8HA 3PLFB 3PSJA 2OQ1A 3S8LA 2L4KA 5DF6A 1JYUA 3HCKA
chains in the Genus database with same CATH topology
1CWEA 1LCJA 1BFJA 1JU5A 3KFJA 4H34A 1SHDA 2DX0A 5DC9A 3VS4A 2EL8A 1O46A 2H46E 3OV1A 3IN7A 1D1ZA 1O4NA 3MAZA 1OO3A 2C0IA 1TZEE 1UUSA 2QMSA 1AYCA 2C9WA 3IMJA 2ABLA 1FU6A 2EOBA 1RQQC 5EHPA 1O4QA 1R1PA 2VIFA 3PFVA 4L1BB 4OHDA 1R1QA 1QADA 3CWGA 2AUGA 1D4TA 1A81A 2HDXA 5HKYA 1FYRA 3IN8A 2CI9A 1O4IA 1O4GA 1LKLA 2CBLA 4JEGA 1AOTF 1O4PA 1F1WA 1Y57A 4JGHA 4A4BA 1CSZA 2L6KA 3MXCA 1BMBA 2EU0A 2C0OA 1BHFA 2PNAA 3M7FA 4DGPA 4QSYA 1O4RA 1M61A 1O42A 1OPKA 3VS6A 5I6VA 5AULA 3OP0A 1IS0A 3VRPA 2KK6A 1Y1UA 1O4MA 5EELA 1TCEA 2PLEA 4EY0A 3CD3A 1LKKA 3ZNIA 2IUHA 3OB2B 1LUIA 5HKWA 3UF4A 1O4LA 1FBZA 4P9ZA 3VS0A 1A08A 1A1EA 2YU7A 4K44A 1Z3KA 3HIZB 1M27A 1BKMA 5IBMA 1A1CA 4D8KA 4U1PA 2EYZA 1OPLA 4JE4A 3N7YA 3VGOA 3VRYA 4OHHA 1SHAA 3PQZA 3VS5A 1YVHA 2ECDA 2RORA 1OO4A 5GJHA 2OZOA 1SKJA 2HMHA 4OHLA 2SHPA 1YVLA 3OVEA 2FCIA 3BUWB 1AYDA 1K9AA 1QG1E 3N8MA 1O4BA 5EG3B 1IJRA 2CR4A 4F5BA 1WQUA 1R1SA 1CWDL 1BFIA 1X6CA 3GXWA 2BBUA 1P13A 1AYAA 1O4OA 2IUGA 2EO6A 2LQWA 3VRRA 2LNWA 3EAZA 2ETZA 1CJ1A 1D4WA 2B3OA 2HUWA 2GSBA 3PJPA 1LUMA 2LCTA 3PS5A 1AYBA 3UYOA 1O4KA 4E68A 1NRVA 1G83A 4H1OA 1KC2A 3VS3A 2GE9A 4F5AA 1BM2A 3GXXA 4E93A 1B47A 3MXYA 2SRCA 1RJAA 3VS7A 1JYRA 1BHHB 1JWOA 1A1BA 1SHBA 2DCRA 4GPLB 3CXLA 5GJIA 1F2FA 1GRIA 2IUIA 1BG1A 5IBSA 4F59A 1XA6A 3NHNA 5D0JA 1MW4A 1ZFPE 2HCKA 5DC0B 5EHRA 1O4AA 3OB1B 1HCTB 1O4CA 2K7AB 2HDVA 2LQNA 1KA7A 4U17A 3US4A 2H5KA 2LNXA 3CBLA 2Y1NA 3K2MA 5BO4A 4DGXA 5CDWA 1FU5A 1NZLA 3TKZA 3VRZA 4XZ1A 5KAZA 2CI8A 4K2RA 2EYYA 3GQIB 1O4DA 4M4ZA 4NWFA 2C0TA 3IMDA 1HCSB 3PSKA 1FBVA 1JYQA 3EACA 3HHMB 2MRJA 1O47A 1GHUA 2AOBA 1KA6A 1PICA 2Y1MA 1UURA 1BHHA 1AOUF 2EYVA 1KSWA 2CIAA 1O45A 4EIHA 4GWFA 4FL3A 3VS2A 3QWYA 1O4HA 2EO3A 2YSXA 1AD5A 2PTKA 4A4CA 1LUKA 4ROJA 2XP1A 3VRQA 1BKLA 1O4FA 4XZ0A 4K45A 5DC4A 2CS0A 3BUMB 2DLZA 5AXIA 1H9OA 5EEQA 1BLJA 3T04A 2PNBA 1LUNA 2MQIA 3S8NA 1RPYA 2EKXA 2DM0A 2DLYA 4GL9E 3QWXX 3VRNA 4LUEA 5J3XA 1QCFA 4P9VA 2AOAA 1NZVA 4NWGA 3WA4A 2Y3AB 1O41A 1O43A 2KNOA 4LUDA 1O44A 1FMKA 2MC1A 4WWQA 2PLDA 3S8OA 3S9KA 2MRKA 2DVJA 1O49A 1CSYA 2RSYA 3TL0A 2L3TA 1BF5A 1SPSA 4X6SA 1MILA 4TZIA 3N84A 2CRHA 3BKBA 1A07A 2MK2A 