2EO6A

Solution structure of the sh2 domain from mouse b-cell linker protein blnk
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
141
structure length
141
Chain Sequence
b'GSSGSSGPFNSTFADQEAELLGKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVAFFNKRVYNIPVRFIEATKQYALGKKKNGEEYFGSVVEIVNSHQHNPLVLIDSQNNTKDSTRLKYAVKVSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B-cell linker protein
publication title Solution structure of the SH2 domain from mouse B-cell linker protein BLNK
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 19
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2eo6A01
4F5BA 1A1EA 1QG1E 5HKZA 2L3TA 1O4AA 1FMKA 5EELA 4EY0A 3HIZB 5IBSA 2AOAA 1O47A 3VRNA 2DM0A 2LNXA 5EEQA 1D4WA 1LCJA 1YVHA 2HCKA 3BUNB 2EL8A 1NZLA 2IUHA 1O4BA 2PTKA 3C7IA 5IBMA 4WWQA 1O42A 2KK6A 2L4KA 2GE9A 1P13A 2AUGA 1TCEA 1O4RA 1O4MA 3VS2A 3EAZA 3OP0A 1O4QA 3VS5A 1BLJA 4OHEA 2RVFA 2H8HA 4GL9E 1FBVA 5CDWA 2DX0A 2RORA 1OO3A 2ECDA 1O43A 1MILA 4OHLA 4P9VA 1FU5A 1QADA 1BMBA 2MK2A 3PQZA 2SHPA 1GHUA 1O4GA 2HDXA 1YVLA 2Y1NA 3UYOA 1BG1A 3BKBA 2EYZA 2DVJA 1SKJA 1BLKA 1MW4A 4EIHA 1O4JA 1F2FA 2AOBA 3TKZA 2MQIA 2FO0A 2PNAA 1HCSB 2C0TA 3UF4A 5D0JA 3VS6A 4DGXA 5HKYA 1O49A 3GXWA 3OV1A 4FL3A 3T04A 2MRJA 4ROJA 2PLDA 4FL2A 3M7FA 1AYCA 1SPSA 3CD3A 2PLEA 1BM2A 2RSYA 5AULA 2EU0A 1LKKA 3IMDA 4K44A 4F5AA 4DGPA 2CBLA 3OB1B 1SHAA 2IZVA 1KC2A 5I6VA 2H5KA 1D1ZA 1I3ZA 2EOBA 1A08A 4TZIA 1JU5A 1IJRA 4X6SA 1O45A 2LCTA 1IS0A 3OVEA 2RMXA 3KFJA 1R1QA 3S8OA 2HUWA 2LQNA 1GRIA 3VRPA 2LQWA 1O44A 1BHFA 5HKWA 1OPKA 5DC4A 1BHHB 3MAZA 1O4LA 3VS1A 1KA6A 5EG3B 1BF5A 1PICA 4E93A 4P9ZA 1WQUA 2ABLA 4U1PA 4LUDA 1KA7A 3TL0A 2B3OA 3BUOB 2OZOA 2L6KA 5EHRA 4OHDA 1HCTB 2MRKA 2C0OA 4E68A 1X27A 1QCFA 3PSJA 3S9KA 3OB2B 4NWGA 1B47A 2Y1MA 2C0IA 3BUXB 3NHNA 2C9WA 1FHSA 1CSYA 4U17A 5GJHA 2K7AB 3S8LA 5GJIA 5EHPA 4K11A 2YU7A 2JYQA 2EO3A 2DLZA 1OO4A 2KNOA 3MXCA 1JYRA 3VS7A 3PSKA 2CS0A 3EACA 2EKXA 1UUSA 3VGOA 1NRVA 3N7YA 3CBLA 1O4IA 1AOUF 1AB2A 1O4CA 1AD5A 1FU6A 4OHHA 1RQQC 3GQIB 4H1OA 1JYQA 1JYUA 3HCKA 3VRQA 1BKMA 1OPLA 3PS5A 1AYAA 1G83A 2HDVA 1Y1UA 2PNBA 2DLYA 5KAZA 1BKLA 2CR4A 1SPRA 2CIAA 2EYVA 1CJ1A 1XA6A 1K9AA 3PJPA 2CRHA 1AYBA 1X6CA 1A1CA 2LNWA 1O4HA 3GXXA 3HHMB 3MXYA 3PFVA 2CI9A 1A1AA 5DC0B 1JWOA 1NZVA 4QSYA 4L1BB 2MC1A 3VRZA 2EO6A 4A4BA 3N8MA 2EYYA 4H34A 1FYRA 2YSXA 1LUIA 2XP1A 4JEGA 