1SHAA

Crystal structure of the phosphotyrosine recognition domain sh2 of v-src complexed with tyrosine-phosphorylated peptides
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords V-SRC SH2 DOMAIN
publication title Crystal structure of the phosphotyrosine recognition domain SH2 of v-src complexed with tyrosine-phosphorylated peptides.
pubmed doi rcsb
source organism Rous sarcoma virus
total genus 28
structure length 103
sequence length 103
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1992-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1shaA00
3CD3A 2RMXA 4GPLB 3VROA 1SKJA 4E68A 1O45A 1UUSA 1QG1E 1BF5A 2L3TA 2OZOA 5BO4A 2RORA 3S8NA 1I3ZA 1OPKA 1SPSA 2HCKA 1O42A 1FU5A 2MRJA 3NHNA 4JEGA 2DCRA 1PICA 3BUWB 4WWQA 2MQIA 3PSJA 1D4TA 1R1SA 5IBSA 1D1ZA 2CR4A 3S8LA 2LQNA 1O44A 2LNXA 3UF4A 1GRIA 2HDXA 3GXWA 4NWFA 2HDVA 1BKLA 1Y57A 1LKKA 3VS1A 3OB1B 3BKBA 2C0IA 3MXYA 1IJRA 3IMDA 1A1EA 2K79B 2L4KA 2PLDA 2CIAA 3VS6A 1RPYA 1KSWA 1TZEE 1AB2A 2C0OA 4K2RA 3WA4A 4GL9E 2YSXA 2FO0A 1O41A 2EOBA 1HCSB 5EHPA 1A1BA 4ROJA 1JWOA 2B3OA 1LUNA 1BHHA 3OB2B 2Y1NA 1MW4A 5DC0B 3EAZA 1LUIA 1CWEA 1O4CA 1SHDA 3PLFB 2IUHA 5DF6A 2SRCA 5EG3B 2SHPA 4DGPA 2KK6A 2OQ1A 2K7AB 4L1BB 4A4CA 1JYUA 1O48A 2EL8A 1QCFA 1LCJA 4X6SA 1JYQA 2EU0A 2HMHA 4XZ0A 1FYRA 1AOUF 2EYVA 1O4RA 4JGHA 1M61A 4D8KA 2PNBA 5EHRA 2RVFA 2Y1MA 1O4OA 5J3XA 4FL3A 1G83A 5DC4A 3CBLA 5I6VA 1LKLA 1BHHB 2H46E 1TCEA 2EYZA 1O43A 4F5AA 1R1QA 4OHEA 2LQWA 3VS0A 1FU6A 1BLJA 1O4DA 3VGOA 4H34A 1WQUA 2H8HA 1CWDL 5AXIA 4EIHA 1O47A 2YU7A 4FBNA 1O4PA 2HUWA 1A81A 4M4ZA 2IUGA 4NWGA 2CRHA 3VRYA 1YVLA 1NRVA 2MC1A 1LUKA 3OV1A 1BMBA 1FBVA 2MK2A 3BUOB 3VRZA 1O4FA 1O4LA 3KFJA 1FHSA 1BG1A 4GWFA 1BM2A 1KA6A 3PQZA 1NZVA 2PNAA 1A08A 1KA7A 4K44A 2FCIA 1O4GA 2AUGA 2CBLA 4U17A 1FBZA 1AYCA 2CS0A 5EELA 2C9WA 1O4EA 3HIZB 4DGXA 1O4IA 5GJHA 1GHUA 1Y1UA 1NZLA 4K45A 2GSBA 4E93A 5CDWA 1HCTB 2EYYA 1BFJA 3GQIB 2L6KA 1AYDA 5HKYA 4OHHA 5EEQA 1A1CA 1O4HA 2DLZA 1O4QA 3IMJA 1RQQC 3N7YA 2MRKA 3BUNB 1BKMA 2EO6A 2RSYA 1D4WA 1O4JA 3VS2A 1X0NA 1B47A 2DVJA 2DM0A 2EO3A 1F1WA 2LNWA 2KNOA 1O4BA 1BHFA 1ZFPE 3VS4A 4F5BA 3VRNA 3CWGA 3BUXB 1FMKA 2IZVA 1O4AA 5DC9A 4FL2A 1SHBA 1O46A 2XP1A 4P9ZA 1JYRA 3QWYA 4OHIA 4P9VA 5IBMA 3HCKA 1JU5A 1MILA 3K2MA 1O4MA 1AOTF 4K11A 3EACA 3TKZA 2LCTA 4OHDA 4TZIA 1UURA 4QSYA 3VRQA 3T04A 1O4NA 5KAZA 3PFVA 1Z3KA 