3S8NA

Crystal structure of the grb2 sh2 domain in complex with a pyxn-derived tripeptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
101
structure length
101
Chain Sequence
EMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/antagonist
molecule keywords Growth factor receptor-bound protein 2
publication title Protein-ligand interactions: thermodynamic effects associated with increasing nonpolar surface area.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3s8nA00
2HDXA 1R1SA 1O4PA 3KFJA 1BKLA 4OHHA 1LCJA 3S8OA 3MAZA 3TKZA 1CWDL 3QWXX 3PS5A 1A07A 3N84A 1O4BA 3CBLA 1SKJA 4E93A 2Y3AB 3GXWA 2K7AB 2CBLA 1IJRA 3VGOA 1KC2A 3IN8A 3OB2B 3MXCA 1AYAA 1O4HA 1A81A 2EKXA 2SRCA 4P9VA 1FBZA 2ECDA 1OPLA 5AULA 3CD3A 1O4NA 2H5KA 1HCSB 2RMXA 4JE4A 1CSZA 4JEGA 1JYQA 2MC1A 5EHRA 1O48A 4TZIA 1KA7A 1BHHA 1OO3A 1RQQC 4DGPA 2EYVA 3MXYA 5I6VA 3GQIB 2RORA 2PNBA 5D0JA 3GXXA 2YSXA 2HDVA 2KK6A 1ZFPE 3BUOB 2L3TA 1D4WA 4GWFA 2PTKA 2DLYA 3VRNA 2DVJA 1SHDA 1O4OA 2MK2A 4K2RA 2EO3A 1O4QA 1FU6A 4U17A 5DC9A 5EEQA 1F1WA 2ETZA 1K9AA 1TCEA 3VRZA 1BLJA 1AD5A 5EG3B 4L1BB 2RSYA 3VS5A 1I3ZA 2LNWA 2GSBA 4JGHA 1X6CA 2DX0A 4X6SA 3N8MA 2CR4A 1O41A 2Y1NA 1LKLA 2SHPA 1OO4A 1GRIA 1OPKA 4XZ0A 5KAZA 3VS2A 2LQWA 1FBVA 5IBSA 5HKZA 1O49A 1CSYA 3TL0A 1D1ZA 1O46A 1AOTF 1WQUA 4LUDA 3PSKA 2CIAA 3CXLA 3NHNA 1QADA 3M7FA 1BFJA 3N7YA 4OHLA 2IUGA 5HKWA 1YVHA 1O4AA 2DCRA 5J3XA 1NZLA 3QWYA 4F59A 1O42A 1FU5A 1O4KA 1X27A 3BUWB 1M27A 1QG1E 1O4EA 2OQ1A 2GE9A 3OVEA 3US4A 1TZEE 3EACA 1A1BA 1KSWA 1O44A 2IUHA 2EYZA 1FHSA 1O43A 2CRHA 3PSJA 1O4JA 2FO0A 3UYOA 2DLZA 3VS7A 4DGXA 2RVFA 1GHUA 2K79B 1B47A 1JYRA 1JYUA 1QCFA 2IUIA 1CJ1A 1D4TA 1LUMA 2EYYA 1AB2A 4K11A 1H9OA 3T04A 1BMBA 5EELA 3EAZA 1BLKA 4OHDA 3OB1B 1JWOA 2LQNA 1SPSA 2FCIA 1SHAA 1Y57A 5DF6A 1LUKA 3BUMB 4H34A 3OP0A 2OZOA 4F5AA 2C9WA 2YU7A 1M61A 5DC4A 1BFIA 1UUSA 1A09A 1O4CA 2HUWA 3VROA 2LNXA 3PQZA 1O4RA 3PFVA 3VS6A 2JYQA 4A4CA 5HKYA 1BF5A 1O4DA 1O4FA 2MQIA 2C0IA 2VIFA 1LUNA 3UF4A 3IMDA 1X0NA 1AYBA 2IZVA 2EOBA 1A1EA 1UURA 2AUGA 4U1PA 3VRYA 1AYCA 1HCTB 3HIZB 1PICA 4K44A 1Z3KA 5CDWA 1A1CA 2C0OA 1IS0A 2CS0A 3HCKA 2AOBA 1LKKA 2AOAA 1BHHB 4OHEA 1CWEA 5GJHA 1R1PA 1O4IA 2EL8A 2L4KA 4XZ1A 1BKMA 1O45A 2XP1A 3IN7A 3HHMB 5AXIA 1NRVA 4NWGA 3VS3A 3PJPA 4H1OA 2H8HA 3S8LA 1JU5A 3VRRA 2HMHA 2C0TA 4WWQA 1O47A 3VRQA 1NZVA 1KA6A 2ABLA 4GL9E 