1BFIA 5DF6A 1TZEE 1Y57A 1LUNA 3VS0A 4FBNA 2GSBA 1A07A 1FBZA 5J3XA 1AYDA 4F59A 4OHIA 3ZNIA 2IUIA 3US4A 1A1BA 4XZ0A 4JGHA 1LCKA 5DC9A 2SRCA 2HMHA 1H9OA 3N84A 1AOTF 1CWEA 2DCRA 1O41A 2ETZA 1X0NA 1LUMA 2VIFA 3VRRA 1RPYA 3K2MA 1O46A 1O4NA 1RJAA 4M4ZA 2BBUA 2CI8A 3PLFB 1O4OA 1M27A 1O4FA 3VS3A 3BUWB 3VRYA 3IN8A 3VROA 1SHBA 3WA4A 4XZ1A 2Y3AB 1Z3KA 4GWFA 1O48A 5AXIA 1KSWA 1LKLA 1O4EA 2H46E 1R1SA 3QWYA 1M61A 2QMSA 5BO4A 3IMJA 2IUGA 1ZFPE 1SHDA 1BHHA 1D4TA 1F1WA 3VS4A 4JE4A 1O4KA 1R1PA 1CSZA 3QWXX 4A4CA 1LUKA 2OQ1A 1O4PA 4LUEA 3S8NA 3CXLA 2K79B 4GPLB 4K2RA 1A09A 1BFJA 4NWFA 1UURA 1CWDL 4D8KA 1A81A 2FCIA 3IN7A 3BUMB 4K45A 1O4DA 3CWGA
chains in the Genus database with same CATH superfamily
4F5BA 1A1EA 1QG1E 5HKZA 2L3TA 3LYVA 1O4AA 1FMKA 5EELA 4EY0A 3HIZB 5IBSA 2AOAA 1O47A 3VRNA 2DM0A 2LNXA 5EEQA 1D4WA 1LCJA 1YVHA 2HCKA 3BUNB 2EL8A 1NZLA 2IUHA 1O4BA 2PTKA 3C7IA 5IBMA 4WWQA 1O42A 2KK6A 2L4KA 2GE9A 1P13A 2AUGA 1TCEA 1O4RA 1O4MA 3VS2A 3EAZA 3OP0A 1O4QA 3VS5A 1BLJA 4OHEA 2RVFA 2H8HA 4GL9E 1FBVA 5CDWA 2DX0A 2RORA 1OO3A 2ECDA 1O43A 1MILA 4OHLA 4P9VA 1FU5A 1QADA 1BMBA 2MK2A 3PQZA 2SHPA 1GHUA 1O4GA 2HDXA 1YVLA 2Y1NA 3UYOA 1BG1A 3BKBA 2EYZA 2DVJA 1SKJA 1BLKA 1MW4A 4EIHA 1O4JA 1F2FA 2AOBA 3K2TA 3TKZA 2MQIA 2FO0A 2PNAA 1HCSB 2C0TA 3UF4A 5D0JA 3VS6A 4DGXA 5HKYA 1O49A 3GXWA 3OV1A 4FL3A 3T04A 2MRJA 4ROJA 2PLDA 4FL2A 3M7FA 1AYCA 1SPSA 3CD3A 2PLEA 1BM2A 2RSYA 5AULA 2EU0A 1LKKA 3IMDA 4K44A 4F5AA 4DGPA 2CBLA 3OB1B 1SHAA 2IZVA 1KC2A 5I6VA 2H5KA 2LRAA 1D1ZA 1I3ZA 2EOBA 1A08A 4TZIA 1JU5A 1IJRA 4X6SA 1O45A 2LCTA 1IS0A 3OVEA 2RMXA 3KFJA 1R1QA 3S8OA 2HUWA 2LQNA 1GRIA 3VRPA 2LQWA 1O44A 1BHFA 5HKWA 1OPKA 5DC4A 1BHHB 3MAZA 1O4LA 3VS1A 1KA6A 5EG3B 1BF5A 1PICA 4E93A 4P9ZA 1WQUA 2ABLA 4U1PA 4LUDA 1KA7A 3TL0A 2B3OA 3BUOB 2OZOA 2L6KA 5EHRA 4OHDA 1HCTB 2MRKA 2C0OA 4E68A 1X27A 1QCFA 3PSJA 3S9KA 3OB2B 4NWGA 1B47A 2Y1MA 2C0IA 3BUXB 3NHNA 2C9WA 1FHSA 1CSYA 4U17A 5GJHA 2K7AB 3S8LA 5GJIA 5EHPA 4K11A 2YU7A 2JYQA 2EO3A 2DLZA 1OO4A 2KNOA 3MXCA 1JYRA 3VS7A 3PSKA 2CS0A 3EACA 2KGYA 2EKXA 1UUSA 3VGOA 1NRVA 3N7YA 3CBLA 1O4IA 1AOUF 1AB2A 1O4CA 1AD5A 1FU6A 4OHHA 1RQQC 3GQIB 4H1OA 1JYQA 1JYUA 3HCKA 3VRQA 1BKMA 1OPLA 3PS5A 1AYAA 1G83A 2HDVA 1Y1UA 2PNBA 2DLYA 5KAZA 1BKLA 2CR4A 1SPRA 2CIAA 2EYVA 1CJ1A 1XA6A 1K9AA 3PJPA 2CRHA 1AYBA 1X6CA 1A1CA 2LNWA 1O4HA 3GXXA 3HHMB 3MXYA 3PFVA 2CI9A 1A1AA 