1AYBA

Crystal structures of peptide complexes of the amino-terminal sh2 domain of the syp tyrosine phosphatase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
100
structure length
100
Chain Sequence
RRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(sh2 domain)
molecule keywords PROTEIN-TYROSINE PHOSPHATASE SYP (N-TERMINAL SH2 DOMAIN)
publication title Crystal structures of peptide complexes of the amino-terminal SH2 domain of the Syp tyrosine phosphatase.
pubmed doi rcsb
source organism Mus musculus
total genus 23
structure length 100
sequence length 100
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 1994-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1aybA00
1CWDL 1BG1A 3QWXX 4JEGA 2Y1MA 5HKZA 4K44A 1WQUA 2YSXA 1OPLA 2MC1A 2EO6A 2FCIA 1Y1UA 1P13A 3IMDA 3IN8A 4GWFA 1QCFA 3VRYA 3ZNIA 4E68A 1D4WA 1O4AA 1A1AA 1KSWA 3PJPA 1LKKA 2CI8A 3HIZB 1IJRA 1O4QA 4WWQA 4GL9E 2LQNA 1IS0A 3IN7A 3CBLA 4NWGA 5DC0B 4DGXA 5DC4A 1R1PA 2C9WA 1A08A 1QG1E 1O46A 1SHBA 2HDXA 1AOTF 1O4PA 3S8LA 2RVFA 2ABLA 3OVEA 1O4OA 1BHHB 3US4A 4H1OA 3VS0A 2SHPA 1OO3A 2L4KA 2OQ1A 1GRIA 1QADA 2JYQA 3TKZA 1RJAA 3CXLA 1A1EA 2FO0A 1R1QA 3KFJA 1F2FA 2DX0A 1SPRA 4P9VA 1KC2A 3N84A 2EU0A 1FBVA 3OV1A 4JE4A 3MXCA 4U1PA 3OB1B 3PLFB 1O45A 1YVLA 1O48A 5IBSA 1JWOA 3TL0A 3VS7A 2EYYA 1O43A 3EAZA 2IUGA 1X27A 2EL8A 5KAZA 3HHMB 1O47A 2PNBA 1JYQA 1M61A 2PNAA 3GXXA 2XP1A 4GPLB 1LCJA 3S8NA 4TZIA 1LKLA 1TCEA 2K79B 1D1ZA 2C0TA 1X6CA 3NHNA 2LNWA 3CD3A 5I6VA 4DGPA 1SHAA 4F59A 3N7YA 2H46E 4OHEA 2PTKA 1FBZA 4U17A 3VRQA 1O4LA 1CJ1A 2PLDA 4EIHA 4NWFA 4OHIA 1FHSA 3QWYA 1O4FA 3CWGA 2CBLA 5D0JA 3UYOA 4E93A 1CWEA 2VIFA 1UUSA 1SHDA 4L1BB 5HKWA 1KA7A 5BO4A 3PQZA 2HCKA 2KK6A 2KNOA 4FL2A 1YVHA 3MAZA 3BUOB 3BUXB 3MXYA 1NRVA 3T04A 1O4HA 3PSJA 1O4EA 5GJHA 2AUGA 1BF5A 1AYDA 1O4MA 2EYVA 2MRJA 4M4ZA 1Y57A 4XZ1A 3VROA 2YU7A 4OHLA 1SKJA 2Y3AB 2DM0A 2LNXA 3HCKA 3VS1A 2EO3A 4XZ0A 2CS0A 1FU6A 1O4GA 