3QWXX 1O4KA 2ABLA 4JE4A 2IUIA 4OHLA 2PTKA 3PJPA 3VRPA 1H9OA 2DLYA 1OPLA 3US4A 1KC2A 1A07A 2DX0A 1LCKA 3C7IA 3ZNIA 5GJIA 1OO3A 2PLEA 3UYOA 3PSKA 2AOBA 2CI9A 2H5KA 1IS0A 4EY0A 1BFIA 3BUMB 2QMSA 3CXLA 1M27A 3GXXA 3TL0A 4XZ1A 2AOAA 2GE9A 3VS5A 4U1PA 4H1OA 5D0JA 5HKWA 2VIFA 1CJ1A 1O49A 1R1PA 4F59A 1OO4A 3IN8A 1F2FA 1SHAA 2ETZA 5AULA 3IN7A 1AYAA 1BLKA 2ECDA 1A09A 4A4BA 1AD5A 2JYQA 3VS7A 1CSYA 3HHMB 4LUDA 4LUEA 5HKZA 1LUMA 3VS3A 2C0TA 2BBUA 3MXCA 1XA6A 2EKXA 1A1AA 3N84A 1X6CA 1P13A 3OP0A 3N8MA 1CSZA 1RJAA 1QADA 2CI8A 3OVEA 3S9KA 3S8OA 3M7FA 1SPRA 2Y3AB 1AYBA 1YVHA 1K9AA 1X27A 3VRRA 3MAZA 3PS5A
chains in the Genus database with same CATH superfamily
3CD3A 2RMXA 4GPLB 3VROA 1SKJA 4E68A 1O45A 1UUSA 1QG1E 1BF5A 2L3TA 2OZOA 5BO4A 2RORA 3S8NA 1I3ZA 1OPKA 1SPSA 2HCKA 1O42A 1FU5A 2MRJA 3NHNA 4JEGA 2DCRA 1PICA 3BUWB 4WWQA 2MQIA 3PSJA 1D4TA 1R1SA 5IBSA 1D1ZA 2CR4A 3S8LA 2LQNA 1O44A 2LNXA 3UF4A 1GRIA 2HDXA 3GXWA 4NWFA 2HDVA 1BKLA 1Y57A 1LKKA 3VS1A 3OB1B 3BKBA 2C0IA 3MXYA 1IJRA 3IMDA 1A1EA 2K79B 2L4KA 2PLDA 2CIAA 3VS6A 1RPYA 1KSWA 1TZEE 1AB2A 2C0OA 4K2RA 3WA4A 4GL9E 2YSXA 2FO0A 1O41A 2EOBA 1HCSB 5EHPA 1A1BA 4ROJA 1JWOA 2B3OA 1LUNA 1BHHA 3OB2B 2Y1NA 1MW4A 5DC0B 3EAZA 1LUIA 1CWEA 1O4CA 1SHDA 3PLFB 2IUHA 5DF6A 2SRCA 5EG3B 2SHPA 4DGPA 2KK6A 2OQ1A 2K7AB 4L1BB 4A4CA 1JYUA 1O48A 2EL8A 1QCFA 1LCJA 4X6SA 1JYQA 2EU0A 2HMHA 4XZ0A 1FYRA 1AOUF 2EYVA 1O4RA 4JGHA 1M61A 4D8KA 2PNBA 5EHRA 2RVFA 2Y1MA 1O4OA 5J3XA 4FL3A 1G83A 5DC4A 3CBLA 5I6VA 1LKLA 1BHHB 2H46E 1TCEA 2EYZA 1O43A 4F5AA 1R1QA 4OHEA 2LQWA 3VS0A 1FU6A 1BLJA 1O4DA 3VGOA 4H34A 1WQUA 2H8HA 1CWDL 5AXIA 4EIHA 1O47A 2YU7A 4FBNA 1O4PA 2HUWA 1A81A 2LRAA 4M4ZA 2IUGA 4NWGA 2CRHA 3VRYA 1YVLA 1NRVA 2MC1A 1LUKA 3OV1A 1BMBA 1FBVA 2MK2A 3BUOB 3VRZA 1O4FA 1O4LA 3KFJA 1FHSA 1BG1A 4GWFA 1BM2A 1KA6A 3PQZA 1NZVA 2PNAA 1A08A 1KA7A 3K2TA 4K44A 2FCIA 1O4GA 2AUGA 2CBLA 4U17A 1FBZA 1AYCA 2CS0A 5EELA 2C9WA 1O4EA 3HIZB 4DGXA 1O4IA 5GJHA 1GHUA 1Y1UA 1NZLA 4K45A 2GSBA 4E93A 5CDWA 1HCTB 2EYYA 1BFJA 3GQIB 2L6KA 2KGYA 1AYDA 5HKYA 4OHHA 5EEQA 1A1CA 1O4HA 2DLZA 1O4QA 3IMJA 1RQQC 3N7YA 2MRKA 3BUNB 1BKMA 2EO6A 2RSYA 1D4WA 1O4JA 3LYVA 3VS2A 1X0NA 1B47A 2DVJA 2DM0A 2EO3A 1F1WA 2LNWA 2KNOA 1O4BA 1BHFA 1ZFPE 3VS4A 4F5BA 3VRNA 3CWGA 3BUXB 1FMKA 2IZVA 1O4AA 5DC9A 4FL2A 1SHBA 1O46A 2XP1A 4P9ZA 1JYRA 3QWYA 4OHIA 4P9VA 5IBMA 3HCKA 1JU5A 1MILA 