2EO6A 2QMSA 1FYRA 4NWFA 1YVLA 4ROJA 3IMJA 1O4GA 1SPRA 3S8NA 2BBUA 1O4LA 4FL3A 5IBMA 4OHIA 2KNOA 4F5BA 2PNAA 2PLDA 2L6KA 4E68A 2HCKA 4K45A 4LUEA 2H46E 4EIHA 3CWGA 3K2MA 1MW4A 5BO4A 3VS0A 2B3OA 1A1AA 1P13A 3WA4A 2CI8A 3S9KA 4A4BA 1BG1A 3C7IA 1BM2A 2MRJA 4P9ZA 4D8KA 3ZNIA 3OV1A 1G83A 1LUIA 3VS1A 2CI9A 2EU0A 4GPLB 2MRKA 4M4ZA 1FMKA 2LCTA 3BUXB 3BKBA 1R1QA 1Y1UA 3VRPA 3VS4A 2Y1MA 4EY0A 1RPYA 1BHFA 2DM0A 4FL2A 2PLEA 4QSYA 5DC0B 3PLFB 1F2FA 1A08A 1O4MA 4FBNA 1SHBA 5GJIA 1AOUF 1XA6A 1LCKA 1RJAA 1AYDA 1MILA 5EHPA 3BUNB
chains in the Genus database with same CATH superfamily
2HDXA 1R1SA 1O4PA 3KFJA 1BKLA 4OHHA 1LCJA 3S8OA 3MAZA 3TKZA 1CWDL 3QWXX 3PS5A 1A07A 3N84A 1O4BA 3CBLA 1SKJA 4E93A 2Y3AB 3GXWA 2K7AB 2CBLA 1IJRA 3VGOA 1KC2A 3IN8A 3OB2B 3MXCA 1AYAA 1O4HA 1A81A 2EKXA 2SRCA 4P9VA 1FBZA 2ECDA 1OPLA 5AULA 3CD3A 1O4NA 2H5KA 1HCSB 2RMXA 4JE4A 1CSZA 4JEGA 1JYQA 2MC1A 5EHRA 1O48A 4TZIA 1KA7A 1BHHA 1OO3A 1RQQC 4DGPA 2EYVA 3MXYA 5I6VA 3GQIB 2RORA 2PNBA 5D0JA 3GXXA 2YSXA 2HDVA 2KK6A 1ZFPE 3BUOB 2L3TA 1D4WA 4GWFA 2PTKA 2DLYA 3VRNA 2DVJA 1SHDA 1O4OA 2MK2A 4K2RA 2EO3A 1O4QA 1FU6A 4U17A 5DC9A 5EEQA 1F1WA 2ETZA 1K9AA 1TCEA 3VRZA 1BLJA 1AD5A 5EG3B 4L1BB 2RSYA 3VS5A 1I3ZA 2LNWA 2GSBA 4JGHA 1X6CA 2DX0A 4X6SA 3N8MA 2CR4A 1O41A 2Y1NA 1LKLA 2SHPA 1OO4A 1GRIA 1OPKA 4XZ0A 5KAZA 3VS2A 2LQWA 1FBVA 5IBSA 5HKZA 1O49A 1CSYA 3TL0A 1D1ZA 1O46A 1AOTF 1WQUA 4LUDA 3PSKA 2CIAA 3CXLA 3NHNA 1QADA 3M7FA 1BFJA 3N7YA 4OHLA 2IUGA 5HKWA 1YVHA 1O4AA 2DCRA 5J3XA 1NZLA 3QWYA 4F59A 1O42A 1FU5A 1O4KA 1X27A 3BUWB 1M27A 1QG1E 1O4EA 2OQ1A 2GE9A 3OVEA 3US4A 1TZEE 3EACA 1A1BA 1KSWA 1O44A 2IUHA 2EYZA 1FHSA 1O43A 2CRHA 3PSJA 1O4JA 2FO0A 3UYOA 2DLZA 3VS7A 4DGXA 2RVFA 1GHUA 2K79B 1B47A 1JYRA 1JYUA 1QCFA 2IUIA 1CJ1A 1D4TA 1LUMA 2EYYA 1AB2A 4K11A 1H9OA 3T04A 1BMBA 5EELA 3EAZA 1BLKA 4OHDA 3OB1B 1JWOA 2LQNA 1SPSA 2FCIA 1SHAA 1Y57A 5DF6A 1LUKA 3BUMB 4H34A 3OP0A 2OZOA 4F5AA 2C9WA 2YU7A 2KGYA 1M61A 5DC4A 1BFIA 1UUSA 1A09A 1O4CA 2HUWA 3VROA 2LNXA 3PQZA 1O4RA 3PFVA 3VS6A 2JYQA 4A4CA 5HKYA 1BF5A 1O4DA 1O4FA 2MQIA 2C0IA 2VIFA 3LYVA 1LUNA 3UF4A 3IMDA 1X0NA 1AYBA 2IZVA 2EOBA 1A1EA 1UURA 2AUGA 4U1PA 3VRYA 1AYCA 1HCTB 3HIZB 1PICA 4K44A 1Z3KA 2LRAA 5CDWA 1A1CA 2C0OA 1IS0A 2CS0A 3HCKA 2AOBA 1LKKA 2AOAA 1BHHB 4OHEA 1CWEA 5GJHA 1R1PA 1O4IA 2EL8A 2L4KA 4XZ1A 1BKMA 1O45A 2XP1A 3IN7A 3HHMB 