1O4RA

Crystal structure of sh2 in complex with ru78783.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
105
Chain Sequence
SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
publication title Requirements for specific binding of low affinity inhibitor fragments to the SH2 domain of (pp60)Src are identical to those for high affinity binding of full length inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 105
sequence length 105
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1o4rA00
2H5KA 1YVHA 4JGHA 1NRVA 1OO4A 3UF4A 1YVLA 2DX0A 1H9OA 2RSYA 4E93A 3VRZA 1LUKA 4L1BB 2DCRA 1KC2A 1SKJA 2PLEA 2ETZA 4U1PA 2L6KA 5D0JA 3MXYA 4K45A 1RJAA 1BM2A 3VS2A 1SHDA 5EELA 4NWFA 3VGOA 1M61A 2IUGA 2EYYA 1G83A 1A07A 2EYZA 4JEGA 5DC4A 3KFJA 2KNOA 1CWDL 3VS1A 2YSXA 5BO4A 4GWFA 1BLJA 1AYAA 1LUIA 1AYDA 1TZEE 1O49A 1CSYA 1A1CA 3EACA 2MQIA 1O4OA 2HMHA 1SHBA 1A1BA 4K44A 1O46A 2MC1A 1LKKA 5KAZA 5HKZA 3IMDA 1B47A 1O4FA 4OHEA 2K79B 2PTKA 2AOBA 3M7FA 1NZLA 4EY0A 2L3TA 1O4RA 1LCJA 1UURA 1TCEA 3VS0A 1SHAA 5AULA 2PLDA 1CWEA 1KA6A 3PJPA 2IUIA 2RMXA 1BHHB 1BKMA 3GXXA 4DGPA 1LKLA 5DC0B 3PS5A 3GQIB 4FBNA 1A81A 3QWXX 1AB2A 2DM0A 1HCSB 2C9WA 3PSJA 2FO0A 1M27A 2LNWA 2H46E 2MK2A 1O4JA 1A08A 4OHHA 4E68A 1ZFPE 1JYUA 3VS5A 2RVFA 4A4BA 1MILA 2H8HA 2LQWA 4LUDA 5CDWA 3BUMB 2CBLA 5I6VA 1FBVA 3VS3A 1O4CA 1R1SA 2EL8A 2DLZA 4A4CA 3T04A 1D4TA 1AD5A 2CRHA 1HCTB 2MRKA 2IUHA 1BHFA 1UUSA 2C0OA 5EEQA 3NHNA 3N8MA 1O4PA 2EKXA 1F1WA 1O48A 1XA6A 1IS0A 1FYRA 1A1EA 1O45A 1O47A 1FBZA 4LUEA 2C0TA 3S9KA 1GRIA 1O42A 1O43A 3VRPA 1GHUA 3VS4A 2ABLA 1X0NA 4OHDA 2SRCA 3PQZA 3N7YA 3OVEA 4DGXA 3BUOB 2PNBA 1O4DA 2HDVA 2SHPA 3BUXB 3VRNA 3C7IA 2JYQA 3OB2B 2EYVA 3BKBA 1O4AA 3VRRA 4GL9E 2PNAA 4OHIA 1BKLA 1O4BA 4FL2A 1BMBA 3N84A 1O4MA 2CI8A 1O4LA 5J3XA 3MAZA 3PSKA 3CXLA 2EOBA 1AYBA 2ECDA 1LCKA 1O4KA 2DLYA 1FU5A 2RORA 4K11A 5HKYA 1LUMA 3HCKA 2VIFA 4FL3A 1OPKA 5IBSA 2AOAA 5EHRA 1FHSA 2HDXA 3HHMB 3OP0A 1SPRA 1QCFA 3CWGA 4H34A 1O4NA 3S8LA 1JYRA 2CS0A 2Y1NA 2LNXA 3PLFB 4F5BA 2CIAA 3BUNB 5EG3B 2EO3A 2BBUA 3VROA 2LQNA 4P9VA 1IJRA 4TZIA 4F59A 2QMSA 3QWYA 3GXWA 3CD3A 1BFIA 1F2FA 2HCKA 1BHHA 3TL0A 1MW4A 1R1PA 2FCIA 2MRJA 2L4KA 1JWOA 2HUWA 2XP1A 1FU6A 3K2MA 3S8NA 2AUGA 3HIZB 3S8OA 3VRQA 4GPLB 2OZOA 2Y1MA 2IZVA 3VS6A 3IN8A 2CR4A 4QSYA 1OO3A 2KK6A 2B3OA 1X27A 4XZ0A 3IMJA 3WA4A 5GJHA 2Y3AB 