3K2MA 1O4MA 1AOTF 4K11A 3EACA 3TKZA 2LCTA 4OHDA 4TZIA 1UURA 4QSYA 3VRQA 3T04A 1O4NA 5KAZA 3PFVA 1Z3KA 3QWXX 1O4KA 2ABLA 4JE4A 2IUIA 4OHLA 2PTKA 3PJPA 3VRPA 1H9OA 2DLYA 1OPLA 3US4A 1KC2A 1A07A 2DX0A 1LCKA 3C7IA 3ZNIA 5GJIA 1OO3A 2PLEA 3UYOA 3PSKA 2AOBA 2CI9A 2H5KA 1IS0A 4EY0A 1BFIA 3BUMB 2QMSA 3CXLA 1M27A 3GXXA 3TL0A 4XZ1A 2AOAA 2GE9A 3VS5A 4U1PA 4H1OA 5D0JA 5HKWA 2VIFA 1CJ1A 1O49A 1R1PA 4F59A 1OO4A 3IN8A 1F2FA 1SHAA 2ETZA 5AULA 3IN7A 1AYAA 1BLKA 2ECDA 1A09A 4A4BA 1AD5A 2JYQA 3VS7A 1CSYA 3HHMB 4LUDA 4LUEA 5HKZA 1LUMA 3VS3A 2C0TA 2BBUA 3MXCA 1XA6A 2EKXA 1A1AA 3N84A 1X6CA 1P13A 3OP0A 3N8MA 1CSZA 1RJAA 1QADA 2CI8A 3OVEA 3S9KA 3S8OA 3M7FA 1SPRA 2Y3AB 1AYBA 1YVHA 1K9AA 1X27A 3VRRA 3MAZA 3PS5A
chains in the Genus database with same CATH topology
3CD3A 2RMXA 4GPLB 3VROA 1SKJA 4E68A 1O45A 1UUSA 1QG1E 1BF5A 2L3TA 2OZOA 5BO4A 2RORA 3S8NA 1I3ZA 1OPKA 1SPSA 2HCKA 1O42A 1FU5A 2MRJA 3NHNA 4JEGA 2DCRA 1PICA 3BUWB 4WWQA 2MQIA 3PSJA 1D4TA 1R1SA 5IBSA 1D1ZA 2CR4A 3S8LA 2LQNA 1O44A 2LNXA 3UF4A 1GRIA 2HDXA 3GXWA 4NWFA 2HDVA 1BKLA 1Y57A 1LKKA 3VS1A 3OB1B 3BKBA 2C0IA 3MXYA 1IJRA 3IMDA 1A1EA 2K79B 2L4KA 2PLDA 2CIAA 3VS6A 1RPYA 1KSWA 1TZEE 1AB2A 2C0OA 4K2RA 3WA4A 4GL9E 2YSXA 2FO0A 1O41A 2EOBA 1HCSB 5EHPA 1A1BA 4ROJA 1JWOA 2B3OA 1LUNA 1BHHA 3OB2B 2Y1NA 1MW4A 5DC0B 3EAZA 1LUIA 1CWEA 1O4CA 1SHDA 3PLFB 2IUHA 5DF6A 2SRCA 5EG3B 2SHPA 4DGPA 2KK6A 2OQ1A 2K7AB 4L1BB 4A4CA 1JYUA 1O48A 2EL8A 1QCFA 1LCJA 4X6SA 1JYQA 2EU0A 2HMHA 4XZ0A 1FYRA 1AOUF 2EYVA 1O4RA 4JGHA 1M61A 4D8KA 2PNBA 5EHRA 2RVFA 2Y1MA 1O4OA 5J3XA 4FL3A 1G83A 5DC4A 3CBLA 5I6VA 1LKLA 1BHHB 2H46E 1TCEA 2EYZA 1O43A 4F5AA 1R1QA 4OHEA 2LQWA 3VS0A 1FU6A 1BLJA 1O4DA 3VGOA 4H34A 1WQUA 2H8HA 1CWDL 5AXIA 4EIHA 1O47A 2YU7A 4FBNA 1O4PA 2HUWA 1A81A 4M4ZA 2IUGA 4NWGA 2CRHA 3VRYA 1YVLA 1NRVA 2MC1A 1LUKA 3OV1A 1BMBA 1FBVA 2MK2A 3BUOB 3VRZA 1O4FA 1O4LA 3KFJA 1FHSA 1BG1A 4GWFA 1BM2A 1KA6A 3PQZA 1NZVA 2PNAA 1A08A 1KA7A 4K44A 2FCIA 1O4GA 2AUGA 2CBLA 4U17A 1FBZA 1AYCA 2CS0A 5EELA 2C9WA 1O4EA 3HIZB 4DGXA 1O4IA 5GJHA 1GHUA 1Y1UA 1NZLA 4K45A 2GSBA 4E93A 5CDWA 1HCTB 2EYYA 1BFJA 3GQIB 2L6KA 1AYDA 5HKYA 4OHHA 5EEQA 1A1CA 1O4HA 2DLZA 1O4QA 3IMJA 1RQQC 3N7YA 2MRKA 3BUNB 1BKMA 2EO6A 2RSYA 1D4WA 1O4JA 3VS2A 1X0NA 1B47A 2DVJA 2DM0A 2EO3A 1F1WA 2LNWA 2KNOA 1O4BA 1BHFA 1ZFPE 3VS4A 4F5BA 3VRNA 3CWGA 3BUXB 1FMKA 2IZVA 1O4AA 5DC9A 