3BUXB 1LCKA 2K79B 2RVFA 1FHSA 1A09A 4OHIA 1O4EA 1O48A 1SPRA 3C7IA 1BLKA 3VS1A 2JYQA 1AB2A 1A1AA 2IZVA 2RMXA 5HKZA 1X27A 4FL2A 4FBNA 3BUOB 3BUNB 4OHEA 1X0NA 1I3ZA 1O4JA 4K11A 3VROA 2FO0A 2H8HA 3PLFB 3PSJA 2OQ1A 3S8LA 2L4KA 5DF6A 1JYUA 3HCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CWE A;  1LCJ A;  1BFJ A;  1JU5 A;  3KFJ A;  4H34 A;  1SHD A;  2DX0 A;  5DC9 A;  3VS4 A;  2EL8 A;  1O46 A;  2H46 E;  3OV1 A;  3IN7 A;  1D1Z A;  1O4N A;  3MAZ A;  1OO3 A;  2C0I A;  1TZE E;  1UUS A;  2QMS A;  1AYC A;  2C9W A;  3IMJ A;  2ABL A;  1FU6 A;  2EOB A;  1RQQ C;  5EHP A;  1O4Q A;  1R1P A;  2VIF A;  3PFV A;  4L1B B;  4OHD A;  1R1Q A;  1QAD A;  3CWG A;  2AUG A;  1D4T A;  1A81 A;  2HDX A;  5HKY A;  1FYR A;  3IN8 A;  2CI9 A;  1O4I A;  1O4G A;  1LKL A;  2CBL A;  4JEG A;  1AOT F;  1O4P A;  1F1W A;  1Y57 A;  4JGH A;  4A4B A;  1CSZ A;  2L6K A;  3MXC A;  1BMB A;  2EU0 A;  2C0O A;  1BHF A;  2PNA A;  3M7F A;  4DGP A;  4QSY A;  1O4R A;  1M61 A;  1O42 A;  1OPK A;  3VS6 A;  5I6V A;  5AUL A;  3OP0 A;  1IS0 A;  3VRP A;  2KK6 A;  1Y1U A;  1O4M A;  5EEL A;  1TCE A;  2PLE A;  4EY0 A;  3CD3 A;  1LKK A;  3ZNI A;  2IUH A;  3OB2 B;  1LUI A;  5HKW A;  3UF4 A;  1O4L A;  1FBZ A;  4P9Z A;  3VS0 A;  1A08 A;  1A1E A;  2YU7 A;  4K44 A;  1Z3K A;  3HIZ B;  1M27 A;  1BKM A;  5IBM A;  1A1C A;  4D8K A;  4U1P A;  2EYZ A;  1OPL A;  4JE4 A;  3N7Y A;  3VGO A;  3VRY A;  4OHH A;  1SHA A;  3PQZ A;  3VS5 A;  1YVH A;  2ECD A;  2ROR A;  1OO4 A;  5GJH A;  2OZO A;  1SKJ A;  2HMH A;  4OHL A;  2SHP A;  1YVL A;  3OVE A;  2FCI A;  3BUW B;  1AYD A;  1K9A A;  1QG1 E;  3N8M A;  1O4B A;  5EG3 B;  1IJR A;  2CR4 A;  4F5B A;  1WQU A;  1R1S A;  1CWD L;  1BFI A;  1X6C A;  3GXW A;  2BBU A;  1P13 A;  1AYA A;  1O4O A;  2IUG A;  2EO6 A;  2LQW A;  3VRR A;  2LNW A;  3EAZ A;  2ETZ A;  1CJ1 A;  1D4W A;  2B3O A;  2HUW A;  2GSB A;  3PJP A;  1LUM A;  2LCT A;  3PS5 A;  1AYB A;  3UYO A;  1O4K A;  4E68 A;  1NRV A;  1G83 A;  4H1O A;  1KC2 A;  3VS3 A;  2GE9 A;  4F5A A;  1BM2 A;  3GXX A;  4E93 A;  1B47 A;  3MXY A;  2SRC A;  1RJA A;  3VS7 A;  1JYR A;  1BHH B;  1JWO A;  1A1B A;  1SHB A;  2DCR A;  4GPL B;  3CXL A;  5GJI A;  1F2F A;  1GRI A;  2IUI A;  1BG1 A;  5IBS A;  4F59 A;  1XA6 A;  3NHN A;  5D0J A;  1MW4 