1OPLA 4JE4A 3BUWB 2EO6A 1JYQA 1BF5A 1O41A 3VRYA 3MXCA 3UYOA 4OHLA 1A09A 4ROJA 1RQQC 5AXIA 1JU5A 1LUNA 1CJ1A 1BLKA 2C0IA 1D4WA 1AOTF 2GSBA 1AOUF 1O44A 1Y57A 4H1OA 5GJIA 1I3ZA 1AYCA 1P13A 4F5AA 5HKWA 1FMKA 2GE9A 1Y1UA 4M4ZA 2K7AB 1BFJA 3OB1B 4EIHA 1NZVA 2DVJA 2YU7A 3US4A 4WWQA 1K9AA 1R1QA 1PICA 1D1ZA 1KA7A 5DF6A 4U17A 1O4IA 2LCTA 1QADA 3TKZA 4P9ZA 1O4EA 2EU0A 1Z3KA 5DC9A 1O4GA 3PFVA 3VS7A 1KSWA 4X6SA 4NWGA 2OQ1A 1WQUA 4K2RA 1RPYA 1SPSA 3EAZA 2CI9A 5EHPA 3CBLA 1A1AA 1QG1E 1O4HA 1O4QA 5IBMA 4D8KA 3OV1A 1BG1A 3ZNIA 1CSZA 1X6CA 4XZ1A 3IN7A
chains in the Genus database with same CATH superfamily
2H5KA 1YVHA 4JGHA 1NRVA 1OO4A 3UF4A 1YVLA 2DX0A 1H9OA 2RSYA 4E93A 3VRZA 1LUKA 4L1BB 2DCRA 1KC2A 1SKJA 2PLEA 2ETZA 4U1PA 2L6KA 5D0JA 3MXYA 4K45A 1RJAA 1BM2A 3VS2A 1SHDA 5EELA 4NWFA 3VGOA 1M61A 2IUGA 2EYYA 1G83A 1A07A 2EYZA 4JEGA 5DC4A 3KFJA 2KNOA 1CWDL 3VS1A 2YSXA 5BO4A 4GWFA 1BLJA 1AYAA 1LUIA 1AYDA 1TZEE 1O49A 1CSYA 1A1CA 3EACA 2MQIA 1O4OA 2HMHA 1SHBA 1A1BA 4K44A 1O46A 2MC1A 1LKKA 5KAZA 5HKZA 3IMDA 1B47A 1O4FA 4OHEA 2K79B 2PTKA 2AOBA 3M7FA 1NZLA 4EY0A 2L3TA 1O4RA 1LCJA 1UURA 1TCEA 3VS0A 1SHAA 5AULA 2PLDA 1CWEA 1KA6A 3PJPA 2IUIA 2RMXA 1BHHB 1BKMA 3GXXA 4DGPA 1LKLA 5DC0B 3PS5A 2KGYA 3GQIB 4FBNA 1A81A 3QWXX 1AB2A 2DM0A 1HCSB 2C9WA 3PSJA 2FO0A 1M27A 2LNWA 2H46E 2MK2A 1O4JA 1A08A 4OHHA 4E68A 1ZFPE 1JYUA 3VS5A 2RVFA 4A4BA 1MILA 2H8HA 2LQWA 4LUDA 5CDWA 3BUMB 2CBLA 5I6VA 1FBVA 3VS3A 1O4CA 1R1SA 2EL8A 2DLZA 4A4CA 3T04A 1D4TA 1AD5A 2CRHA 1HCTB 2MRKA 2IUHA 1BHFA 1UUSA 2C0OA 5EEQA 3NHNA 3N8MA 1O4PA 2EKXA 1F1WA 1O48A 1XA6A 1IS0A 1FYRA 1A1EA 1O45A 1O47A 1FBZA 4LUEA 2C0TA 3S9KA 1GRIA 1O42A 1O43A 3VRPA 1GHUA 3VS4A 2ABLA 1X0NA 4OHDA 2SRCA 3PQZA 3N7YA 3OVEA 4DGXA 3BUOB 2PNBA 1O4DA 2HDVA 2SHPA 3BUXB 3VRNA 3C7IA 2JYQA 3OB2B 2EYVA 3BKBA 1O4AA 3VRRA 4GL9E 2PNAA 4OHIA 1BKLA 1O4BA 4FL2A 1BMBA 3N84A 1O4MA 2CI8A 1O4LA 5J3XA 3MAZA 3PSKA 3CXLA 2EOBA 1AYBA 2ECDA 1LCKA 1O4KA 2DLYA 1FU5A 2RORA 4K11A 5HKYA 1LUMA 3HCKA 2VIFA 4FL3A 1OPKA 5IBSA 2AOAA 5EHRA 1FHSA 2HDXA 3HHMB 3OP0A 1SPRA 1QCFA 3CWGA 4H34A 1O4NA 3S8LA 1JYRA 2CS0A 2Y1NA 2LNXA 3PLFB 4F5BA 2CIAA 3BUNB 2LRAA 5EG3B 2EO3A 2BBUA 3VROA 2LQNA 4P9VA 1IJRA 4TZIA 4F59A 2QMSA 3QWYA 3GXWA 3CD3A 1BFIA 1F2FA 2HCKA 1BHHA 3TL0A 1MW4A 1R1PA 2FCIA 2MRJA 2L4KA 1JWOA 2HUWA 2XP1A 1FU6A 3K2MA 3S8NA 2AUGA 3HIZB 3S8OA 3VRQA 