5AXIA 1NRVA 4NWGA 3VS3A 3PJPA 4H1OA 2H8HA 3S8LA 1JU5A 3VRRA 2HMHA 2C0TA 4WWQA 1O47A 3VRQA 1NZVA 1KA6A 2ABLA 4GL9E 2EO6A 2QMSA 1FYRA 4NWFA 1YVLA 4ROJA 3IMJA 1O4GA 1SPRA 3S8NA 2BBUA 1O4LA 4FL3A 5IBMA 4OHIA 2KNOA 4F5BA 2PNAA 2PLDA 2L6KA 4E68A 2HCKA 4K45A 4LUEA 2H46E 3K2TA 4EIHA 3CWGA 3K2MA 1MW4A 5BO4A 3VS0A 2B3OA 1A1AA 1P13A 3WA4A 2CI8A 3S9KA 4A4BA 1BG1A 3C7IA 1BM2A 2MRJA 4P9ZA 4D8KA 3ZNIA 3OV1A 1G83A 1LUIA 3VS1A 2CI9A 2EU0A 4GPLB 2MRKA 4M4ZA 1FMKA 2LCTA 3BUXB 3BKBA 1R1QA 1Y1UA 3VRPA 3VS4A 2Y1MA 4EY0A 1RPYA 1BHFA 2DM0A 4FL2A 2PLEA 4QSYA 5DC0B 3PLFB 1F2FA 1A08A 1O4MA 4FBNA 1SHBA 5GJIA 1AOUF 1XA6A 1LCKA 1RJAA 1AYDA 1MILA 5EHPA 3BUNB
chains in the Genus database with same CATH topology
2HDXA 1R1SA 1O4PA 3KFJA 1BKLA 4OHHA 1LCJA 3S8OA 3MAZA 3TKZA 1CWDL 3QWXX 3PS5A 1A07A 3N84A 1O4BA 3CBLA 1SKJA 4E93A 2Y3AB 3GXWA 2K7AB 2CBLA 1IJRA 3VGOA 1KC2A 3IN8A 3OB2B 3MXCA 1AYAA 1O4HA 1A81A 2EKXA 2SRCA 4P9VA 1FBZA 2ECDA 1OPLA 5AULA 3CD3A 1O4NA 2H5KA 1HCSB 2RMXA 4JE4A 1CSZA 4JEGA 1JYQA 2MC1A 5EHRA 1O48A 4TZIA 1KA7A 1BHHA 1OO3A 1RQQC 4DGPA 2EYVA 3MXYA 5I6VA 3GQIB 2RORA 2PNBA 5D0JA 3GXXA 2YSXA 2HDVA 2KK6A 1ZFPE 3BUOB 2L3TA 1D4WA 4GWFA 2PTKA 2DLYA 3VRNA 2DVJA 1SHDA 1O4OA 2MK2A 4K2RA 2EO3A 1O4QA 1FU6A 4U17A 5DC9A 5EEQA 1F1WA 2ETZA 1K9AA 1TCEA 3VRZA 1BLJA 1AD5A 5EG3B 4L1BB 2RSYA 3VS5A 1I3ZA 2LNWA 2GSBA 4JGHA 1X6CA 2DX0A 4X6SA 3N8MA 2CR4A 1O41A 2Y1NA 1LKLA 2SHPA 1OO4A 1GRIA 1OPKA 4XZ0A 5KAZA 3VS2A 2LQWA 1FBVA 5IBSA 5HKZA 1O49A 1CSYA 3TL0A 1D1ZA 1O46A 1AOTF 1WQUA 4LUDA 3PSKA 2CIAA 3CXLA 3NHNA 1QADA 3M7FA 1BFJA 3N7YA 4OHLA 2IUGA 5HKWA 1YVHA 1O4AA 2DCRA 5J3XA 1NZLA 3QWYA 4F59A 1O42A 1FU5A 1O4KA 1X27A 3BUWB 1M27A 1QG1E 1O4EA 2OQ1A 2GE9A 3OVEA 3US4A 1TZEE 3EACA 1A1BA 1KSWA 1O44A 2IUHA 2EYZA 1FHSA 1O43A 2CRHA 3PSJA 1O4JA 2FO0A 3UYOA 2DLZA 3VS7A 4DGXA 2RVFA 1GHUA 2K79B 1B47A 1JYRA 1JYUA 1QCFA 2IUIA 1CJ1A 1D4TA 1LUMA 2EYYA 1AB2A 4K11A 1H9OA 3T04A 1BMBA 5EELA 3EAZA 1BLKA 4OHDA 3OB1B 1JWOA 2LQNA 1SPSA 2FCIA 1SHAA 1Y57A 5DF6A 1LUKA 3BUMB 4H34A 3OP0A 2OZOA 4F5AA 2C9WA 2YU7A 1M61A 5DC4A 1BFIA 1UUSA 1A09A 1O4CA 2HUWA 3VROA 2LNXA 3PQZA 1O4RA 3PFVA 3VS6A 2JYQA 4A4CA 5HKYA 1BF5A 1O4DA 1O4FA 2MQIA 2C0IA 2VIFA 1LUNA 3UF4A 3IMDA 1X0NA 1AYBA 2IZVA 2EOBA 1A1EA 1UURA 2AUGA 4U1PA 3VRYA 1AYCA 1HCTB 3HIZB 1PICA 4K44A 1Z3KA 5CDWA 1A1CA 2C0OA 1IS0A 2CS0A 3HCKA 2AOBA 1LKKA 