4FL2A 1SHBA 1O46A 2XP1A 4P9ZA 1JYRA 3QWYA 4OHIA 4P9VA 5IBMA 3HCKA 1JU5A 1MILA 3K2MA 1O4MA 1AOTF 4K11A 3EACA 3TKZA 2LCTA 4OHDA 4TZIA 1UURA 4QSYA 3VRQA 3T04A 1O4NA 5KAZA 3PFVA 1Z3KA 3QWXX 1O4KA 2ABLA 4JE4A 2IUIA 4OHLA 2PTKA 3PJPA 3VRPA 1H9OA 2DLYA 1OPLA 3US4A 1KC2A 1A07A 2DX0A 1LCKA 3C7IA 3ZNIA 5GJIA 1OO3A 2PLEA 3UYOA 3PSKA 2AOBA 2CI9A 2H5KA 1IS0A 4EY0A 1BFIA 3BUMB 2QMSA 3CXLA 1M27A 3GXXA 3TL0A 4XZ1A 2AOAA 2GE9A 3VS5A 4U1PA 4H1OA 5D0JA 5HKWA 2VIFA 1CJ1A 1O49A 1R1PA 4F59A 1OO4A 3IN8A 1F2FA 1SHAA 2ETZA 5AULA 3IN7A 1AYAA 1BLKA 2ECDA 1A09A 4A4BA 1AD5A 2JYQA 3VS7A 1CSYA 3HHMB 4LUDA 4LUEA 5HKZA 1LUMA 3VS3A 2C0TA 2BBUA 3MXCA 1XA6A 2EKXA 1A1AA 3N84A 1X6CA 1P13A 3OP0A 3N8MA 1CSZA 1RJAA 1QADA 2CI8A 3OVEA 3S9KA 3S8OA 3M7FA 1SPRA 2Y3AB 1AYBA 1YVHA 1K9AA 1X27A 3VRRA 3MAZA 3PS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD3 A;  2RMX A;  4GPL B;  3VRO A;  1SKJ A;  4E68 A;  1O45 A;  1UUS A;  1QG1 E;  1BF5 A;  2L3T A;  2OZO A;  5BO4 A;  2ROR A;  3S8N A;  1I3Z A;  1OPK A;  1SPS A;  2HCK A;  1O42 A;  1FU5 A;  2MRJ A;  3NHN A;  4JEG A;  2DCR A;  1PIC A;  3BUW B;  4WWQ A;  2MQI A;  3PSJ A;  1D4T A;  1R1S A;  5IBS A;  1D1Z A;  2CR4 A;  3S8L A;  2LQN A;  1O44 A;  2LNX A;  3UF4 A;  1GRI A;  2HDX A;  3GXW A;  4NWF A;  2HDV A;  1BKL A;  1Y57 A;  1LKK A;  3VS1 A;  3OB1 B;  3BKB A;  2C0I A;  3MXY A;  1IJR A;  3IMD A;  1A1E A;  2K79 B;  2L4K A;  2PLD A;  2CIA A;  3VS6 A;  1RPY A;  1KSW A;  1TZE E;  1AB2 A;  2C0O A;  4K2R A;  3WA4 A;  4GL9 E;  2YSX A;  2FO0 A;  1O41 A;  2EOB A;  1HCS B;  5EHP A;  1A1B A;  4ROJ A;  1JWO A;  2B3O A;  1LUN A;  1BHH A;  3OB2 B;  2Y1N A;  1MW4 A;  5DC0 B;  3EAZ A;  1LUI A;  1CWE A;  1O4C A;  1SHD A;  3PLF B;  2IUH A;  5DF6 A;  2SRC A;  5EG3 B;  2SHP A;  4DGP A;  2KK6 A;  2OQ1 A;  2K7A B;  4L1B B;  4A4C A;  1JYU A;  1O48 A;  2EL8 A;  1QCF A;  1LCJ A;  4X6S A;  1JYQ A;  2EU0 A;  2HMH A;  4XZ0 A;  1FYR A;  1AOU F;  2EYV A;  1O4R A;  4JGH A;  1M61 A;  4D8K A;  2PNB A;  5EHR A;  2RVF A;  2Y1M A;  1O4O A;  5J3X A;  4FL3 A;  1G83 A;  5DC4 A;  3CBL A;  5I6V A;  1LKL A;  1BHH B;  2H46 E;  1TCE A;  2EYZ A;  1O43 A;  4F5A A;  1R1Q A;  4OHE A;  2LQW A;  3VS0 A;  1FU6 A;  1BLJ A;  1O4D A;  3VGO A;  4H34 A;  1WQU A;  2H8H A;  1CWD L;  5AXI A;  4EIH A;  1O47 A;  2YU7 A;  4FBN A;  1O4P A;  2HUW A;  1A81 A;  4M4Z A;  2IUG A;  4NWG