5DC0B 1JWOA 1NZVA 4QSYA 4L1BB 2MC1A 3VRZA 2EO6A 4A4BA 3N8MA 2EYYA 4H34A 1FYRA 2YSXA 1LUIA 2XP1A 4JEGA 1BFIA 5DF6A 1TZEE 1Y57A 1LUNA 3VS0A 4FBNA 2GSBA 1A07A 1FBZA 5J3XA 1AYDA 4F59A 4OHIA 3ZNIA 2IUIA 3US4A 1A1BA 4XZ0A 4JGHA 1LCKA 5DC9A 2SRCA 2HMHA 1H9OA 3N84A 1AOTF 1CWEA 2DCRA 1O41A 2ETZA 1X0NA 1LUMA 2VIFA 3VRRA 1RPYA 3K2MA 1O46A 1O4NA 1RJAA 4M4ZA 2BBUA 2CI8A 3PLFB 1O4OA 1M27A 1O4FA 3VS3A 3BUWB 3VRYA 3IN8A 3VROA 1SHBA 3WA4A 4XZ1A 2Y3AB 1Z3KA 4GWFA 1O48A 5AXIA 1KSWA 1LKLA 1O4EA 2H46E 1R1SA 3QWYA 1M61A 2QMSA 5BO4A 3IMJA 2IUGA 1ZFPE 1SHDA 1BHHA 1D4TA 1F1WA 3VS4A 4JE4A 1O4KA 1R1PA 1CSZA 3QWXX 4A4CA 1LUKA 2OQ1A 1O4PA 4LUEA 3S8NA 3CXLA 2K79B 4GPLB 4K2RA 1A09A 1BFJA 4NWFA 1UURA 1CWDL 4D8KA 1A81A 2FCIA 3IN7A 3BUMB 4K45A 1O4DA 3CWGA
chains in the Genus database with same CATH topology
4F5BA 1A1EA 1QG1E 5HKZA 2L3TA 1O4AA 1FMKA 5EELA 4EY0A 3HIZB 5IBSA 2AOAA 1O47A 3VRNA 2DM0A 2LNXA 5EEQA 1D4WA 1LCJA 1YVHA 2HCKA 3BUNB 2EL8A 1NZLA 2IUHA 1O4BA 2PTKA 3C7IA 5IBMA 4WWQA 1O42A 2KK6A 2L4KA 2GE9A 1P13A 2AUGA 1TCEA 1O4RA 1O4MA 3VS2A 3EAZA 3OP0A 1O4QA 3VS5A 1BLJA 4OHEA 2RVFA 2H8HA 4GL9E 1FBVA 5CDWA 2DX0A 2RORA 1OO3A 2ECDA 1O43A 1MILA 4OHLA 4P9VA 1FU5A 1QADA 1BMBA 2MK2A 3PQZA 2SHPA 1GHUA 1O4GA 2HDXA 1YVLA 2Y1NA 3UYOA 1BG1A 3BKBA 2EYZA 2DVJA 1SKJA 1BLKA 1MW4A 4EIHA 1O4JA 1F2FA 2AOBA 3TKZA 2MQIA 2FO0A 2PNAA 1HCSB 2C0TA 3UF4A 5D0JA 3VS6A 4DGXA 5HKYA 1O49A 3GXWA 3OV1A 4FL3A 3T04A 2MRJA 4ROJA 2PLDA 4FL2A 3M7FA 1AYCA 1SPSA 3CD3A 2PLEA 1BM2A 2RSYA 5AULA 2EU0A 1LKKA 3IMDA 4K44A 4F5AA 4DGPA 2CBLA 3OB1B 1SHAA 2IZVA 1KC2A 5I6VA 2H5KA 1D1ZA 1I3ZA 2EOBA 1A08A 4TZIA 1JU5A 1IJRA 4X6SA 1O45A 2LCTA 1IS0A 3OVEA 2RMXA 3KFJA 1R1QA 3S8OA 2HUWA 2LQNA 1GRIA 3VRPA 2LQWA 1O44A 1BHFA 5HKWA 1OPKA 5DC4A 1BHHB 3MAZA 1O4LA 3VS1A 1KA6A 5EG3B 1BF5A 1PICA 4E93A 4P9ZA 1WQUA 2ABLA 4U1PA 4LUDA 1KA7A 3TL0A 2B3OA 3BUOB 2OZOA 2L6KA 5EHRA 4OHDA 1HCTB 2MRKA 2C0OA 4E68A 1X27A 1QCFA 3PSJA 3S9KA 3OB2B 4NWGA 1B47A 2Y1MA 2C0IA 3BUXB 3NHNA 2C9WA 1FHSA 1CSYA 4U17A 5GJHA 2K7AB 3S8LA 5GJIA 5EHPA 4K11A 2YU7A 2JYQA 2EO3A 2DLZA 1OO4A 2KNOA 3MXCA 1JYRA 3VS7A 3PSKA 2CS0A 3EACA 2EKXA 1UUSA 3VGOA 1NRVA 3N7YA 3CBLA 1O4IA 1AOUF 1AB2A 1O4CA 1AD5A 1FU6A 4OHHA 1RQQC 3GQIB 4H1OA 1JYQA 1JYUA 3HCKA 3VRQA 1BKMA 1OPLA 3PS5A 1AYAA 1G83A 2HDVA 1Y1UA 2PNBA 2DLYA 5KAZA 1BKLA 2CR4A 1SPRA 2CIAA 2EYVA 1CJ1A 1XA6A 1K9AA 3PJPA 