2LCTA 1LUMA 4X6SA 2RSYA 3VRNA 3M7FA 4OHHA 4FBNA 2SRCA 1O42A 1R1SA 2CR4A 2K7AB 2MK2A 3IMJA 2AOAA 1UURA 2HDVA 1M27A 1FMKA 5DF6A 2QMSA 1O41A 1LUKA 1BFJA 3BUMB 1O4JA 1LUNA 1OO4A 3S9KA 2H5KA 4H34A 1AB2A 2GE9A 4A4CA 3VGOA 3C7IA 1RQQC 3VS4A 5EHPA 1A81A 2HUWA 1AYCA 1NZVA 3PSKA 1JYUA 2ECDA 2IUHA 3S8OA 2CRHA 1X0NA 2CIAA 2DVJA 4K11A 3VS2A 4ROJA 2CI9A 1O4IA 2ETZA 1KA6A 2PLEA 4OHDA 1A09A 1HCTB 2EKXA 5EELA 1H9OA 1A1CA 1SPSA 1CSYA 1NZLA 4QSYA 5AXIA 2OZOA 3OB2B 2RORA 4JGHA 1D4TA 3VRPA 3BKBA 2IZVA 1G83A 1O4NA 2DCRA 1BLJA 2H8HA 1O4RA 1ZFPE 3PS5A 2L6KA 2LQWA 1MW4A 2C0OA 4A4BA 1JYRA 2IUIA 5EHRA 2RMXA 1AYBA 1LUIA 1I3ZA 2L3TA 2Y1NA 2B3OA 2HMHA 5DC9A 3K2MA 1AOUF 3GQIB 3VRZA 1O4BA 3EACA 3OP0A 1BM2A 1Z3KA 1BHHA 4K45A 4EY0A 2DLYA 1BHFA 3PFVA 5EEQA 4P9ZA 1FYRA 1F1WA 1JU5A 3VS3A 2EYZA 1AYAA 1MILA 3GXWA 1OPKA 4FL3A 1BFIA 4F5AA 2MRKA 1LCKA 1O4KA 1A07A 1O4DA 5GJIA 4D8KA 1BMBA 4F5BA 1O49A 1TZEE 2BBUA 1FU5A 2DLZA 3VRRA 3VS6A 4K2RA 1RPYA 1K9AA 5IBMA 1A1BA 1CSZA 5EG3B 1B47A 4LUDA 3N8MA 1GHUA 2EOBA 1O4CA 1BLKA 2GSBA 2C0IA 2AOBA 3VS5A 1O44A 5CDWA 1PICA 3BUNB 1XA6A 3WA4A 3UF4A 5HKYA 1HCSB 5AULA 5J3XA 2MQIA 4LUEA 3BUWB 1AD5A 1BKMA 1BKLA
chains in the Genus database with same CATH superfamily
1CWDL 1BG1A 3QWXX 4JEGA 2Y1MA 5HKZA 4K44A 1WQUA 2YSXA 1OPLA 2MC1A 2EO6A 2FCIA 1Y1UA 1P13A 3IMDA 3IN8A 4GWFA 1QCFA 3VRYA 3ZNIA 4E68A 1D4WA 1O4AA 1A1AA 1KSWA 3PJPA 1LKKA 2CI8A 3HIZB 1IJRA 1O4QA 4WWQA 4GL9E 2LQNA 1IS0A 3IN7A 3CBLA 4NWGA 5DC0B 4DGXA 5DC4A 1R1PA 2C9WA 1A08A 1QG1E 1O46A 1SHBA 2HDXA 1AOTF 1O4PA 3S8LA 2RVFA 2ABLA 3OVEA 1O4OA 1BHHB 3US4A 4H1OA 3VS0A 2SHPA 1OO3A 2L4KA 2OQ1A 1GRIA 1QADA 2JYQA 3TKZA 1RJAA 3CXLA 2LRAA 1A1EA 2FO0A 1R1QA 3KFJA 1F2FA 2DX0A 1SPRA 4P9VA 1KC2A 3N84A 2EU0A 1FBVA 3OV1A 4JE4A 3MXCA 4U1PA 3OB1B 3PLFB 1O45A 1YVLA 1O48A 5IBSA 1JWOA 3TL0A 3VS7A 2EYYA 1O43A 3EAZA 2IUGA 1X27A 2EL8A 5KAZA 3HHMB 1O47A 2PNBA 1JYQA 1M61A 2PNAA 3GXXA 2XP1A 4GPLB 1LCJA 3S8NA 4TZIA 