A;  1ZFP E;  2HCK A;  5DC0 B;  5EHR A;  1O4A A;  3OB1 B;  1HCT B;  1O4C A;  2K7A B;  2HDV A;  2LQN A;  1KA7 A;  4U17 A;  3US4 A;  2H5K A;  2LNX A;  3CBL A;  2Y1N A;  3K2M A;  5BO4 A;  4DGX A;  5CDW A;  1FU5 A;  1NZL A;  3TKZ A;  3VRZ A;  4XZ1 A;  5KAZ A;  2CI8 A;  4K2R A;  2EYY A;  3GQI B;  1O4D A;  4M4Z A;  4NWF A;  2C0T A;  3IMD A;  1HCS B;  3PSK A;  1FBV A;  1JYQ A;  3EAC A;  3HHM B;  2MRJ A;  1O47 A;  1GHU A;  2AOB A;  1KA6 A;  1PIC A;  2Y1M A;  1UUR A;  1BHH A;  1AOU F;  2EYV A;  1KSW A;  2CIA A;  1O45 A;  4EIH A;  4GWF A;  4FL3 A;  3VS2 A;  3QWY A;  1O4H A;  2EO3 A;  2YSX A;  1AD5 A;  2PTK A;  4A4C A;  1LUK A;  4ROJ A;  2XP1 A;  3VRQ A;  1BKL A;  1O4F A;  4XZ0 A;  4K45 A;  5DC4 A;  2CS0 A;  3BUM B;  2DLZ A;  5AXI A;  1H9O A;  5EEQ A;  1BLJ A;  3T04 A;  2PNB A;  1LUN A;  2MQI A;  3S8N A;  1RPY A;  2EKX A;  2DM0 A;  2DLY A;  4GL9 E;  3QWX X;  3VRN A;  4LUE A;  5J3X A;  1QCF A;  4P9V A;  2AOA A;  1NZV A;  4NWG A;  3WA4 A;  2Y3A B;  1O41 A;  1O43 A;  2KNO A;  4LUD A;  1O44 A;  1FMK A;  2MC1 A;  4WWQ A;  2PLD A;  3S8O A;  3S9K A;  2MRK A;  2DVJ A;  1O49 A;  1CSY A;  2RSY A;  3TL0 A;  2L3T A;  1BF5 A;  1SPS A;  4X6S A;  1MIL A;  4TZI A;  3N84 A;  2CRH A;  3BKB A;  1A07 A;  2MK2 A;  3BUX B;  1LCK A;  2K79 B;  2RVF A;  1FHS A;  1A09 A;  4OHI A;  1O4E A;  1O48 A;  1SPR A;  3C7I A;  1BLK A;  3VS1 A;  2JYQ A;  1AB2 A;  1A1A A;  2IZV A;  2RMX A;  5HKZ A;  1X27 A;  4FL2 A;  4FBN A;  3BUO B;  3BUN B;  4OHE A;  1X0N A;  1I3Z A;  1O4J A;  4K11 A;  3VRO A;  2FO0 A;  2H8H A;  3PLF B;  3PSJ A;  2OQ1 A;  3S8L A;  2L4K A;  5DF6 A;  1JYU A;  3HCK A; 
#chains in the Genus database with same CATH topology
 1CWE A;  1LCJ A;  1BFJ A;  1JU5 A;  3KFJ A;  4H34 A;  1SHD A;  2DX0 A;  5DC9 A;  3VS4 A;  2EL8 A;  1O46 A;  2H46 E;  3OV1 A;  3IN7 A;  1D1Z A;  1O4N A;  3MAZ A;  1OO3 A;  2C0I A;  1TZE E;  1UUS A;  2QMS A;  1AYC A;  2C9W A;  3IMJ A;  2ABL A;  1FU6 A;  2EOB A;  1RQQ C;  5EHP A;  1O4Q A;  1R1P A;  2VIF A;  3PFV A;  4L1B B;  4OHD A;  1R1Q A;  1QAD A;  3CWG A;  2AUG A;  1D4T A;  1A81 A;  2HDX A;  5HKY A;  1FYR A;  3IN8 A;  2CI9 A;  1O4I A;  1O4G A;  1LKL A;  2CBL A;  4JEG A;  1AOT F;  1O4P A;  1F1W A;  1Y57 A;  3LYV A;  4JGH A;  4A4B