2CRHA 1AYBA 1X6CA 1A1CA 2LNWA 1O4HA 3GXXA 3HHMB 3MXYA 3PFVA 2CI9A 1A1AA 5DC0B 1JWOA 1NZVA 4QSYA 4L1BB 2MC1A 3VRZA 2EO6A 4A4BA 3N8MA 2EYYA 4H34A 1FYRA 2YSXA 1LUIA 2XP1A 4JEGA 1BFIA 5DF6A 1TZEE 1Y57A 1LUNA 3VS0A 4FBNA 2GSBA 1A07A 1FBZA 5J3XA 1AYDA 4F59A 4OHIA 3ZNIA 2IUIA 3US4A 1A1BA 4XZ0A 4JGHA 1LCKA 5DC9A 2SRCA 2HMHA 1H9OA 3N84A 1AOTF 1CWEA 2DCRA 1O41A 2ETZA 1X0NA 1LUMA 2VIFA 3VRRA 1RPYA 3K2MA 1O46A 1O4NA 1RJAA 4M4ZA 2BBUA 2CI8A 3PLFB 1O4OA 1M27A 1O4FA 3VS3A 3BUWB 3VRYA 3IN8A 3VROA 1SHBA 3WA4A 4XZ1A 2Y3AB 1Z3KA 4GWFA 1O48A 5AXIA 1KSWA 1LKLA 1O4EA 2H46E 1R1SA 3QWYA 1M61A 2QMSA 5BO4A 3IMJA 2IUGA 1ZFPE 1SHDA 1BHHA 1D4TA 1F1WA 3VS4A 4JE4A 1O4KA 1R1PA 1CSZA 3QWXX 4A4CA 1LUKA 2OQ1A 1O4PA 4LUEA 3S8NA 3CXLA 2K79B 4GPLB 4K2RA 1A09A 1BFJA 4NWFA 1UURA 1CWDL 4D8KA 1A81A 2FCIA 3IN7A 3BUMB 4K45A 1O4DA 3CWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F5B A;  1A1E A;  1QG1 E;  5HKZ A;  2L3T A;  1O4A A;  1FMK A;  5EEL A;  4EY0 A;  3HIZ B;  5IBS A;  2AOA A;  1O47 A;  3VRN A;  2DM0 A;  2LNX A;  5EEQ A;  1D4W A;  1LCJ A;  1YVH A;  2HCK A;  3BUN B;  2EL8 A;  1NZL A;  2IUH A;  1O4B A;  2PTK A;  3C7I A;  5IBM A;  4WWQ A;  1O42 A;  2KK6 A;  2L4K A;  2GE9 A;  1P13 A;  2AUG A;  1TCE A;  1O4R A;  1O4M A;  3VS2 A;  3EAZ A;  3OP0 A;  1O4Q A;  3VS5 A;  1BLJ A;  4OHE A;  2RVF A;  2H8H A;  4GL9 E;  1FBV A;  5CDW A;  2DX0 A;  2ROR A;  1OO3 A;  2ECD A;  1O43 A;  1MIL A;  4OHL A;  4P9V A;  1FU5 A;  1QAD A;  1BMB A;  2MK2 A;  3PQZ A;  2SHP A;  1GHU A;  1O4G A;  2HDX A;  1YVL A;  2Y1N A;  3UYO A;  1BG1 A;  3BKB A;  2EYZ A;  2DVJ A;  1SKJ A;  1BLK A;  1MW4 A;  4EIH A;  1O4J A;  1F2F A;  2AOB A;  3TKZ A;  2MQI A;  2FO0 A;  2PNA A;  1HCS B;  2C0T A;  3UF4 A;  5D0J A;  3VS6 A;  4DGX A;  5HKY A;  1O49 A;  3GXW A;  3OV1 A;  4FL3 A;  3T04 A;  2MRJ A;  4ROJ A;  2PLD A;  4FL2 A;  3M7F A;  1AYC A;  1SPS A;  3CD3 A;  2PLE A;  1BM2 A;  2RSY A;  5AUL A;  2EU0 A;  1LKK A;  3IMD A;  4K44 A;  4F5A A;  4DGP A;  2CBL A;  3OB1 B;  1SHA A;  2IZV A;  1KC2 A;  5I6V A;  2H5K A;  1D1Z A;  1I3Z A;  2EOB A;  1A08 A;  4TZI A;  1JU5 A;  1IJR A;  4X6S A;  1O45 A;  2LCT A;  1IS0 A;  3OVE A;  2RMX A;  3KFJ A;  1R1Q A;  3S8O A;  2HUW A;  2LQN A;  1GRI A;  3VRP A;  2LQW A;  1O44 A;  1BHF A;  5HKW A;  1OPK A;  5DC4 A;  1BHH B;  3MAZ A;  1O4L A;  3VS1 A;  1KA6 A;  5EG3 B;  1BF5 A;  1PIC A;  4E93 