4GPLB 2OZOA 2Y1MA 2IZVA 3VS6A 3IN8A 3LYVA 2CR4A 4QSYA 1OO3A 2KK6A 2B3OA 1X27A 4XZ0A 3IMJA 3WA4A 5GJHA 2Y3AB 1OPLA 4JE4A 3BUWB 2EO6A 1JYQA 1BF5A 1O41A 3VRYA 3MXCA 3UYOA 4OHLA 1A09A 4ROJA 1RQQC 5AXIA 1JU5A 1LUNA 1CJ1A 1BLKA 2C0IA 1D4WA 1AOTF 2GSBA 1AOUF 1O44A 1Y57A 4H1OA 5GJIA 1I3ZA 1AYCA 1P13A 4F5AA 5HKWA 1FMKA 2GE9A 1Y1UA 4M4ZA 2K7AB 1BFJA 3OB1B 4EIHA 1NZVA 2DVJA 2YU7A 3US4A 4WWQA 1K9AA 1R1QA 1PICA 1D1ZA 1KA7A 5DF6A 4U17A 1O4IA 2LCTA 1QADA 3TKZA 4P9ZA 1O4EA 2EU0A 1Z3KA 5DC9A 1O4GA 3PFVA 3VS7A 3K2TA 1KSWA 4X6SA 4NWGA 2OQ1A 1WQUA 4K2RA 1RPYA 1SPSA 3EAZA 2CI9A 5EHPA 3CBLA 1A1AA 1QG1E 1O4HA 1O4QA 5IBMA 4D8KA 3OV1A 1BG1A 3ZNIA 1CSZA 1X6CA 4XZ1A 3IN7A
chains in the Genus database with same CATH topology
2H5KA 1YVHA 4JGHA 1NRVA 1OO4A 3UF4A 1YVLA 2DX0A 1H9OA 2RSYA 4E93A 3VRZA 1LUKA 4L1BB 2DCRA 1KC2A 1SKJA 2PLEA 2ETZA 4U1PA 2L6KA 5D0JA 3MXYA 4K45A 1RJAA 1BM2A 3VS2A 1SHDA 5EELA 4NWFA 3VGOA 1M61A 2IUGA 2EYYA 1G83A 1A07A 2EYZA 4JEGA 5DC4A 3KFJA 2KNOA 1CWDL 3VS1A 2YSXA 5BO4A 4GWFA 1BLJA 1AYAA 1LUIA 1AYDA 1TZEE 1O49A 1CSYA 1A1CA 3EACA 2MQIA 1O4OA 2HMHA 1SHBA 1A1BA 4K44A 1O46A 2MC1A 1LKKA 5KAZA 5HKZA 3IMDA 1B47A 1O4FA 4OHEA 2K79B 2PTKA 2AOBA 3M7FA 1NZLA 4EY0A 2L3TA 1O4RA 1LCJA 1UURA 1TCEA 3VS0A 1SHAA 5AULA 2PLDA 1CWEA 1KA6A 3PJPA 2IUIA 2RMXA 1BHHB 1BKMA 3GXXA 4DGPA 1LKLA 5DC0B 3PS5A 3GQIB 4FBNA 1A81A 3QWXX 1AB2A 2DM0A 1HCSB 2C9WA 3PSJA 2FO0A 1M27A 2LNWA 2H46E 2MK2A 1O4JA 1A08A 4OHHA 4E68A 1ZFPE 1JYUA 3VS5A 2RVFA 4A4BA 1MILA 2H8HA 2LQWA 4LUDA 5CDWA 3BUMB 2CBLA 5I6VA 1FBVA 3VS3A 1O4CA 1R1SA 2EL8A 2DLZA 4A4CA 3T04A 1D4TA 1AD5A 2CRHA 1HCTB 2MRKA 2IUHA 1BHFA 1UUSA 2C0OA 5EEQA 3NHNA 3N8MA 1O4PA 2EKXA 1F1WA 1O48A 1XA6A 1IS0A 1FYRA 1A1EA 1O45A 1O47A 1FBZA 4LUEA 2C0TA 3S9KA 1GRIA 1O42A 1O43A 3VRPA 1GHUA 3VS4A 2ABLA 1X0NA 4OHDA 2SRCA 3PQZA 3N7YA 3OVEA 4DGXA 3BUOB 2PNBA 1O4DA 2HDVA 2SHPA 3BUXB 3VRNA 3C7IA 2JYQA 3OB2B 2EYVA 3BKBA 1O4AA 3VRRA 4GL9E 2PNAA 4OHIA 1BKLA 1O4BA 4FL2A 1BMBA 3N84A 1O4MA 2CI8A 1O4LA 5J3XA 3MAZA 3PSKA 3CXLA 2EOBA 1AYBA 2ECDA 1LCKA 1O4KA 2DLYA 1FU5A 2RORA 4K11A 5HKYA 1LUMA 3HCKA 2VIFA 4FL3A 1OPKA 5IBSA 2AOAA 5EHRA 1FHSA 2HDXA 3HHMB 3OP0A 1SPRA 1QCFA 3CWGA 4H34A 1O4NA 3S8LA 1JYRA 2CS0A 2Y1NA 2LNXA 3PLFB 4F5BA 2CIAA 3BUNB 5EG3B 2EO3A 2BBUA 3VROA 2LQNA 4P9VA 1IJRA 4TZIA 4F59A 2QMSA 3QWYA 3GXWA 3CD3A 1BFIA 1F2FA 2HCKA 1BHHA 