A;  1CSZ A;  2L6K A;  3MXC A;  1BMB A;  2EU0 A;  2C0O A;  1BHF A;  2PNA A;  3M7F A;  4DGP A;  4QSY A;  1O4R A;  1M61 A;  1O42 A;  1OPK A;  3VS6 A;  5I6V A;  5AUL A;  3OP0 A;  1IS0 A;  3VRP A;  2KK6 A;  1Y1U A;  1O4M A;  5EEL A;  1TCE A;  2PLE A;  4EY0 A;  3CD3 A;  1LKK A;  3ZNI A;  2IUH A;  3OB2 B;  1LUI A;  5HKW A;  3UF4 A;  1O4L A;  1FBZ A;  4P9Z A;  3VS0 A;  3K2T A;  1A08 A;  1A1E A;  2YU7 A;  4K44 A;  1Z3K A;  3HIZ B;  1M27 A;  1BKM A;  5IBM A;  1A1C A;  4D8K A;  4U1P A;  2EYZ A;  1OPL A;  4JE4 A;  3N7Y A;  3VGO A;  3VRY A;  4OHH A;  1SHA A;  3PQZ A;  3VS5 A;  1YVH A;  2ECD A;  2ROR A;  1OO4 A;  5GJH A;  2OZO A;  1SKJ A;  2HMH A;  4OHL A;  2SHP A;  1YVL A;  3OVE A;  2FCI A;  3BUW B;  1AYD A;  1K9A A;  1QG1 E;  3N8M A;  1O4B A;  5EG3 B;  1IJR A;  2CR4 A;  4F5B A;  1WQU A;  1R1S A;  1CWD L;  1BFI A;  1X6C A;  3GXW A;  2BBU A;  1P13 A;  1AYA A;  1O4O A;  2IUG A;  2EO6 A;  2LQW A;  3VRR A;  2LNW A;  3EAZ A;  2ETZ A;  1CJ1 A;  1D4W A;  2B3O A;  2HUW A;  2GSB A;  3PJP A;  1LUM A;  2LCT A;  3PS5 A;  1AYB A;  3UYO A;  1O4K A;  4E68 A;  1NRV A;  1G83 A;  4H1O A;  1KC2 A;  3VS3 A;  2GE9 A;  4F5A A;  1BM2 A;  3GXX A;  4E93 A;  1B47 A;  3MXY A;  2SRC A;  1RJA A;  3VS7 A;  1JYR A;  1BHH B;  1JWO A;  1A1B A;  1SHB A;  2DCR A;  4GPL B;  3CXL A;  5GJI A;  1F2F A;  1GRI A;  2IUI A;  1BG1 A;  5IBS A;  4F59 A;  1XA6 A;  3NHN A;  5D0J A;  1MW4 A;  1ZFP E;  2HCK A;  5DC0 B;  5EHR A;  1O4A A;  3OB1 B;  1HCT B;  1O4C A;  2K7A B;  2HDV A;  2LQN A;  1KA7 A;  4U17 A;  3US4 A;  2H5K A;  2LNX A;  3CBL A;  2Y1N A;  3K2M A;  5BO4 A;  4DGX A;  5CDW A;  1FU5 A;  1NZL A;  3TKZ A;  3VRZ A;  4XZ1 A;  5KAZ A;  2KGY A;  2CI8 A;  4K2R A;  2EYY A;  3GQI B;  1O4D A;  4M4Z A;  4NWF A;  2C0T A;  3IMD A;  1HCS B;  3PSK A;  1FBV A;  1JYQ A;  3EAC A;  3HHM B;  2MRJ A;  2LRA A;  1O47 A;  1GHU A;  2AOB A;  1KA6 A;  1PIC A;  2Y1M A;  1UUR A;  1BHH A;  1AOU F;  2EYV A;  1KSW A;  2CIA A;  1O45 A;  4EIH A;  4GWF A;  4FL3 A;  3VS2 A;  3QWY A;  1O4H A;  2EO3 A;  2YSX A;  1AD5 A;  2PTK A;  4A4C A;  1LUK A;  4ROJ A;  2XP1 A;  3VRQ A;  1BKL A;  1O4F A;  4XZ0 A;  4K45 A;  5DC4 A;  2CS0 A;  3BUM B;  2DLZ A;  5AXI A;  1H9O A;  5EEQ A;  1BLJ A;  3T04 A;  2PNB A;  1LUN A;  