A;  4P9Z A;  1WQU A;  2ABL A;  4U1P A;  4LUD A;  1KA7 A;  3TL0 A;  2B3O A;  3BUO B;  2OZO A;  2L6K A;  5EHR A;  4OHD A;  1HCT B;  2MRK A;  2C0O A;  4E68 A;  1X27 A;  1QCF A;  3PSJ A;  3S9K A;  3OB2 B;  4NWG A;  1B47 A;  2Y1M A;  2C0I A;  3BUX B;  3NHN A;  2C9W A;  1FHS A;  1CSY A;  4U17 A;  5GJH A;  2K7A B;  3S8L A;  5GJI A;  5EHP A;  4K11 A;  2YU7 A;  2JYQ A;  2EO3 A;  2DLZ A;  1OO4 A;  2KNO A;  3MXC A;  1JYR A;  3VS7 A;  3PSK A;  2CS0 A;  3EAC A;  2EKX A;  1UUS A;  3VGO A;  1NRV A;  3N7Y A;  3CBL A;  1O4I A;  1AOU F;  1AB2 A;  1O4C A;  1AD5 A;  1FU6 A;  4OHH A;  1RQQ C;  3GQI B;  4H1O A;  1JYQ A;  1JYU A;  3HCK A;  3VRQ A;  1BKM A;  1OPL A;  3PS5 A;  1AYA A;  1G83 A;  2HDV A;  1Y1U A;  2PNB A;  2DLY A;  5KAZ A;  1BKL A;  2CR4 A;  1SPR A;  2CIA A;  2EYV A;  1CJ1 A;  1XA6 A;  1K9A A;  3PJP A;  2CRH A;  1AYB A;  1X6C A;  1A1C A;  2LNW A;  1O4H A;  3GXX A;  3HHM B;  3MXY A;  3PFV A;  2CI9 A;  1A1A A;  5DC0 B;  1JWO A;  1NZV A;  4QSY A;  4L1B B;  2MC1 A;  3VRZ A;  2EO6 A;  4A4B A;  3N8M A;  2EYY A;  4H34 A;  1FYR A;  2YSX A;  1LUI A;  2XP1 A;  4JEG A;  1BFI A;  5DF6 A;  1TZE E;  1Y57 A;  1LUN A;  3VS0 A;  4FBN A;  2GSB A;  1A07 A;  1FBZ A;  5J3X A;  1AYD A;  4F59 A;  4OHI A;  3ZNI A;  2IUI A;  3US4 A;  1A1B A;  4XZ0 A;  4JGH A;  1LCK A;  5DC9 A;  2SRC A;  2HMH A;  1H9O A;  3N84 A;  1AOT F;  1CWE A;  2DCR A;  1O41 A;  2ETZ A;  1X0N A;  1LUM A;  2VIF A;  3VRR A;  1RPY A;  3K2M A;  1O46 A;  1O4N A;  1RJA A;  4M4Z A;  2BBU A;  2CI8 A;  3PLF B;  1O4O A;  1M27 A;  1O4F A;  3VS3 A;  3BUW B;  3VRY A;  3IN8 A;  3VRO A;  1SHB A;  3WA4 A;  4XZ1 A;  2Y3A B;  1Z3K A;  4GWF A;  1O48 A;  5AXI A;  1KSW A;  1LKL A;  1O4E A;  2H46 E;  1R1S A;  3QWY A;  1M61 A;  2QMS A;  5BO4 A;  3IMJ A;  2IUG A;  1ZFP E;  1SHD A;  1BHH A;  1D4T A;  1F1W A;  3VS4 A;  4JE4 A;  1O4K A;  1R1P A;  1CSZ A;  3QWX X;  4A4C A;  1LUK A;  2OQ1 A;  1O4P A;  4LUE A;  3S8N A;  3CXL A;  2K79 B;  4GPL B;  4K2R A;  1A09 A;  1BFJ A;  4NWF A;  1UUR A;  1CWD L;  4D8K A;  1A81 A;  2FCI A;  3IN7 A;  3BUM B;  4K45 A;  1O4D A;  3CWG A; 
#chains in the Genus database with same CATH topology