2AOAA 1BHHB 4OHEA 1CWEA 5GJHA 1R1PA 1O4IA 2EL8A 2L4KA 4XZ1A 1BKMA 1O45A 2XP1A 3IN7A 3HHMB 5AXIA 1NRVA 4NWGA 3VS3A 3PJPA 4H1OA 2H8HA 3S8LA 1JU5A 3VRRA 2HMHA 2C0TA 4WWQA 1O47A 3VRQA 1NZVA 1KA6A 2ABLA 4GL9E 2EO6A 2QMSA 1FYRA 4NWFA 1YVLA 4ROJA 3IMJA 1O4GA 1SPRA 3S8NA 2BBUA 1O4LA 4FL3A 5IBMA 4OHIA 2KNOA 4F5BA 2PNAA 2PLDA 2L6KA 4E68A 2HCKA 4K45A 4LUEA 2H46E 4EIHA 3CWGA 3K2MA 1MW4A 5BO4A 3VS0A 2B3OA 1A1AA 1P13A 3WA4A 2CI8A 3S9KA 4A4BA 1BG1A 3C7IA 1BM2A 2MRJA 4P9ZA 4D8KA 3ZNIA 3OV1A 1G83A 1LUIA 3VS1A 2CI9A 2EU0A 4GPLB 2MRKA 4M4ZA 1FMKA 2LCTA 3BUXB 3BKBA 1R1QA 1Y1UA 3VRPA 3VS4A 2Y1MA 4EY0A 1RPYA 1BHFA 2DM0A 4FL2A 2PLEA 4QSYA 5DC0B 3PLFB 1F2FA 1A08A 1O4MA 4FBNA 1SHBA 5GJIA 1AOUF 1XA6A 1LCKA 1RJAA 1AYDA 1MILA 5EHPA 3BUNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDX A;  1R1S A;  1O4P A;  3KFJ A;  1BKL A;  4OHH A;  1LCJ A;  3S8O A;  3MAZ A;  3TKZ A;  1CWD L;  3QWX X;  3PS5 A;  1A07 A;  3N84 A;  1O4B A;  3CBL A;  1SKJ A;  4E93 A;  2Y3A B;  3GXW A;  2K7A B;  2CBL A;  1IJR A;  3VGO A;  1KC2 A;  3IN8 A;  3OB2 B;  3MXC A;  1AYA A;  1O4H A;  1A81 A;  2EKX A;  2SRC A;  4P9V A;  1FBZ A;  2ECD A;  1OPL A;  5AUL A;  3CD3 A;  1O4N A;  2H5K A;  1HCS B;  2RMX A;  4JE4 A;  1CSZ A;  4JEG A;  1JYQ A;  2MC1 A;  5EHR A;  1O48 A;  4TZI A;  1KA7 A;  1BHH A;  1OO3 A;  1RQQ C;  4DGP A;  2EYV A;  3MXY A;  5I6V A;  3GQI B;  2ROR A;  2PNB A;  5D0J A;  3GXX A;  2YSX A;  2HDV A;  2KK6 A;  1ZFP E;  3BUO B;  2L3T A;  1D4W A;  4GWF A;  2PTK A;  2DLY A;  3VRN A;  2DVJ A;  1SHD A;  1O4O A;  2MK2 A;  4K2R A;  2EO3 A;  1O4Q A;  1FU6 A;  4U17 A;  5DC9 A;  5EEQ A;  1F1W A;  2ETZ A;  1K9A A;  1TCE A;  3VRZ A;  1BLJ A;  1AD5 A;  5EG3 B;  4L1B B;  2RSY A;  3VS5 A;  1I3Z A;  2LNW A;  2GSB A;  4JGH A;  1X6C A;  2DX0 A;  4X6S A;  3N8M A;  2CR4 A;  1O41 A;  2Y1N A;  1LKL A;  2SHP A;  1OO4 A;  1GRI A;  1OPK A;  4XZ0 A;  5KAZ A;  3VS2 A;  2LQW A;  1FBV A;  5IBS A;  5HKZ A;  1O49 A;  1CSY A;  3TL0 A;  1D1Z A;  1O46 A;  1AOT F;  1WQU A;  4LUD A;  3PSK A;  2CIA A;  3CXL A;  3NHN A;  1QAD A;  3M7F A;  1BFJ A;  3N7Y A;  4OHL A;  2IUG A;  5HKW A;  1YVH A;  1O4A A;  2DCR A;  5J3X A;  1NZL A;  3QWY A;  4F59 A;  1O42 A;  1FU5 A;  1O4K A;  1X27 A;  3BUW B;  1M27 A;  1QG1 E;  1O4E A;  2OQ1 A;  2GE9 A;  3OVE A;  3US4 A;  1TZE E;  3EAC A;  1A1B A;  1KSW A;  1O44 A;  2IUH