2MQI A;  3S8N A;  1RPY A;  2EKX A;  2DM0 A;  2DLY A;  4GL9 E;  3QWX X;  3VRN A;  4LUE A;  5J3X A;  1QCF A;  4P9V A;  2AOA A;  1NZV A;  4NWG A;  3WA4 A;  2Y3A B;  1O41 A;  1O43 A;  2KNO A;  4LUD A;  1O44 A;  1FMK A;  2MC1 A;  4WWQ A;  2PLD A;  3S8O A;  3S9K A;  2MRK A;  2DVJ A;  1O49 A;  1CSY A;  2RSY A;  3TL0 A;  2L3T A;  1BF5 A;  1SPS A;  4X6S A;  1MIL A;  4TZI A;  3N84 A;  2CRH A;  3BKB A;  1A07 A;  2MK2 A;  3BUX B;  1LCK A;  2K79 B;  2RVF A;  1FHS A;  1A09 A;  4OHI A;  1O4E A;  1O48 A;  1SPR A;  3C7I A;  1BLK A;  3VS1 A;  2JYQ A;  1AB2 A;  1A1A A;  2IZV A;  2RMX A;  5HKZ A;  1X27 A;  4FL2 A;  4FBN A;  3BUO B;  3BUN B;  4OHE A;  1X0N A;  1I3Z A;  1O4J A;  4K11 A;  3VRO A;  2FO0 A;  2H8H A;  3PLF B;  3PSJ A;  2OQ1 A;  3S8L A;  2L4K A;  5DF6 A;  1JYU A;  3HCK A; 
#chains in the Genus database with same CATH homology
 1CWE A;  1LCJ A;  1BFJ A;  1JU5 A;  3KFJ A;  4H34 A;  1SHD A;  2DX0 A;  5DC9 A;  3VS4 A;  2EL8 A;  1O46 A;  2H46 E;  3OV1 A;  3IN7 A;  1D1Z A;  1O4N A;  3MAZ A;  1OO3 A;  2C0I A;  1TZE E;  1UUS A;  2QMS A;  1AYC A;  2C9W A;  3IMJ A;  2ABL A;  1FU6 A;  2EOB A;  1RQQ C;  5EHP A;  1O4Q A;  1R1P A;  2VIF A;  3PFV A;  4L1B B;  4OHD A;  1R1Q A;  1QAD A;  3CWG A;  2AUG A;  1D4T A;  1A81 A;  2HDX A;  5HKY A;  1FYR A;  3IN8 A;  2CI9 A;  1O4I A;  1O4G A;  1LKL A;  2CBL A;  4JEG A;  1AOT F;  1O4P A;  1F1W A;  1Y57 A;  4JGH A;  4A4B A;  1CSZ A;  2L6K A;  3MXC A;  1BMB A;  2EU0 A;  2C0O A;  1BHF A;  2PNA A;  3M7F A;  4DGP A;  4QSY A;  1O4R A;  1M61 A;  1O42 A;  1OPK A;  3VS6 A;  5I6V A;  5AUL A;  3OP0 A;  1IS0 A;  3VRP A;  2KK6 A;  1Y1U A;  1O4M A;  5EEL A;  1TCE A;  2PLE A;  4EY0 A;  3CD3 A;  1LKK A;  3ZNI A;  2IUH A;  3OB2 B;  1LUI A;  5HKW A;  3UF4 A;  1O4L A;  1FBZ A;  4P9Z A;  3VS0 A;  1A08 A;  1A1E A;  2YU7 A;  4K44 A;  1Z3K A;  3HIZ B;  1M27 A;  1BKM A;  5IBM A;  1A1C A;  4D8K A;  4U1P A;  2EYZ A;  1OPL A;  4JE4 A;  3N7Y A;  3VGO A;  3VRY A;  4OHH A;  1SHA A;  3PQZ A;  3VS5 A;  1YVH A;  2ECD A;  2ROR A;  1OO4 A;  5GJH A;  2OZO A;  1SKJ A;  2HMH A;  4OHL A;  2SHP A;  1YVL A;  3OVE A;  2FCI A;  3BUW B;  1AYD A;  1K9A A;  1QG1 E;  3N8M A;  1O4B A;  5EG3 B;  1IJR A;  2CR4 A;  4F5B A;  1WQU A;  1R1S A;  1CWD L;  