1LKLA 1TCEA 2K79B 1D1ZA 2C0TA 1X6CA 3NHNA 2LNWA 3CD3A 5I6VA 4DGPA 1SHAA 4F59A 3N7YA 2H46E 4OHEA 2PTKA 1FBZA 4U17A 3VRQA 1O4LA 1CJ1A 2PLDA 4EIHA 4NWFA 4OHIA 1FHSA 2KGYA 3QWYA 1O4FA 3CWGA 2CBLA 5D0JA 3UYOA 4E93A 1CWEA 2VIFA 1UUSA 1SHDA 4L1BB 5HKWA 1KA7A 5BO4A 3PQZA 2HCKA 2KK6A 2KNOA 4FL2A 1YVHA 3MAZA 3BUOB 3BUXB 3MXYA 3K2TA 1NRVA 3T04A 1O4HA 3PSJA 1O4EA 5GJHA 2AUGA 1BF5A 1AYDA 1O4MA 2EYVA 2MRJA 4M4ZA 1Y57A 4XZ1A 3VROA 2YU7A 4OHLA 1SKJA 2Y3AB 2DM0A 2LNXA 3HCKA 3VS1A 2EO3A 4XZ0A 2CS0A 1FU6A 1O4GA 2LCTA 1LUMA 4X6SA 2RSYA 3VRNA 3M7FA 4OHHA 4FBNA 2SRCA 1O42A 1R1SA 2CR4A 2K7AB 2MK2A 3IMJA 2AOAA 1UURA 2HDVA 1M27A 1FMKA 5DF6A 2QMSA 1O41A 1LUKA 1BFJA 3BUMB 1O4JA 1LUNA 1OO4A 3S9KA 2H5KA 4H34A 1AB2A 2GE9A 4A4CA 3VGOA 3C7IA 1RQQC 3VS4A 5EHPA 1A81A 2HUWA 1AYCA 1NZVA 3PSKA 1JYUA 2ECDA 2IUHA 3S8OA 2CRHA 1X0NA 2CIAA 2DVJA 4K11A 3VS2A 4ROJA 2CI9A 1O4IA 2ETZA 1KA6A 2PLEA 4OHDA 1A09A 1HCTB 2EKXA 5EELA 1H9OA 1A1CA 1SPSA 1CSYA 1NZLA 4QSYA 5AXIA 2OZOA 3OB2B 2RORA 4JGHA 1D4TA 3VRPA 3BKBA 2IZVA 1G83A 1O4NA 2DCRA 1BLJA 2H8HA 1O4RA 1ZFPE 3PS5A 2L6KA 2LQWA 1MW4A 2C0OA 4A4BA 1JYRA 2IUIA 5EHRA 2RMXA 1AYBA 1LUIA 1I3ZA 2L3TA 2Y1NA 2B3OA 2HMHA 5DC9A 3K2MA 1AOUF 3GQIB 3VRZA 1O4BA 3EACA 3OP0A 1BM2A 1Z3KA 1BHHA 4K45A 4EY0A 2DLYA 1BHFA 3PFVA 5EEQA 4P9ZA 1FYRA 1F1WA 1JU5A 3VS3A 2EYZA 1AYAA 1MILA 3GXWA 1OPKA 4FL3A 1BFIA 4F5AA 2MRKA 1LCKA 1O4KA 1A07A 1O4DA 5GJIA 4D8KA 1BMBA 4F5BA 1O49A 1TZEE 2BBUA 1FU5A 2DLZA 3VRRA 3VS6A 4K2RA 1RPYA 1K9AA 5IBMA 1A1BA 1CSZA 5EG3B 1B47A 4LUDA 3N8MA 1GHUA 2EOBA 1O4CA 1BLKA 2GSBA 2C0IA 2AOBA 3VS5A 1O44A 5CDWA 1PICA 3BUNB 1XA6A 3WA4A 3UF4A 5HKYA 1HCSB 5AULA 5J3XA 2MQIA 4LUEA 3LYVA 3BUWB 1AD5A 1BKMA 1BKLA
chains in the Genus database with same CATH topology