A;  2EYZ A;  1FHS A;  1O43 A;  2CRH A;  3PSJ A;  1O4J A;  2FO0 A;  3UYO A;  2DLZ A;  3VS7 A;  4DGX A;  2RVF A;  1GHU A;  2K79 B;  1B47 A;  1JYR A;  1JYU A;  1QCF A;  2IUI A;  1CJ1 A;  1D4T A;  1LUM A;  2EYY A;  1AB2 A;  4K11 A;  1H9O A;  3T04 A;  1BMB A;  5EEL A;  3EAZ A;  1BLK A;  4OHD A;  3OB1 B;  1JWO A;  2LQN A;  1SPS A;  2FCI A;  1SHA A;  1Y57 A;  5DF6 A;  1LUK A;  3BUM B;  4H34 A;  3OP0 A;  2OZO A;  4F5A A;  2C9W A;  2YU7 A;  1M61 A;  5DC4 A;  1BFI A;  1UUS A;  1A09 A;  1O4C A;  2HUW A;  3VRO A;  2LNX A;  3PQZ A;  1O4R A;  3PFV A;  3VS6 A;  2JYQ A;  4A4C A;  5HKY A;  1BF5 A;  1O4D A;  1O4F A;  2MQI A;  2C0I A;  2VIF A;  1LUN A;  3UF4 A;  3IMD A;  1X0N A;  1AYB A;  2IZV A;  2EOB A;  1A1E A;  1UUR A;  2AUG A;  4U1P A;  3VRY A;  1AYC A;  1HCT B;  3HIZ B;  1PIC A;  4K44 A;  1Z3K A;  5CDW A;  1A1C A;  2C0O A;  1IS0 A;  2CS0 A;  3HCK A;  2AOB A;  1LKK A;  2AOA A;  1BHH B;  4OHE A;  1CWE A;  5GJH A;  1R1P A;  1O4I A;  2EL8 A;  2L4K A;  4XZ1 A;  1BKM A;  1O45 A;  2XP1 A;  3IN7 A;  3HHM B;  5AXI A;  1NRV A;  4NWG A;  3VS3 A;  3PJP A;  4H1O A;  2H8H A;  3S8L A;  1JU5 A;  3VRR A;  2HMH A;  2C0T A;  4WWQ A;  1O47 A;  3VRQ A;  1NZV A;  1KA6 A;  2ABL A;  4GL9 E;  2EO6 A;  2QMS A;  1FYR A;  4NWF A;  1YVL A;  4ROJ A;  3IMJ A;  1O4G A;  1SPR A;  3S8N A;  2BBU A;  1O4L A;  4FL3 A;  5IBM A;  4OHI A;  2KNO A;  4F5B A;  2PNA A;  2PLD A;  2L6K A;  4E68 A;  2HCK A;  4K45 A;  4LUE A;  2H46 E;  4EIH A;  3CWG A;  3K2M A;  1MW4 A;  5BO4 A;  3VS0 A;  2B3O A;  1A1A A;  1P13 A;  3WA4 A;  2CI8 A;  3S9K A;  4A4B A;  1BG1 A;  3C7I A;  1BM2 A;  2MRJ A;  4P9Z A;  4D8K A;  3ZNI A;  3OV1 A;  1G83 A;  1LUI A;  3VS1 A;  2CI9 A;  2EU0 A;  4GPL B;  2MRK A;  4M4Z A;  1FMK A;  2LCT A;  3BUX B;  3BKB A;  1R1Q A;  1Y1U A;  3VRP A;  3VS4 A;  2Y1M A;  4EY0 A;  1RPY A;  1BHF A;  2DM0 A;  4FL2 A;  2PLE A;  4QSY A;  5DC0 B;  3PLF B;  1F2F A;  1A08 A;  1O4M A;  4FBN A;  1SHB A;  5GJI A;  1AOU F;  1XA6 A;  1LCK A;  1RJA A;  1AYD A;  1MIL A;  5EHP A;  3BUN B; 
#chains in the Genus database with same CATH topology