 4F5B A;  1A1E A;  1QG1 E;  5HKZ A;  2L3T A;  3LYV A;  1O4A A;  1FMK A;  5EEL A;  4EY0 A;  3HIZ B;  5IBS A;  2AOA A;  1O47 A;  3VRN A;  2DM0 A;  2LNX A;  5EEQ A;  1D4W A;  1LCJ A;  1YVH A;  2HCK A;  3BUN B;  2EL8 A;  1NZL A;  2IUH A;  1O4B A;  2PTK A;  3C7I A;  5IBM A;  4WWQ A;  1O42 A;  2KK6 A;  2L4K A;  2GE9 A;  1P13 A;  2AUG A;  1TCE A;  1O4R A;  1O4M A;  3VS2 A;  3EAZ A;  3OP0 A;  1O4Q A;  3VS5 A;  1BLJ A;  4OHE A;  2RVF A;  2H8H A;  4GL9 E;  1FBV A;  5CDW A;  2DX0 A;  2ROR A;  1OO3 A;  2ECD A;  1O43 A;  1MIL A;  4OHL A;  4P9V A;  1FU5 A;  1QAD A;  1BMB A;  2MK2 A;  3PQZ A;  2SHP A;  1GHU A;  1O4G A;  2HDX A;  1YVL A;  2Y1N A;  3UYO A;  1BG1 A;  3BKB A;  2EYZ A;  2DVJ A;  1SKJ A;  1BLK A;  1MW4 A;  4EIH A;  1O4J A;  1F2F A;  2AOB A;  3K2T A;  3TKZ A;  2MQI A;  2FO0 A;  2PNA A;  1HCS B;  2C0T A;  3UF4 A;  5D0J A;  3VS6 A;  4DGX A;  5HKY A;  1O49 A;  3GXW A;  3OV1 A;  4FL3 A;  3T04 A;  2MRJ A;  4ROJ A;  2PLD A;  4FL2 A;  3M7F A;  1AYC A;  1SPS A;  3CD3 A;  2PLE A;  1BM2 A;  2RSY A;  5AUL A;  2EU0 A;  1LKK A;  3IMD A;  4K44 A;  4F5A A;  4DGP A;  2CBL A;  3OB1 B;  1SHA A;  2IZV A;  1KC2 A;  5I6V A;  2H5K A;  2LRA A;  1D1Z A;  1I3Z A;  2EOB A;  1A08 A;  4TZI A;  1JU5 A;  1IJR A;  4X6S A;  1O45 A;  2LCT A;  1IS0 A;  3OVE A;  2RMX A;  3KFJ A;  1R1Q A;  3S8O A;  2HUW A;  2LQN A;  1GRI A;  3VRP A;  2LQW A;  1O44 A;  1BHF A;  5HKW A;  1OPK A;  5DC4 A;  1BHH B;  3MAZ A;  1O4L A;  3VS1 A;  1KA6 A;  5EG3 B;  1BF5 A;  1PIC A;  4E93 A;  4P9Z A;  1WQU A;  2ABL A;  4U1P A;  4LUD A;  1KA7 A;  3TL0 A;  2B3O A;  3BUO B;  2OZO A;  2L6K A;  5EHR A;  4OHD A;  1HCT B;  2MRK A;  2C0O A;  4E68 A;  1X27 A;  1QCF A;  3PSJ A;  3S9K A;  3OB2 B;  4NWG A;  1B47 A;  2Y1M A;  2C0I A;  3BUX B;  3NHN A;  2C9W A;  1FHS A;  1CSY A;  4U17 A;  5GJH A;  2K7A B;  3S8L A;  5GJI A;  5EHP A;  4K11 A;  2YU7 A;  2JYQ A;  2EO3 A;  2DLZ A;  1OO4 A;  2KNO A;  3MXC A;  1JYR A;  3VS7 A;  3PSK A;  2CS0 A;  3EAC A;  2KGY A;  2EKX A;  1UUS A;  3VGO A;  1NRV A;  3N7Y A;  3CBL A;  1O4I A;  1AOU F;  1AB2 A;  1O4C A;  1AD5 A;  1FU6 A;  4OHH A;  1RQQ C;  3GQI B;  4H1O A;  1JYQ A;  1JYU A;  3HCK A;  3VRQ A;  1BKM A;  1OPL A;  3PS5 A;  1AYA A;  1G83 A;  2HDV A;  1Y1U A;  2PNB A;  2DLY A;  5KAZ A;  1BKL A;  2CR4 A;  1SPR A;  2CIA A;  2EYV A;  1CJ1 A;  1XA6 A;  1K9A A;  3PJP A;  2CRH A;  1AYB A;  1X6C A;  1A1C A;  2LNW A;  1O4H A;  3GXX A;  3HHM B;  3MXY A;  3PFV A;  2CI9 A;  1A1A A;  5DC0 B;  1JWO A;  1NZV A;  4QSY A;  4L1B B;  2MC1 A;  3VRZ A;  2EO6 A;  4A4B A;  3N8M A;  2EYY A;  