3TL0A 1MW4A 1R1PA 2FCIA 2MRJA 2L4KA 1JWOA 2HUWA 2XP1A 1FU6A 3K2MA 3S8NA 2AUGA 3HIZB 3S8OA 3VRQA 4GPLB 2OZOA 2Y1MA 2IZVA 3VS6A 3IN8A 2CR4A 4QSYA 1OO3A 2KK6A 2B3OA 1X27A 4XZ0A 3IMJA 3WA4A 5GJHA 2Y3AB 1OPLA 4JE4A 3BUWB 2EO6A 1JYQA 1BF5A 1O41A 3VRYA 3MXCA 3UYOA 4OHLA 1A09A 4ROJA 1RQQC 5AXIA 1JU5A 1LUNA 1CJ1A 1BLKA 2C0IA 1D4WA 1AOTF 2GSBA 1AOUF 1O44A 1Y57A 4H1OA 5GJIA 1I3ZA 1AYCA 1P13A 4F5AA 5HKWA 1FMKA 2GE9A 1Y1UA 4M4ZA 2K7AB 1BFJA 3OB1B 4EIHA 1NZVA 2DVJA 2YU7A 3US4A 4WWQA 1K9AA 1R1QA 1PICA 1D1ZA 1KA7A 5DF6A 4U17A 1O4IA 2LCTA 1QADA 3TKZA 4P9ZA 1O4EA 2EU0A 1Z3KA 5DC9A 1O4GA 3PFVA 3VS7A 1KSWA 4X6SA 4NWGA 2OQ1A 1WQUA 4K2RA 1RPYA 1SPSA 3EAZA 2CI9A 5EHPA 3CBLA 1A1AA 1QG1E 1O4HA 1O4QA 5IBMA 4D8KA 3OV1A 1BG1A 3ZNIA 1CSZA 1X6CA 4XZ1A 3IN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H5K A;  1YVH A;  4JGH A;  1NRV A;  1OO4 A;  3UF4 A;  1YVL A;  2DX0 A;  1H9O A;  2RSY A;  4E93 A;  3VRZ A;  1LUK A;  4L1B B;  2DCR A;  1KC2 A;  1SKJ A;  2PLE A;  2ETZ A;  4U1P A;  2L6K A;  5D0J A;  3MXY A;  4K45 A;  1RJA A;  1BM2 A;  3VS2 A;  1SHD A;  5EEL A;  4NWF A;  3VGO A;  1M61 A;  2IUG A;  2EYY A;  1G83 A;  1A07 A;  2EYZ A;  4JEG A;  5DC4 A;  3KFJ A;  2KNO A;  1CWD L;  3VS1 A;  2YSX A;  5BO4 A;  4GWF A;  1BLJ A;  1AYA A;  1LUI A;  1AYD A;  1TZE E;  1O49 A;  1CSY A;  1A1C A;  3EAC A;  2MQI A;  1O4O A;  2HMH A;  1SHB A;  1A1B A;  4K44 A;  1O46 A;  2MC1 A;  1LKK A;  5KAZ A;  5HKZ A;  3IMD A;  1B47 A;  1O4F A;  4OHE A;  2K79 B;  2PTK A;  2AOB A;  3M7F A;  1NZL A;  4EY0 A;  2L3T A;  1O4R A;  1LCJ A;  1UUR A;  1TCE A;  3VS0 A;  1SHA A;  5AUL A;  2PLD A;  1CWE A;  1KA6 A;  3PJP A;  2IUI A;  2RMX A;  1BHH B;  1BKM A;  3GXX A;  4DGP A;  1LKL A;  5DC0 B;  3PS5 A;  3GQI B;  4FBN A;  1A81 A;  3QWX X;  1AB2 A;  2DM0 A;  1HCS B;  2C9W A;  3PSJ A;  2FO0 A;  1M27 A;  2LNW A;  2H46 E;  2MK2 A;  1O4J A;  1A08 A;  4OHH A;  4E68 A;  1ZFP E;  1JYU A;  3VS5 A;  2RVF A;  4A4B A;  1MIL A;  2H8H A;  2LQW A;  4LUD A;  5CDW A;  3BUM B;  2CBL A;  5I6V A;  1FBV A;  3VS3 A;  1O4C A;  1R1S A;  2EL8 A;  2DLZ A;  4A4C A;  3T04 A;  1D4T A;  1AD5 A;  2CRH A;  1HCT B;  2MRK A;  2IUH A;  1BHF A;  1UUS A;  2C0O A;  5EEQ A;  3NHN A;  3N8M A;  1O4P A;  2EKX A;  1F1W A;  1O48 A;  1XA6 A;  1IS0 A;  1FYR A;  1A1E A;  1O45 A;  1O47 A;  1FBZ A;  4LUE A;  2C0T A;  3S9K A;  1GRI A;  