 2HDX A;  1R1S A;  1O4P A;  3KFJ A;  1BKL A;  4OHH A;  1LCJ A;  3S8O A;  3MAZ A;  3TKZ A;  1CWD L;  3QWX X;  3PS5 A;  1A07 A;  3N84 A;  1O4B A;  3CBL A;  1SKJ A;  4E93 A;  2Y3A B;  3GXW A;  2K7A B;  2CBL A;  1IJR A;  3VGO A;  1KC2 A;  3IN8 A;  3OB2 B;  3MXC A;  1AYA A;  1O4H A;  1A81 A;  2EKX A;  2SRC A;  4P9V A;  1FBZ A;  2ECD A;  1OPL A;  5AUL A;  3CD3 A;  1O4N A;  2H5K A;  1HCS B;  2RMX A;  4JE4 A;  1CSZ A;  4JEG A;  1JYQ A;  2MC1 A;  5EHR A;  1O48 A;  4TZI A;  1KA7 A;  1BHH A;  1OO3 A;  1RQQ C;  4DGP A;  2EYV A;  3MXY A;  5I6V A;  3GQI B;  2ROR A;  2PNB A;  5D0J A;  3GXX A;  2YSX A;  2HDV A;  2KK6 A;  1ZFP E;  3BUO B;  2L3T A;  1D4W A;  4GWF A;  2PTK A;  2DLY A;  3VRN A;  2DVJ A;  1SHD A;  1O4O A;  2MK2 A;  4K2R A;  2EO3 A;  1O4Q A;  1FU6 A;  4U17 A;  5DC9 A;  5EEQ A;  1F1W A;  2ETZ A;  1K9A A;  1TCE A;  3VRZ A;  1BLJ A;  1AD5 A;  5EG3 B;  4L1B B;  2RSY A;  3VS5 A;  1I3Z A;  2LNW A;  2GSB A;  4JGH A;  1X6C A;  2DX0 A;  4X6S A;  3N8M A;  2CR4 A;  1O41 A;  2Y1N A;  1LKL A;  2SHP A;  1OO4 A;  1GRI A;  1OPK A;  4XZ0 A;  5KAZ A;  3VS2 A;  2LQW A;  1FBV A;  5IBS A;  5HKZ A;  1O49 A;  1CSY A;  3TL0 A;  1D1Z A;  1O46 A;  1AOT F;  1WQU A;  4LUD A;  3PSK A;  2CIA A;  3CXL A;  3NHN A;  1QAD A;  3M7F A;  1BFJ A;  3N7Y A;  4OHL A;  2IUG A;  5HKW A;  1YVH A;  1O4A A;  2DCR A;  5J3X A;  1NZL A;  3QWY A;  4F59 A;  1O42 A;  1FU5 A;  1O4K A;  1X27 A;  3BUW B;  1M27 A;  1QG1 E;  1O4E A;  2OQ1 A;  2GE9 A;  3OVE A;  3US4 A;  1TZE E;  3EAC A;  1A1B A;  1KSW A;  1O44 A;  2IUH A;  2EYZ A;  1FHS A;  1O43 A;  2CRH A;  3PSJ A;  1O4J A;  2FO0 A;  3UYO A;  2DLZ A;  3VS7 A;  4DGX A;  2RVF A;  1GHU A;  2K79 B;  1B47 A;  1JYR A;  1JYU A;  1QCF A;  2IUI A;  1CJ1 A;  1D4T A;  1LUM A;  2EYY A;  1AB2 A;  4K11 A;  1H9O A;  3T04 A;  1BMB A;  5EEL A;  3EAZ A;  1BLK A;  4OHD A;  3OB1 B;  1JWO A;  2LQN A;  1SPS A;  2FCI A;  1SHA A;  1Y57 A;  5DF6 A;  1LUK A;  3BUM B;  4H34 A;  3OP0 A;  2OZO A;  4F5A A;  2C9W A;  2YU7 A;  2KGY A;  1M61 A;  5DC4 A;  1BFI A;  1UUS A;  1A09 A;  1O4C A;  2HUW A;  3VRO A;  2LNX A;  3PQZ A;  1O4R A;  3PFV A;  3VS6 A;  2JYQ A;  4A4C A;  5HKY A;  1BF5 A;  1O4D A;  1O4F A;  2MQI A;  2C0I A;  2VIF A;  3LYV A;  1LUN A;  3UF4 A;  3IMD A;  1X0N A;  1AYB A;  2IZV A;  2EOB A;  1A1E A;  1UUR A;  2AUG A;  4U1P A;  3VRY A;  1AYC A;  1HCT B;  3HIZ B;  1PIC A;  4K44 A;  1Z3K A;  2LRA A;  5CDW A;  1A1C A;  2C0O A;  1IS0 A;  2CS0 A;  3HCK A;  2AOB A;  1LKK A;  2AOA A;  1BHH B;  4OHE A;  1CWE A;  5GJH A;  1R1P A;  1O4I A;  2EL8 A;  2L4K A;  4XZ1 A;  1BKM A;  1O45 A;  2XP1 A;  3IN7 