4H34 A;  1FYR A;  2YSX A;  1LUI A;  2XP1 A;  4JEG A;  1BFI A;  5DF6 A;  1TZE E;  1Y57 A;  1LUN A;  3VS0 A;  4FBN A;  2GSB A;  1A07 A;  1FBZ A;  5J3X A;  1AYD A;  4F59 A;  4OHI A;  3ZNI A;  2IUI A;  3US4 A;  1A1B A;  4XZ0 A;  4JGH A;  1LCK A;  5DC9 A;  2SRC A;  2HMH A;  1H9O A;  3N84 A;  1AOT F;  1CWE A;  2DCR A;  1O41 A;  2ETZ A;  1X0N A;  1LUM A;  2VIF A;  3VRR A;  1RPY A;  3K2M A;  1O46 A;  1O4N A;  1RJA A;  4M4Z A;  2BBU A;  2CI8 A;  3PLF B;  1O4O A;  1M27 A;  1O4F A;  3VS3 A;  3BUW B;  3VRY A;  3IN8 A;  3VRO A;  1SHB A;  3WA4 A;  4XZ1 A;  2Y3A B;  1Z3K A;  4GWF A;  1O48 A;  5AXI A;  1KSW A;  1LKL A;  1O4E A;  2H46 E;  1R1S A;  3QWY A;  1M61 A;  2QMS A;  5BO4 A;  3IMJ A;  2IUG A;  1ZFP E;  1SHD A;  1BHH A;  1D4T A;  1F1W A;  3VS4 A;  4JE4 A;  1O4K A;  1R1P A;  1CSZ A;  3QWX X;  4A4C A;  1LUK A;  2OQ1 A;  1O4P A;  4LUE A;  3S8N A;  3CXL A;  2K79 B;  4GPL B;  4K2R A;  1A09 A;  1BFJ A;  4NWF A;  1UUR A;  1CWD L;  4D8K A;  1A81 A;  2FCI A;  3IN7 A;  3BUM B;  4K45 A;  1O4D A;  3CWG A; 
#chains in the Genus database with same CATH homology
 4F5B A;  1A1E A;  1QG1 E;  5HKZ A;  2L3T A;  1O4A A;  1FMK A;  5EEL A;  4EY0 A;  3HIZ B;  5IBS A;  2AOA A;  1O47 A;  3VRN A;  2DM0 A;  2LNX A;  5EEQ A;  1D4W A;  1LCJ A;  1YVH A;  2HCK A;  3BUN B;  2EL8 A;  1NZL A;  2IUH A;  1O4B A;  2PTK A;  3C7I A;  5IBM A;  4WWQ A;  1O42 A;  2KK6 A;  2L4K A;  2GE9 A;  1P13 A;  2AUG A;  1TCE A;  1O4R A;  1O4M A;  3VS2 A;  3EAZ A;  3OP0 A;  1O4Q A;  3VS5 A;  1BLJ A;  4OHE A;  2RVF A;  2H8H A;  4GL9 E;  1FBV A;  5CDW A;  2DX0 A;  2ROR A;  1OO3 A;  2ECD A;  1O43 A;  1MIL A;  4OHL A;  4P9V A;  1FU5 A;  1QAD A;  1BMB A;  2MK2 A;  3PQZ A;  2SHP A;  1GHU A;  1O4G A;  2HDX A;  1YVL A;  2Y1N A;  3UYO A;  1BG1 A;  3BKB A;  2EYZ A;  2DVJ A;  1SKJ A;  1BLK A;  1MW4 A;  4EIH A;  1O4J A;  1F2F A;  2AOB A;  3TKZ A;  2MQI A;  2FO0 A;  2PNA A;  1HCS B;  2C0T A;  3UF4 A;  5D0J A;  3VS6 A;  4DGX A;  5HKY A;  1O49 A;  3GXW A;  3OV1 A;  4FL3 A;  3T04 A;  2MRJ A;  4ROJ A;  2PLD A;  4FL2 A;  3M7F A;  1AYC A;  1SPS A;  3CD3 A;  2PLE A;  1BM2 A;  2RSY A;  5AUL A;  2EU0 A;  1LKK A;  3IMD A;  4K44 A;  4F5A A;  4DGP A;  2CBL A;  3OB1 B;  1SHA A;  2IZV A;  1KC2 A;  5I6V A;  2H5K A;  1D1Z A;  1I3Z A;  2EOB A;  1A08 A;  4TZI A;  1JU5 A;  1IJR A;  4X6S A;  1O45 A;  2LCT A;  1IS0 A;  3OVE