1BFI A;  1X6C A;  3GXW A;  2BBU A;  1P13 A;  1AYA A;  1O4O A;  2IUG A;  2EO6 A;  2LQW A;  3VRR A;  2LNW A;  3EAZ A;  2ETZ A;  1CJ1 A;  1D4W A;  2B3O A;  2HUW A;  2GSB A;  3PJP A;  1LUM A;  2LCT A;  3PS5 A;  1AYB A;  3UYO A;  1O4K A;  4E68 A;  1NRV A;  1G83 A;  4H1O A;  1KC2 A;  3VS3 A;  2GE9 A;  4F5A A;  1BM2 A;  3GXX A;  4E93 A;  1B47 A;  3MXY A;  2SRC A;  1RJA A;  3VS7 A;  1JYR A;  1BHH B;  1JWO A;  1A1B A;  1SHB A;  2DCR A;  4GPL B;  3CXL A;  5GJI A;  1F2F A;  1GRI A;  2IUI A;  1BG1 A;  5IBS A;  4F59 A;  1XA6 A;  3NHN A;  5D0J A;  1MW4 A;  1ZFP E;  2HCK A;  5DC0 B;  5EHR A;  1O4A A;  3OB1 B;  1HCT B;  1O4C A;  2K7A B;  2HDV A;  2LQN A;  1KA7 A;  4U17 A;  3US4 A;  2H5K A;  2LNX A;  3CBL A;  2Y1N A;  3K2M A;  5BO4 A;  4DGX A;  5CDW A;  1FU5 A;  1NZL A;  3TKZ A;  3VRZ A;  4XZ1 A;  5KAZ A;  2CI8 A;  4K2R A;  2EYY A;  3GQI B;  1O4D A;  4M4Z A;  4NWF A;  2C0T A;  3IMD A;  1HCS B;  3PSK A;  1FBV A;  1JYQ A;  3EAC A;  3HHM B;  2MRJ A;  1O47 A;  1GHU A;  2AOB A;  1KA6 A;  1PIC A;  2Y1M A;  1UUR A;  1BHH A;  1AOU F;  2EYV A;  1KSW A;  2CIA A;  1O45 A;  4EIH A;  4GWF A;  4FL3 A;  3VS2 A;  3QWY A;  1O4H A;  2EO3 A;  2YSX A;  1AD5 A;  2PTK A;  4A4C A;  1LUK A;  4ROJ A;  2XP1 A;  3VRQ A;  1BKL A;  1O4F A;  4XZ0 A;  4K45 A;  5DC4 A;  2CS0 A;  3BUM B;  2DLZ A;  5AXI A;  1H9O A;  5EEQ A;  1BLJ A;  3T04 A;  2PNB A;  1LUN A;  2MQI A;  3S8N A;  1RPY A;  2EKX A;  2DM0 A;  2DLY A;  4GL9 E;  3QWX X;  3VRN A;  4LUE A;  5J3X A;  1QCF A;  4P9V A;  2AOA A;  1NZV A;  4NWG A;  3WA4 A;  2Y3A B;  1O41 A;  1O43 A;  2KNO A;  4LUD A;  1O44 A;  1FMK A;  2MC1 A;  4WWQ A;  2PLD A;  3S8O A;  3S9K A;  2MRK A;  2DVJ A;  1O49 A;  1CSY A;  2RSY A;  3TL0 A;  2L3T A;  1BF5 A;  1SPS A;  4X6S A;  1MIL A;  4TZI A;  3N84 A;  2CRH A;  3BKB A;  1A07 A;  2MK2 A;  3BUX B;  1LCK A;  2K79 B;  2RVF A;  1FHS A;  1A09 A;  4OHI A;  1O4E A;  1O48 A;  1SPR A;  3C7I A;  1BLK A;  3VS1 A;  2JYQ A;  1AB2 A;  1A1A A;  2IZV A;  2RMX A;  5HKZ A;  1X27 A;  4FL2 A;  4FBN A;  3BUO B;  3BUN B;  4OHE A;  1X0N A;  1I3Z A;  1O4J A;  4K11 A;  3VRO A;  2FO0 A;  2H8H A;  3PLF B;  3PSJ A;  2OQ1 A;  3S8L A;  2L4K A;  5DF6 A;  1JYU A;  3HCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...