A;  2CRH A;  3VRY A;  1YVL A;  1NRV A;  2MC1 A;  1LUK A;  3OV1 A;  1BMB A;  1FBV A;  2MK2 A;  3BUO B;  3VRZ A;  1O4F A;  1O4L A;  3KFJ A;  1FHS A;  1BG1 A;  4GWF A;  1BM2 A;  1KA6 A;  3PQZ A;  1NZV A;  2PNA A;  1A08 A;  1KA7 A;  4K44 A;  2FCI A;  1O4G A;  2AUG A;  2CBL A;  4U17 A;  1FBZ A;  1AYC A;  2CS0 A;  5EEL A;  2C9W A;  1O4E A;  3HIZ B;  4DGX A;  1O4I A;  5GJH A;  1GHU A;  1Y1U A;  1NZL A;  4K45 A;  2GSB A;  4E93 A;  5CDW A;  1HCT B;  2EYY A;  1BFJ A;  3GQI B;  2L6K A;  1AYD A;  5HKY A;  4OHH A;  5EEQ A;  1A1C A;  1O4H A;  2DLZ A;  1O4Q A;  3IMJ A;  1RQQ C;  3N7Y A;  2MRK A;  3BUN B;  1BKM A;  2EO6 A;  2RSY A;  1D4W A;  1O4J A;  3VS2 A;  1X0N A;  1B47 A;  2DVJ A;  2DM0 A;  2EO3 A;  1F1W A;  2LNW A;  2KNO A;  1O4B A;  1BHF A;  1ZFP E;  3VS4 A;  4F5B A;  3VRN A;  3CWG A;  3BUX B;  1FMK A;  2IZV A;  1O4A A;  5DC9 A;  4FL2 A;  1SHB A;  1O46 A;  2XP1 A;  4P9Z A;  1JYR A;  3QWY A;  4OHI A;  4P9V A;  5IBM A;  3HCK A;  1JU5 A;  1MIL A;  3K2M A;  1O4M A;  1AOT F;  4K11 A;  3EAC A;  3TKZ A;  2LCT A;  4OHD A;  4TZI A;  1UUR A;  4QSY A;  3VRQ A;  3T04 A;  1O4N A;  5KAZ A;  3PFV A;  1Z3K A;  3QWX X;  1O4K A;  2ABL A;  4JE4 A;  2IUI A;  4OHL A;  2PTK A;  3PJP A;  3VRP A;  1H9O A;  2DLY A;  1OPL A;  3US4 A;  1KC2 A;  1A07 A;  2DX0 A;  1LCK A;  3C7I A;  3ZNI A;  5GJI A;  1OO3 A;  2PLE A;  3UYO A;  3PSK A;  2AOB A;  2CI9 A;  2H5K A;  1IS0 A;  4EY0 A;  1BFI A;  3BUM B;  2QMS A;  3CXL A;  1M27 A;  3GXX A;  3TL0 A;  4XZ1 A;  2AOA A;  2GE9 A;  3VS5 A;  4U1P A;  4H1O A;  5D0J A;  5HKW A;  2VIF A;  1CJ1 A;  1O49 A;  1R1P A;  4F59 A;  1OO4 A;  3IN8 A;  1F2F A;  1SHA A;  2ETZ A;  5AUL A;  3IN7 A;  1AYA A;  1BLK A;  2ECD A;  1A09 A;  4A4B A;  1AD5 A;  2JYQ A;  3VS7 A;  1CSY A;  3HHM B;  4LUD A;  4LUE A;  5HKZ A;  1LUM A;  3VS3 A;  2C0T A;  2BBU A;  3MXC A;  1XA6 A;  2EKX A;  1A1A A;  3N84 A;  1X6C A;  1P13 A;  3OP0 A;  3N8M A;  1CSZ A;  1RJA A;  1QAD A;  2CI8 A;  3OVE A;  3S9K A;  3S8O A;  3M7F A;  1SPR A;  2Y3A B;  1AYB A;  1YVH A;  1K9A A;  1X27 A;  3VRR A;  3MAZ A;  3PS5 A; 
#chains in the Genus database with same CATH topology