A;  3HHM B;  5AXI A;  1NRV A;  4NWG A;  3VS3 A;  3PJP A;  4H1O A;  2H8H A;  3S8L A;  1JU5 A;  3VRR A;  2HMH A;  2C0T A;  4WWQ A;  1O47 A;  3VRQ A;  1NZV A;  1KA6 A;  2ABL A;  4GL9 E;  2EO6 A;  2QMS A;  1FYR A;  4NWF A;  1YVL A;  4ROJ A;  3IMJ A;  1O4G A;  1SPR A;  3S8N A;  2BBU A;  1O4L A;  4FL3 A;  5IBM A;  4OHI A;  2KNO A;  4F5B A;  2PNA A;  2PLD A;  2L6K A;  4E68 A;  2HCK A;  4K45 A;  4LUE A;  2H46 E;  3K2T A;  4EIH A;  3CWG A;  3K2M A;  1MW4 A;  5BO4 A;  3VS0 A;  2B3O A;  1A1A A;  1P13 A;  3WA4 A;  2CI8 A;  3S9K A;  4A4B A;  1BG1 A;  3C7I A;  1BM2 A;  2MRJ A;  4P9Z A;  4D8K A;  3ZNI A;  3OV1 A;  1G83 A;  1LUI A;  3VS1 A;  2CI9 A;  2EU0 A;  4GPL B;  2MRK A;  4M4Z A;  1FMK A;  2LCT A;  3BUX B;  3BKB A;  1R1Q A;  1Y1U A;  3VRP A;  3VS4 A;  2Y1M A;  4EY0 A;  1RPY A;  1BHF A;  2DM0 A;  4FL2 A;  2PLE A;  4QSY A;  5DC0 B;  3PLF B;  1F2F A;  1A08 A;  1O4M A;  4FBN A;  1SHB A;  5GJI A;  1AOU F;  1XA6 A;  1LCK A;  1RJA A;  1AYD A;  1MIL A;  5EHP A;  3BUN B; 
#chains in the Genus database with same CATH homology
 2HDX A;  1R1S A;  1O4P A;  3KFJ A;  1BKL A;  4OHH A;  1LCJ A;  3S8O A;  3MAZ A;  3TKZ A;  1CWD L;  3QWX X;  3PS5 A;  1A07 A;  3N84 A;  1O4B A;  3CBL A;  1SKJ A;  4E93 A;  2Y3A B;  3GXW A;  2K7A B;  2CBL A;  1IJR A;  3VGO A;  1KC2 A;  3IN8 A;  3OB2 B;  3MXC A;  1AYA A;  1O4H A;  1A81 A;  2EKX A;  2SRC A;  4P9V A;  1FBZ A;  2ECD A;  1OPL A;  5AUL A;  3CD3 A;  1O4N A;  2H5K A;  1HCS B;  2RMX A;  4JE4 A;  1CSZ A;  4JEG A;  1JYQ A;  2MC1 A;  5EHR A;  1O48 A;  4TZI A;  1KA7 A;  1BHH A;  1OO3 A;  1RQQ C;  4DGP A;  2EYV A;  3MXY A;  5I6V A;  3GQI B;  2ROR A;  2PNB A;  5D0J A;  3GXX A;  2YSX A;  2HDV A;  2KK6 A;  1ZFP E;  3BUO B;  2L3T A;  1D4W A;  4GWF A;  2PTK A;  2DLY A;  3VRN A;  2DVJ A;  1SHD A;  1O4O A;  2MK2 A;  4K2R A;  2EO3 A;  1O4Q A;  1FU6 A;  4U17 A;  5DC9 A;  5EEQ A;  1F1W A;  2ETZ A;  1K9A A;  1TCE A;  3VRZ A;  1BLJ A;  1AD5 A;  5EG3 B;  4L1B B;  2RSY A;  3VS5 A;  1I3Z A;  2LNW A;  2GSB A;  4JGH A;  1X6C A;  2DX0 A;  4X6S A;  3N8M A;  2CR4 A;  1O41 A;  2Y1N A;  1LKL A;  2SHP A;  1OO4 A;  1GRI A;  1OPK A;  4XZ0 A;  5KAZ A;  3VS2 A;  2LQW A;  1FBV A;  5IBS A;  5HKZ A;  1O49 A;  1CSY A;  3TL0 A;  1D1Z A;  1O46 A;  1AOT F;  1WQU A;  4LUD A;  3PSK A;  2CIA A;  3CXL A;  3NHN A;  1QAD A;  3M7F A;  1BFJ A;  3N7Y