1O42 A;  1O43 A;  3VRP A;  1GHU A;  3VS4 A;  2ABL A;  1X0N A;  4OHD A;  2SRC A;  3PQZ A;  3N7Y A;  3OVE A;  4DGX A;  3BUO B;  2PNB A;  1O4D A;  2HDV A;  2SHP A;  3BUX B;  3VRN A;  3C7I A;  2JYQ A;  3OB2 B;  2EYV A;  3BKB A;  1O4A A;  3VRR A;  4GL9 E;  2PNA A;  4OHI A;  1BKL A;  1O4B A;  4FL2 A;  1BMB A;  3N84 A;  1O4M A;  2CI8 A;  1O4L A;  5J3X A;  3MAZ A;  3PSK A;  3CXL A;  2EOB A;  1AYB A;  2ECD A;  1LCK A;  1O4K A;  2DLY A;  1FU5 A;  2ROR A;  4K11 A;  5HKY A;  1LUM A;  3HCK A;  2VIF A;  4FL3 A;  1OPK A;  5IBS A;  2AOA A;  5EHR A;  1FHS A;  2HDX A;  3HHM B;  3OP0 A;  1SPR A;  1QCF A;  3CWG A;  4H34 A;  1O4N A;  3S8L A;  1JYR A;  2CS0 A;  2Y1N A;  2LNX A;  3PLF B;  4F5B A;  2CIA A;  3BUN B;  5EG3 B;  2EO3 A;  2BBU A;  3VRO A;  2LQN A;  4P9V A;  1IJR A;  4TZI A;  4F59 A;  2QMS A;  3QWY A;  3GXW A;  3CD3 A;  1BFI A;  1F2F A;  2HCK A;  1BHH A;  3TL0 A;  1MW4 A;  1R1P A;  2FCI A;  2MRJ A;  2L4K A;  1JWO A;  2HUW A;  2XP1 A;  1FU6 A;  3K2M A;  3S8N A;  2AUG A;  3HIZ B;  3S8O A;  3VRQ A;  4GPL B;  2OZO A;  2Y1M A;  2IZV A;  3VS6 A;  3IN8 A;  2CR4 A;  4QSY A;  1OO3 A;  2KK6 A;  2B3O A;  1X27 A;  4XZ0 A;  3IMJ A;  3WA4 A;  5GJH A;  2Y3A B;  1OPL A;  4JE4 A;  3BUW B;  2EO6 A;  1JYQ A;  1BF5 A;  1O41 A;  3VRY A;  3MXC A;  3UYO A;  4OHL A;  1A09 A;  4ROJ A;  1RQQ C;  5AXI A;  1JU5 A;  1LUN A;  1CJ1 A;  1BLK A;  2C0I A;  1D4W A;  1AOT F;  2GSB A;  1AOU F;  1O44 A;  1Y57 A;  4H1O A;  5GJI A;  1I3Z A;  1AYC A;  1P13 A;  4F5A A;  5HKW A;  1FMK A;  2GE9 A;  1Y1U A;  4M4Z A;  2K7A B;  1BFJ A;  3OB1 B;  4EIH A;  1NZV A;  2DVJ A;  2YU7 A;  3US4 A;  4WWQ A;  1K9A A;  1R1Q A;  1PIC A;  1D1Z A;  1KA7 A;  5DF6 A;  4U17 A;  1O4I A;  2LCT A;  1QAD A;  3TKZ A;  4P9Z A;  1O4E A;  2EU0 A;  1Z3K A;  5DC9 A;  1O4G A;  3PFV A;  3VS7 A;  1KSW A;  4X6S A;  4NWG A;  2OQ1 A;  1WQU A;  4K2R A;  1RPY A;  1SPS A;  3EAZ A;  2CI9 A;  5EHP A;  3CBL A;  1A1A A;  1QG1 E;  1O4H A;  1O4Q A;  5IBM A;  4D8K A;  3OV1 A;  1BG1 A;  3ZNI A;  1CSZ A;  1X6C A;  4XZ1 A;  3IN7 A; 
#chains in the Genus database with same CATH topology