 3CD3 A;  2RMX A;  4GPL B;  3VRO A;  1SKJ A;  4E68 A;  1O45 A;  1UUS A;  1QG1 E;  1BF5 A;  2L3T A;  2OZO A;  5BO4 A;  2ROR A;  3S8N A;  1I3Z A;  1OPK A;  1SPS A;  2HCK A;  1O42 A;  1FU5 A;  2MRJ A;  3NHN A;  4JEG A;  2DCR A;  1PIC A;  3BUW B;  4WWQ A;  2MQI A;  3PSJ A;  1D4T A;  1R1S A;  5IBS A;  1D1Z A;  2CR4 A;  3S8L A;  2LQN A;  1O44 A;  2LNX A;  3UF4 A;  1GRI A;  2HDX A;  3GXW A;  4NWF A;  2HDV A;  1BKL A;  1Y57 A;  1LKK A;  3VS1 A;  3OB1 B;  3BKB A;  2C0I A;  3MXY A;  1IJR A;  3IMD A;  1A1E A;  2K79 B;  2L4K A;  2PLD A;  2CIA A;  3VS6 A;  1RPY A;  1KSW A;  1TZE E;  1AB2 A;  2C0O A;  4K2R A;  3WA4 A;  4GL9 E;  2YSX A;  2FO0 A;  1O41 A;  2EOB A;  1HCS B;  5EHP A;  1A1B A;  4ROJ A;  1JWO A;  2B3O A;  1LUN A;  1BHH A;  3OB2 B;  2Y1N A;  1MW4 A;  5DC0 B;  3EAZ A;  1LUI A;  1CWE A;  1O4C A;  1SHD A;  3PLF B;  2IUH A;  5DF6 A;  2SRC A;  5EG3 B;  2SHP A;  4DGP A;  2KK6 A;  2OQ1 A;  2K7A B;  4L1B B;  4A4C A;  1JYU A;  1O48 A;  2EL8 A;  1QCF A;  1LCJ A;  4X6S A;  1JYQ A;  2EU0 A;  2HMH A;  4XZ0 A;  1FYR A;  1AOU F;  2EYV A;  1O4R A;  4JGH A;  1M61 A;  4D8K A;  2PNB A;  5EHR A;  2RVF A;  2Y1M A;  1O4O A;  5J3X A;  4FL3 A;  1G83 A;  5DC4 A;  3CBL A;  5I6V A;  1LKL A;  1BHH B;  2H46 E;  1TCE A;  2EYZ A;  1O43 A;  4F5A A;  1R1Q A;  4OHE A;  2LQW A;  3VS0 A;  1FU6 A;  1BLJ A;  1O4D A;  3VGO A;  4H34 A;  1WQU A;  2H8H A;  1CWD L;  5AXI A;  4EIH A;  1O47 A;  2YU7 A;  4FBN A;  1O4P A;  2HUW A;  1A81 A;  2LRA A;  4M4Z A;  2IUG A;  4NWG A;  2CRH A;  3VRY A;  1YVL A;  1NRV A;  2MC1 A;  1LUK A;  3OV1 A;  1BMB A;  1FBV A;  2MK2 A;  3BUO B;  3VRZ A;  1O4F A;  1O4L A;  3KFJ A;  1FHS A;  1BG1 A;  4GWF A;  1BM2 A;  1KA6 A;  3PQZ A;  1NZV A;  2PNA A;  1A08 A;  1KA7 A;  3K2T A;  4K44 A;  2FCI A;  1O4G A;  2AUG A;  2CBL A;  4U17 A;  1FBZ A;  1AYC A;  2CS0 A;  5EEL A;  2C9W A;  1O4E A;  3HIZ B;  4DGX A;  1O4I A;  5GJH A;  1GHU A;  1Y1U A;  1NZL A;  4K45 A;  2GSB A;  4E93 A;  5CDW A;  1HCT B;  2EYY A;  1BFJ A;  3GQI B;  2L6K A;  2KGY A;  1AYD A;  5HKY A;  4OHH A;  5EEQ A;  1A1C A;  1O4H A;  2DLZ A;  1O4Q A;  3IMJ A;  1RQQ C;  3N7Y A;  2MRK A;  3BUN B;  1BKM A;  2EO6 A;  2RSY A;  1D4W A;  1O4J A;  3LYV A;  3VS2 A;  1X0N A;  1B47 A;  2DVJ A;  2DM0 A;  2EO3 A;  1F1W A;  2LNW A;  2KNO A;  1O4B A;  1BHF A;  1ZFP E;  3VS4 A;  4F5B A;  3VRN A;  3CWG A;  3BUX B;  1FMK A;  2IZV A;  1O4A A;  5DC9 A;  4FL2 A;  1SHB A;  1O46 A;  2XP1 A;  4P9Z A;  1JYR A;  3QWY A;  4OHI A;  4P9V A;  5IBM A;  3HCK A;  1JU5 A;  1MIL A;  3K2M A;  1O4M A;  1AOT F;  4K11 A;  3EAC A;  3TKZ A;  