A;  4OHL A;  2IUG A;  5HKW A;  1YVH A;  1O4A A;  2DCR A;  5J3X A;  1NZL A;  3QWY A;  4F59 A;  1O42 A;  1FU5 A;  1O4K A;  1X27 A;  3BUW B;  1M27 A;  1QG1 E;  1O4E A;  2OQ1 A;  2GE9 A;  3OVE A;  3US4 A;  1TZE E;  3EAC A;  1A1B A;  1KSW A;  1O44 A;  2IUH A;  2EYZ A;  1FHS A;  1O43 A;  2CRH A;  3PSJ A;  1O4J A;  2FO0 A;  3UYO A;  2DLZ A;  3VS7 A;  4DGX A;  2RVF A;  1GHU A;  2K79 B;  1B47 A;  1JYR A;  1JYU A;  1QCF A;  2IUI A;  1CJ1 A;  1D4T A;  1LUM A;  2EYY A;  1AB2 A;  4K11 A;  1H9O A;  3T04 A;  1BMB A;  5EEL A;  3EAZ A;  1BLK A;  4OHD A;  3OB1 B;  1JWO A;  2LQN A;  1SPS A;  2FCI A;  1SHA A;  1Y57 A;  5DF6 A;  1LUK A;  3BUM B;  4H34 A;  3OP0 A;  2OZO A;  4F5A A;  2C9W A;  2YU7 A;  1M61 A;  5DC4 A;  1BFI A;  1UUS A;  1A09 A;  1O4C A;  2HUW A;  3VRO A;  2LNX A;  3PQZ A;  1O4R A;  3PFV A;  3VS6 A;  2JYQ A;  4A4C A;  5HKY A;  1BF5 A;  1O4D A;  1O4F A;  2MQI A;  2C0I A;  2VIF A;  1LUN A;  3UF4 A;  3IMD A;  1X0N A;  1AYB A;  2IZV A;  2EOB A;  1A1E A;  1UUR A;  2AUG A;  4U1P A;  3VRY A;  1AYC A;  1HCT B;  3HIZ B;  1PIC A;  4K44 A;  1Z3K A;  5CDW A;  1A1C A;  2C0O A;  1IS0 A;  2CS0 A;  3HCK A;  2AOB A;  1LKK A;  2AOA A;  1BHH B;  4OHE A;  1CWE A;  5GJH A;  1R1P A;  1O4I A;  2EL8 A;  2L4K A;  4XZ1 A;  1BKM A;  1O45 A;  2XP1 A;  3IN7 A;  3HHM B;  5AXI A;  1NRV A;  4NWG A;  3VS3 A;  3PJP A;  4H1O A;  2H8H A;  3S8L A;  1JU5 A;  3VRR A;  2HMH A;  2C0T A;  4WWQ A;  1O47 A;  3VRQ A;  1NZV A;  1KA6 A;  2ABL A;  4GL9 E;  2EO6 A;  2QMS A;  1FYR A;  4NWF A;  1YVL A;  4ROJ A;  3IMJ A;  1O4G A;  1SPR A;  3S8N A;  2BBU A;  1O4L A;  4FL3 A;  5IBM A;  4OHI A;  2KNO A;  4F5B A;  2PNA A;  2PLD A;  2L6K A;  4E68 A;  2HCK A;  4K45 A;  4LUE A;  2H46 E;  4EIH A;  3CWG A;  3K2M A;  1MW4 A;  5BO4 A;  3VS0 A;  2B3O A;  1A1A A;  1P13 A;  3WA4 A;  2CI8 A;  3S9K A;  4A4B A;  1BG1 A;  3C7I A;  1BM2 A;  2MRJ A;  4P9Z A;  4D8K A;  3ZNI A;  3OV1 A;  1G83 A;  1LUI A;  3VS1 A;  2CI9 A;  2EU0 A;  4GPL B;  2MRK A;  4M4Z A;  1FMK A;  2LCT A;  3BUX B;  3BKB A;  1R1Q A;  1Y1U A;  3VRP A;  3VS4 A;  2Y1M A;  4EY0 A;  1RPY A;  1BHF A;  2DM0 A;  4FL2 A;  2PLE A;  4QSY A;  5DC0 B;  3PLF B;  1F2F A;  1A08 A;  1O4M A;  4FBN A;  1SHB A;  5GJI A;  1AOU F;  1XA6 A;  1LCK A;  1RJA A;  1AYD A;  1MIL A;  5EHP A;  3BUN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...