 2H5K A;  1YVH A;  4JGH A;  1NRV A;  1OO4 A;  3UF4 A;  1YVL A;  2DX0 A;  1H9O A;  2RSY A;  4E93 A;  3VRZ A;  1LUK A;  4L1B B;  2DCR A;  1KC2 A;  1SKJ A;  2PLE A;  2ETZ A;  4U1P A;  2L6K A;  5D0J A;  3MXY A;  4K45 A;  1RJA A;  1BM2 A;  3VS2 A;  1SHD A;  5EEL A;  4NWF A;  3VGO A;  1M61 A;  2IUG A;  2EYY A;  1G83 A;  1A07 A;  2EYZ A;  4JEG A;  5DC4 A;  3KFJ A;  2KNO A;  1CWD L;  3VS1 A;  2YSX A;  5BO4 A;  4GWF A;  1BLJ A;  1AYA A;  1LUI A;  1AYD A;  1TZE E;  1O49 A;  1CSY A;  1A1C A;  3EAC A;  2MQI A;  1O4O A;  2HMH A;  1SHB A;  1A1B A;  4K44 A;  1O46 A;  2MC1 A;  1LKK A;  5KAZ A;  5HKZ A;  3IMD A;  1B47 A;  1O4F A;  4OHE A;  2K79 B;  2PTK A;  2AOB A;  3M7F A;  1NZL A;  4EY0 A;  2L3T A;  1O4R A;  1LCJ A;  1UUR A;  1TCE A;  3VS0 A;  1SHA A;  5AUL A;  2PLD A;  1CWE A;  1KA6 A;  3PJP A;  2IUI A;  2RMX A;  1BHH B;  1BKM A;  3GXX A;  4DGP A;  1LKL A;  5DC0 B;  3PS5 A;  2KGY A;  3GQI B;  4FBN A;  1A81 A;  3QWX X;  1AB2 A;  2DM0 A;  1HCS B;  2C9W A;  3PSJ A;  2FO0 A;  1M27 A;  2LNW A;  2H46 E;  2MK2 A;  1O4J A;  1A08 A;  4OHH A;  4E68 A;  1ZFP E;  1JYU A;  3VS5 A;  2RVF A;  4A4B A;  1MIL A;  2H8H A;  2LQW A;  4LUD A;  5CDW A;  3BUM B;  2CBL A;  5I6V A;  1FBV A;  3VS3 A;  1O4C A;  1R1S A;  2EL8 A;  2DLZ A;  4A4C A;  3T04 A;  1D4T A;  1AD5 A;  2CRH A;  1HCT B;  2MRK A;  2IUH A;  1BHF A;  1UUS A;  2C0O A;  5EEQ A;  3NHN A;  3N8M A;  1O4P A;  2EKX A;  1F1W A;  1O48 A;  1XA6 A;  1IS0 A;  1FYR A;  1A1E A;  1O45 A;  1O47 A;  1FBZ A;  4LUE A;  2C0T A;  3S9K A;  1GRI A;  1O42 A;  1O43 A;  3VRP A;  1GHU A;  3VS4 A;  2ABL A;  1X0N A;  4OHD A;  2SRC A;  3PQZ A;  3N7Y A;  3OVE A;  4DGX A;  3BUO B;  2PNB A;  1O4D A;  2HDV A;  2SHP A;  3BUX B;  3VRN A;  3C7I A;  2JYQ A;  3OB2 B;  2EYV A;  3BKB A;  1O4A A;  3VRR A;  4GL9 E;  2PNA A;  4OHI A;  1BKL A;  1O4B A;  4FL2 A;  1BMB A;  3N84 A;  1O4M A;  2CI8 A;  1O4L A;  5J3X A;  3MAZ A;  3PSK A;  3CXL A;  2EOB A;  1AYB A;  2ECD A;  1LCK A;  1O4K A;  2DLY A;  1FU5 A;  2ROR A;  4K11 A;  5HKY A;  1LUM A;  3HCK A;  2VIF A;  4FL3 A;  1OPK A;  5IBS A;  2AOA A;  5EHR A;  1FHS A;  2HDX A;  3HHM B;  3OP0 A;  1SPR A;  1QCF A;  3CWG A;  4H34 A;  1O4N A;  3S8L A;  1JYR A;  2CS0 A;  2Y1N A;  2LNX A;  3PLF B;  4F5B A;  2CIA A;  3BUN B;  2LRA A;  5EG3 B;  2EO3 A;  2BBU A;  3VRO A;  2LQN A;  4P9V A;  1IJR A;  4TZI A;  4F59 A;  2QMS A;  3QWY A;  3GXW A;  3CD3 A;  1BFI A;  1F2F A;  2HCK A;  1BHH A;  3TL0 A;  1MW4 A;  1R1P A;  2FCI A;  2MRJ A;  2L4K A;  1JWO A;  2HUW A;  2XP1 A;  1FU6 A;  3K2M A;  3S8N A;  2AUG A;  3HIZ B;  3S8O A;  3VRQ A;  4GPL B;  