1CWDL 1BG1A 3QWXX 4JEGA 2Y1MA 5HKZA 4K44A 1WQUA 2YSXA 1OPLA 2MC1A 2EO6A 2FCIA 1Y1UA 1P13A 3IMDA 3IN8A 4GWFA 1QCFA 3VRYA 3ZNIA 4E68A 1D4WA 1O4AA 1A1AA 1KSWA 3PJPA 1LKKA 2CI8A 3HIZB 1IJRA 1O4QA 4WWQA 4GL9E 2LQNA 1IS0A 3IN7A 3CBLA 4NWGA 5DC0B 4DGXA 5DC4A 1R1PA 2C9WA 1A08A 1QG1E 1O46A 1SHBA 2HDXA 1AOTF 1O4PA 3S8LA 2RVFA 2ABLA 3OVEA 1O4OA 1BHHB 3US4A 4H1OA 3VS0A 2SHPA 1OO3A 2L4KA 2OQ1A 1GRIA 1QADA 2JYQA 3TKZA 1RJAA 3CXLA 1A1EA 2FO0A 1R1QA 3KFJA 1F2FA 2DX0A 1SPRA 4P9VA 1KC2A 3N84A 2EU0A 1FBVA 3OV1A 4JE4A 3MXCA 4U1PA 3OB1B 3PLFB 1O45A 1YVLA 1O48A 5IBSA 1JWOA 3TL0A 3VS7A 2EYYA 1O43A 3EAZA 2IUGA 1X27A 2EL8A 5KAZA 3HHMB 1O47A 2PNBA 1JYQA 1M61A 2PNAA 3GXXA 2XP1A 4GPLB 1LCJA 3S8NA 4TZIA 1LKLA 1TCEA 2K79B 1D1ZA 2C0TA 1X6CA 3NHNA 2LNWA 3CD3A 5I6VA 4DGPA 1SHAA 4F59A 3N7YA 2H46E 4OHEA 2PTKA 1FBZA 4U17A 3VRQA 1O4LA 1CJ1A 2PLDA 4EIHA 4NWFA 4OHIA 1FHSA 3QWYA 1O4FA 3CWGA 2CBLA 5D0JA 3UYOA 4E93A 1CWEA 2VIFA 1UUSA 1SHDA 4L1BB 5HKWA 1KA7A 5BO4A 3PQZA 2HCKA 2KK6A 2KNOA 4FL2A 1YVHA 3MAZA 3BUOB 3BUXB 3MXYA 1NRVA 3T04A 1O4HA 3PSJA 1O4EA 5GJHA 2AUGA 1BF5A 1AYDA 1O4MA 2EYVA 2MRJA 4M4ZA 1Y57A 4XZ1A 3VROA 2YU7A 4OHLA 1SKJA 2Y3AB 2DM0A 2LNXA 3HCKA 3VS1A 2EO3A 4XZ0A 2CS0A 1FU6A 1O4GA 2LCTA 1LUMA 4X6SA 2RSYA 3VRNA 3M7FA 4OHHA 4FBNA 2SRCA 1O42A 1R1SA 2CR4A 2K7AB 2MK2A 3IMJA 2AOAA 1UURA 2HDVA 1M27A 1FMKA 5DF6A 2QMSA 1O41A 1LUKA 1BFJA 3BUMB 1O4JA 1LUNA 1OO4A 3S9KA 2H5KA 4H34A 1AB2A 2GE9A 4A4CA 3VGOA 3C7IA 1RQQC 3VS4A 5EHPA 1A81A 2HUWA 1AYCA 1NZVA 3PSKA 1JYUA 2ECDA 2IUHA 3S8OA 2CRHA 1X0NA 2CIAA 2DVJA 4K11A 3VS2A 4ROJA 2CI9A 1O4IA 2ETZA 1KA6A 2PLEA 4OHDA 1A09A 1HCTB 2EKXA 5EELA 1H9OA 1A1CA 1SPSA 1CSYA 1NZLA 4QSYA 5AXIA 2OZOA 3OB2B 2RORA 4JGHA 1D4TA 3VRPA 3BKBA 2IZVA 1G83A 1O4NA 2DCRA 1BLJA 2H8HA 1O4RA 1ZFPE 3PS5A 2L6KA 2LQWA 1MW4A 2C0OA 4A4BA 1JYRA 2IUIA 5EHRA 2RMXA 1AYBA 1LUIA 1I3ZA 2L3TA 2Y1NA 2B3OA 2HMHA 5DC9A 3K2MA 1AOUF 3GQIB 3VRZA 1O4BA 3EACA 3OP0A 1BM2A 1Z3KA 1BHHA 4K45A 4EY0A 2DLYA 1BHFA 3PFVA 5EEQA 4P9ZA 1FYRA 1F1WA 1JU5A 3VS3A 2EYZA 1AYAA 1MILA 3GXWA 1OPKA 4FL3A 1BFIA 4F5AA 2MRKA 1LCKA 1O4KA 1A07A 1O4DA 5GJIA 4D8KA 1BMBA 4F5BA 1O49A 1TZEE 2BBUA 