2LCT A;  4OHD A;  4TZI A;  1UUR A;  4QSY A;  3VRQ A;  3T04 A;  1O4N A;  5KAZ A;  3PFV A;  1Z3K A;  3QWX X;  1O4K A;  2ABL A;  4JE4 A;  2IUI A;  4OHL A;  2PTK A;  3PJP A;  3VRP A;  1H9O A;  2DLY A;  1OPL A;  3US4 A;  1KC2 A;  1A07 A;  2DX0 A;  1LCK A;  3C7I A;  3ZNI A;  5GJI A;  1OO3 A;  2PLE A;  3UYO A;  3PSK A;  2AOB A;  2CI9 A;  2H5K A;  1IS0 A;  4EY0 A;  1BFI A;  3BUM B;  2QMS A;  3CXL A;  1M27 A;  3GXX A;  3TL0 A;  4XZ1 A;  2AOA A;  2GE9 A;  3VS5 A;  4U1P A;  4H1O A;  5D0J A;  5HKW A;  2VIF A;  1CJ1 A;  1O49 A;  1R1P A;  4F59 A;  1OO4 A;  3IN8 A;  1F2F A;  1SHA A;  2ETZ A;  5AUL A;  3IN7 A;  1AYA A;  1BLK A;  2ECD A;  1A09 A;  4A4B A;  1AD5 A;  2JYQ A;  3VS7 A;  1CSY A;  3HHM B;  4LUD A;  4LUE A;  5HKZ A;  1LUM A;  3VS3 A;  2C0T A;  2BBU A;  3MXC A;  1XA6 A;  2EKX A;  1A1A A;  3N84 A;  1X6C A;  1P13 A;  3OP0 A;  3N8M A;  1CSZ A;  1RJA A;  1QAD A;  2CI8 A;  3OVE A;  3S9K A;  3S8O A;  3M7F A;  1SPR A;  2Y3A B;  1AYB A;  1YVH A;  1K9A A;  1X27 A;  3VRR A;  3MAZ A;  3PS5 A; 
#chains in the Genus database with same CATH homology
 3CD3 A;  2RMX A;  4GPL B;  3VRO A;  1SKJ A;  4E68 A;  1O45 A;  1UUS A;  1QG1 E;  1BF5 A;  2L3T A;  2OZO A;  5BO4 A;  2ROR A;  3S8N A;  1I3Z A;  1OPK A;  1SPS A;  2HCK A;  1O42 A;  1FU5 A;  2MRJ A;  3NHN A;  4JEG A;  2DCR A;  1PIC A;  3BUW B;  4WWQ A;  2MQI A;  3PSJ A;  1D4T A;  1R1S A;  5IBS A;  1D1Z A;  2CR4 A;  3S8L A;  2LQN A;  1O44 A;  2LNX A;  3UF4 A;  1GRI A;  2HDX A;  3GXW A;  4NWF A;  2HDV A;  1BKL A;  1Y57 A;  1LKK A;  3VS1 A;  3OB1 B;  3BKB A;  2C0I A;  3MXY A;  1IJR A;  3IMD A;  1A1E A;  2K79 B;  2L4K A;  2PLD A;  2CIA A;  3VS6 A;  1RPY A;  1KSW A;  1TZE E;  1AB2 A;  2C0O A;  4K2R A;  3WA4 A;  4GL9 E;  2YSX A;  2FO0 A;  1O41 A;  2EOB A;  1HCS B;  5EHP A;  1A1B A;  4ROJ A;  1JWO A;  2B3O A;  1LUN A;  1BHH A;  3OB2 B;  2Y1N A;  1MW4 A;  5DC0 B;  3EAZ A;  1LUI A;  1CWE A;  1O4C A;  1SHD A;  3PLF B;  2IUH A;  5DF6 A;  2SRC A;  5EG3 B;  2SHP A;  4DGP A;  2KK6 A;  2OQ1 A;  2K7A B;  4L1B B;  4A4C A;  1JYU A;  1O48 A;  2EL8 A;  1QCF A;  1LCJ A;  4X6S A;  1JYQ A;  2EU0 A;  2HMH A;  4XZ0 A;  1FYR A;  1AOU F;  2EYV A;  1O4R A;  4JGH A;  1M61 A;  4D8K A;  2PNB A;  5EHR A;  2RVF A;  2Y1M A;  1O4O A;  5J3X A;  4FL3 A;  1G83 A;  5DC4 A;  3CBL A;  5I6V A;  1LKL A;  1BHH B;  2H46 E;  1TCE A;  2EYZ A;  1O43 