A;  2RMX A;  3KFJ A;  1R1Q A;  3S8O A;  2HUW A;  2LQN A;  1GRI A;  3VRP A;  2LQW A;  1O44 A;  1BHF A;  5HKW A;  1OPK A;  5DC4 A;  1BHH B;  3MAZ A;  1O4L A;  3VS1 A;  1KA6 A;  5EG3 B;  1BF5 A;  1PIC A;  4E93 A;  4P9Z A;  1WQU A;  2ABL A;  4U1P A;  4LUD A;  1KA7 A;  3TL0 A;  2B3O A;  3BUO B;  2OZO A;  2L6K A;  5EHR A;  4OHD A;  1HCT B;  2MRK A;  2C0O A;  4E68 A;  1X27 A;  1QCF A;  3PSJ A;  3S9K A;  3OB2 B;  4NWG A;  1B47 A;  2Y1M A;  2C0I A;  3BUX B;  3NHN A;  2C9W A;  1FHS A;  1CSY A;  4U17 A;  5GJH A;  2K7A B;  3S8L A;  5GJI A;  5EHP A;  4K11 A;  2YU7 A;  2JYQ A;  2EO3 A;  2DLZ A;  1OO4 A;  2KNO A;  3MXC A;  1JYR A;  3VS7 A;  3PSK A;  2CS0 A;  3EAC A;  2EKX A;  1UUS A;  3VGO A;  1NRV A;  3N7Y A;  3CBL A;  1O4I A;  1AOU F;  1AB2 A;  1O4C A;  1AD5 A;  1FU6 A;  4OHH A;  1RQQ C;  3GQI B;  4H1O A;  1JYQ A;  1JYU A;  3HCK A;  3VRQ A;  1BKM A;  1OPL A;  3PS5 A;  1AYA A;  1G83 A;  2HDV A;  1Y1U A;  2PNB A;  2DLY A;  5KAZ A;  1BKL A;  2CR4 A;  1SPR A;  2CIA A;  2EYV A;  1CJ1 A;  1XA6 A;  1K9A A;  3PJP A;  2CRH A;  1AYB A;  1X6C A;  1A1C A;  2LNW A;  1O4H A;  3GXX A;  3HHM B;  3MXY A;  3PFV A;  2CI9 A;  1A1A A;  5DC0 B;  1JWO A;  1NZV A;  4QSY A;  4L1B B;  2MC1 A;  3VRZ A;  2EO6 A;  4A4B A;  3N8M A;  2EYY A;  4H34 A;  1FYR A;  2YSX A;  1LUI A;  2XP1 A;  4JEG A;  1BFI A;  5DF6 A;  1TZE E;  1Y57 A;  1LUN A;  3VS0 A;  4FBN A;  2GSB A;  1A07 A;  1FBZ A;  5J3X A;  1AYD A;  4F59 A;  4OHI A;  3ZNI A;  2IUI A;  3US4 A;  1A1B A;  4XZ0 A;  4JGH A;  1LCK A;  5DC9 A;  2SRC A;  2HMH A;  1H9O A;  3N84 A;  1AOT F;  1CWE A;  2DCR A;  1O41 A;  2ETZ A;  1X0N A;  1LUM A;  2VIF A;  3VRR A;  1RPY A;  3K2M A;  1O46 A;  1O4N A;  1RJA A;  4M4Z A;  2BBU A;  2CI8 A;  3PLF B;  1O4O A;  1M27 A;  1O4F A;  3VS3 A;  3BUW B;  3VRY A;  3IN8 A;  3VRO A;  1SHB A;  3WA4 A;  4XZ1 A;  2Y3A B;  1Z3K A;  4GWF A;  1O48 A;  5AXI A;  1KSW A;  1LKL A;  1O4E A;  2H46 E;  1R1S A;  3QWY A;  1M61 A;  2QMS A;  5BO4 A;  3IMJ A;  2IUG A;  1ZFP E;  1SHD A;  1BHH A;  1D4T A;  1F1W A;  3VS4 A;  4JE4 A;  1O4K A;  1R1P A;  1CSZ A;  3QWX X;  4A4C A;  1LUK A;  2OQ1 A;  1O4P A;  4LUE A;  3S8N A;  3CXL A;  2K79 B;  4GPL B;  4K2R A;  1A09 A;  1BFJ A;  4NWF A;  1UUR A;  1CWD L;  4D8K A;  1A81 A;  2FCI A;  3IN7 A;  3BUM B;  4K45 A;  1O4D A;  3CWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...