2OZO A;  2Y1M A;  2IZV A;  3VS6 A;  3IN8 A;  3LYV A;  2CR4 A;  4QSY A;  1OO3 A;  2KK6 A;  2B3O A;  1X27 A;  4XZ0 A;  3IMJ A;  3WA4 A;  5GJH A;  2Y3A B;  1OPL A;  4JE4 A;  3BUW B;  2EO6 A;  1JYQ A;  1BF5 A;  1O41 A;  3VRY A;  3MXC A;  3UYO A;  4OHL A;  1A09 A;  4ROJ A;  1RQQ C;  5AXI A;  1JU5 A;  1LUN A;  1CJ1 A;  1BLK A;  2C0I A;  1D4W A;  1AOT F;  2GSB A;  1AOU F;  1O44 A;  1Y57 A;  4H1O A;  5GJI A;  1I3Z A;  1AYC A;  1P13 A;  4F5A A;  5HKW A;  1FMK A;  2GE9 A;  1Y1U A;  4M4Z A;  2K7A B;  1BFJ A;  3OB1 B;  4EIH A;  1NZV A;  2DVJ A;  2YU7 A;  3US4 A;  4WWQ A;  1K9A A;  1R1Q A;  1PIC A;  1D1Z A;  1KA7 A;  5DF6 A;  4U17 A;  1O4I A;  2LCT A;  1QAD A;  3TKZ A;  4P9Z A;  1O4E A;  2EU0 A;  1Z3K A;  5DC9 A;  1O4G A;  3PFV A;  3VS7 A;  3K2T A;  1KSW A;  4X6S A;  4NWG A;  2OQ1 A;  1WQU A;  4K2R A;  1RPY A;  1SPS A;  3EAZ A;  2CI9 A;  5EHP A;  3CBL A;  1A1A A;  1QG1 E;  1O4H A;  1O4Q A;  5IBM A;  4D8K A;  3OV1 A;  1BG1 A;  3ZNI A;  1CSZ A;  1X6C A;  4XZ1 A;  3IN7 A; 
#chains in the Genus database with same CATH homology
 2H5K A;  1YVH A;  4JGH A;  1NRV A;  1OO4 A;  3UF4 A;  1YVL A;  2DX0 A;  1H9O A;  2RSY A;  4E93 A;  3VRZ A;  1LUK A;  4L1B B;  2DCR A;  1KC2 A;  1SKJ A;  2PLE A;  2ETZ A;  4U1P A;  2L6K A;  5D0J A;  3MXY A;  4K45 A;  1RJA A;  1BM2 A;  3VS2 A;  1SHD A;  5EEL A;  4NWF A;  3VGO A;  1M61 A;  2IUG A;  2EYY A;  1G83 A;  1A07 A;  2EYZ A;  4JEG A;  5DC4 A;  3KFJ A;  2KNO A;  1CWD L;  3VS1 A;  2YSX A;  5BO4 A;  4GWF A;  1BLJ A;  1AYA A;  1LUI A;  1AYD A;  1TZE E;  1O49 A;  1CSY A;  1A1C A;  3EAC A;  2MQI A;  1O4O A;  2HMH A;  1SHB A;  1A1B A;  4K44 A;  1O46 A;  2MC1 A;  1LKK A;  5KAZ A;  5HKZ A;  3IMD A;  1B47 A;  1O4F A;  4OHE A;  2K79 B;  2PTK A;  2AOB A;  3M7F A;  1NZL A;  4EY0 A;  2L3T A;  1O4R A;  1LCJ A;  1UUR A;  1TCE A;  3VS0 A;  1SHA A;  5AUL A;  2PLD A;  1CWE A;  1KA6 A;  3PJP A;  2IUI A;  2RMX A;  1BHH B;  1BKM A;  3GXX A;  4DGP A;  1LKL A;  5DC0 B;  3PS5 A;  3GQI B;  4FBN A;  1A81 A;  3QWX X;  1AB2 A;  2DM0 A;  1HCS B;  2C9W A;  3PSJ A;  2FO0 A;  1M27 A;  2LNW A;  2H46 E;  2MK2 A;  1O4J A;  1A08 A;  4OHH A;  4E68 A;  1ZFP E;  1JYU A;  3VS5 A;  2RVF A;  4A4B A;  1MIL A;  2H8H A;  2LQW A;  4LUD A;  5CDW A;  3BUM B;  2CBL A;  5I6V A;  1FBV A;  3VS3 A;  1O4C A;  1R1S A;  2EL8 A;  2DLZ A;  4A4C A;  3T04 A;  