A;  4F5A A;  1R1Q A;  4OHE A;  2LQW A;  3VS0 A;  1FU6 A;  1BLJ A;  1O4D A;  3VGO A;  4H34 A;  1WQU A;  2H8H A;  1CWD L;  5AXI A;  4EIH A;  1O47 A;  2YU7 A;  4FBN A;  1O4P A;  2HUW A;  1A81 A;  4M4Z A;  2IUG A;  4NWG A;  2CRH A;  3VRY A;  1YVL A;  1NRV A;  2MC1 A;  1LUK A;  3OV1 A;  1BMB A;  1FBV A;  2MK2 A;  3BUO B;  3VRZ A;  1O4F A;  1O4L A;  3KFJ A;  1FHS A;  1BG1 A;  4GWF A;  1BM2 A;  1KA6 A;  3PQZ A;  1NZV A;  2PNA A;  1A08 A;  1KA7 A;  4K44 A;  2FCI A;  1O4G A;  2AUG A;  2CBL A;  4U17 A;  1FBZ A;  1AYC A;  2CS0 A;  5EEL A;  2C9W A;  1O4E A;  3HIZ B;  4DGX A;  1O4I A;  5GJH A;  1GHU A;  1Y1U A;  1NZL A;  4K45 A;  2GSB A;  4E93 A;  5CDW A;  1HCT B;  2EYY A;  1BFJ A;  3GQI B;  2L6K A;  1AYD A;  5HKY A;  4OHH A;  5EEQ A;  1A1C A;  1O4H A;  2DLZ A;  1O4Q A;  3IMJ A;  1RQQ C;  3N7Y A;  2MRK A;  3BUN B;  1BKM A;  2EO6 A;  2RSY A;  1D4W A;  1O4J A;  3VS2 A;  1X0N A;  1B47 A;  2DVJ A;  2DM0 A;  2EO3 A;  1F1W A;  2LNW A;  2KNO A;  1O4B A;  1BHF A;  1ZFP E;  3VS4 A;  4F5B A;  3VRN A;  3CWG A;  3BUX B;  1FMK A;  2IZV A;  1O4A A;  5DC9 A;  4FL2 A;  1SHB A;  1O46 A;  2XP1 A;  4P9Z A;  1JYR A;  3QWY A;  4OHI A;  4P9V A;  5IBM A;  3HCK A;  1JU5 A;  1MIL A;  3K2M A;  1O4M A;  1AOT F;  4K11 A;  3EAC A;  3TKZ A;  2LCT A;  4OHD A;  4TZI A;  1UUR A;  4QSY A;  3VRQ A;  3T04 A;  1O4N A;  5KAZ A;  3PFV A;  1Z3K A;  3QWX X;  1O4K A;  2ABL A;  4JE4 A;  2IUI A;  4OHL A;  2PTK A;  3PJP A;  3VRP A;  1H9O A;  2DLY A;  1OPL A;  3US4 A;  1KC2 A;  1A07 A;  2DX0 A;  1LCK A;  3C7I A;  3ZNI A;  5GJI A;  1OO3 A;  2PLE A;  3UYO A;  3PSK A;  2AOB A;  2CI9 A;  2H5K A;  1IS0 A;  4EY0 A;  1BFI A;  3BUM B;  2QMS A;  3CXL A;  1M27 A;  3GXX A;  3TL0 A;  4XZ1 A;  2AOA A;  2GE9 A;  3VS5 A;  4U1P A;  4H1O A;  5D0J A;  5HKW A;  2VIF A;  1CJ1 A;  1O49 A;  1R1P A;  4F59 A;  1OO4 A;  3IN8 A;  1F2F A;  1SHA A;  2ETZ A;  5AUL A;  3IN7 A;  1AYA A;  1BLK A;  2ECD A;  1A09 A;  4A4B A;  1AD5 A;  2JYQ A;  3VS7 A;  1CSY A;  3HHM B;  4LUD A;  4LUE A;  5HKZ A;  1LUM A;  3VS3 A;  2C0T A;  2BBU A;  3MXC A;  1XA6 A;  2EKX A;  1A1A A;  3N84 A;  1X6C A;  1P13 A;  3OP0 A;  3N8M A;  1CSZ A;  1RJA A;  1QAD A;  2CI8 A;  3OVE A;  3S9K A;  3S8O A;  3M7F A;  1SPR A;  2Y3A B;  1AYB A;  1YVH A;  1K9A A;  1X27 A;  3VRR A;  3MAZ A;  3PS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...