1D4T A;  1AD5 A;  2CRH A;  1HCT B;  2MRK A;  2IUH A;  1BHF A;  1UUS A;  2C0O A;  5EEQ A;  3NHN A;  3N8M A;  1O4P A;  2EKX A;  1F1W A;  1O48 A;  1XA6 A;  1IS0 A;  1FYR A;  1A1E A;  1O45 A;  1O47 A;  1FBZ A;  4LUE A;  2C0T A;  3S9K A;  1GRI A;  1O42 A;  1O43 A;  3VRP A;  1GHU A;  3VS4 A;  2ABL A;  1X0N A;  4OHD A;  2SRC A;  3PQZ A;  3N7Y A;  3OVE A;  4DGX A;  3BUO B;  2PNB A;  1O4D A;  2HDV A;  2SHP A;  3BUX B;  3VRN A;  3C7I A;  2JYQ A;  3OB2 B;  2EYV A;  3BKB A;  1O4A A;  3VRR A;  4GL9 E;  2PNA A;  4OHI A;  1BKL A;  1O4B A;  4FL2 A;  1BMB A;  3N84 A;  1O4M A;  2CI8 A;  1O4L A;  5J3X A;  3MAZ A;  3PSK A;  3CXL A;  2EOB A;  1AYB A;  2ECD A;  1LCK A;  1O4K A;  2DLY A;  1FU5 A;  2ROR A;  4K11 A;  5HKY A;  1LUM A;  3HCK A;  2VIF A;  4FL3 A;  1OPK A;  5IBS A;  2AOA A;  5EHR A;  1FHS A;  2HDX A;  3HHM B;  3OP0 A;  1SPR A;  1QCF A;  3CWG A;  4H34 A;  1O4N A;  3S8L A;  1JYR A;  2CS0 A;  2Y1N A;  2LNX A;  3PLF B;  4F5B A;  2CIA A;  3BUN B;  5EG3 B;  2EO3 A;  2BBU A;  3VRO A;  2LQN A;  4P9V A;  1IJR A;  4TZI A;  4F59 A;  2QMS A;  3QWY A;  3GXW A;  3CD3 A;  1BFI A;  1F2F A;  2HCK A;  1BHH A;  3TL0 A;  1MW4 A;  1R1P A;  2FCI A;  2MRJ A;  2L4K A;  1JWO A;  2HUW A;  2XP1 A;  1FU6 A;  3K2M A;  3S8N A;  2AUG A;  3HIZ B;  3S8O A;  3VRQ A;  4GPL B;  2OZO A;  2Y1M A;  2IZV A;  3VS6 A;  3IN8 A;  2CR4 A;  4QSY A;  1OO3 A;  2KK6 A;  2B3O A;  1X27 A;  4XZ0 A;  3IMJ A;  3WA4 A;  5GJH A;  2Y3A B;  1OPL A;  4JE4 A;  3BUW B;  2EO6 A;  1JYQ A;  1BF5 A;  1O41 A;  3VRY A;  3MXC A;  3UYO A;  4OHL A;  1A09 A;  4ROJ A;  1RQQ C;  5AXI A;  1JU5 A;  1LUN A;  1CJ1 A;  1BLK A;  2C0I A;  1D4W A;  1AOT F;  2GSB A;  1AOU F;  1O44 A;  1Y57 A;  4H1O A;  5GJI A;  1I3Z A;  1AYC A;  1P13 A;  4F5A A;  5HKW A;  1FMK A;  2GE9 A;  1Y1U A;  4M4Z A;  2K7A B;  1BFJ A;  3OB1 B;  4EIH A;  1NZV A;  2DVJ A;  2YU7 A;  3US4 A;  4WWQ A;  1K9A A;  1R1Q A;  1PIC A;  1D1Z A;  1KA7 A;  5DF6 A;  4U17 A;  1O4I A;  2LCT A;  1QAD A;  3TKZ A;  4P9Z A;  1O4E A;  2EU0 A;  1Z3K A;  5DC9 A;  1O4G A;  3PFV A;  3VS7 A;  1KSW A;  4X6S A;  4NWG A;  2OQ1 A;  1WQU A;  4K2R A;  1RPY A;  1SPS A;  3EAZ A;  2CI9 A;  5EHP A;  3CBL A;  1A1A A;  1QG1 E;  1O4H A;  1O4Q A;  5IBM A;  4D8K A;  3OV1 A;  1BG1 A;  3ZNI A;  1CSZ A;  1X6C A;  4XZ1 A;  3IN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...