1FU5A 2DLZA 3VRRA 3VS6A 4K2RA 1RPYA 1K9AA 5IBMA 1A1BA 1CSZA 5EG3B 1B47A 4LUDA 3N8MA 1GHUA 2EOBA 1O4CA 1BLKA 2GSBA 2C0IA 2AOBA 3VS5A 1O44A 5CDWA 1PICA 3BUNB 1XA6A 3WA4A 3UF4A 5HKYA 1HCSB 5AULA 5J3XA 2MQIA 4LUEA 3BUWB 1AD5A 1BKMA 1BKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CWD L;  1BG1 A;  3QWX X;  4JEG A;  2Y1M A;  5HKZ A;  4K44 A;  1WQU A;  2YSX A;  1OPL A;  2MC1 A;  2EO6 A;  2FCI A;  1Y1U A;  1P13 A;  3IMD A;  3IN8 A;  4GWF A;  1QCF A;  3VRY A;  3ZNI A;  4E68 A;  1D4W A;  1O4A A;  1A1A A;  1KSW A;  3PJP A;  1LKK A;  2CI8 A;  3HIZ B;  1IJR A;  1O4Q A;  4WWQ A;  4GL9 E;  2LQN A;  1IS0 A;  3IN7 A;  3CBL A;  4NWG A;  5DC0 B;  4DGX A;  5DC4 A;  1R1P A;  2C9W A;  1A08 A;  1QG1 E;  1O46 A;  1SHB A;  2HDX A;  1AOT F;  1O4P A;  3S8L A;  2RVF A;  2ABL A;  3OVE A;  1O4O A;  1BHH B;  3US4 A;  4H1O A;  3VS0 A;  2SHP A;  1OO3 A;  2L4K A;  2OQ1 A;  1GRI A;  1QAD A;  2JYQ A;  3TKZ A;  1RJA A;  3CXL A;  1A1E A;  2FO0 A;  1R1Q A;  3KFJ A;  1F2F A;  2DX0 A;  1SPR A;  4P9V A;  1KC2 A;  3N84 A;  2EU0 A;  1FBV A;  3OV1 A;  4JE4 A;  3MXC A;  4U1P A;  3OB1 B;  3PLF B;  1O45 A;  1YVL A;  1O48 A;  5IBS A;  1JWO A;  3TL0 A;  3VS7 A;  2EYY A;  1O43 A;  3EAZ A;  2IUG A;  1X27 A;  2EL8 A;  5KAZ A;  3HHM B;  1O47 A;  2PNB A;  1JYQ A;  1M61 A;  2PNA A;  3GXX A;  2XP1 A;  4GPL B;  1LCJ A;  3S8N A;  4TZI A;  1LKL A;  1TCE A;  2K79 B;  1D1Z A;  2C0T A;  1X6C A;  3NHN A;  2LNW A;  3CD3 A;  5I6V A;  4DGP A;  1SHA A;  4F59 A;  3N7Y A;  2H46 E;  4OHE A;  2PTK A;  1FBZ A;  4U17 A;  3VRQ A;  1O4L A;  1CJ1 A;  2PLD A;  4EIH A;  4NWF A;  4OHI A;  1FHS A;  3QWY A;  1O4F A;  3CWG A;  2CBL A;  5D0J A;  3UYO A;  4E93 A;  1CWE A;  2VIF A;  1UUS A;  1SHD A;  4L1B B;  5HKW A;  1KA7 A;  5BO4 A;  3PQZ A;  2HCK A;  2KK6 A;  2KNO A;  4FL2 A;  1YVH A;  3MAZ A;  3BUO B;  3BUX B;  3MXY A;  1NRV A;  3T04 A;  1O4H A;  3PSJ A;  1O4E A;  5GJH A;  2AUG A;  1BF5 A;  1AYD A;  1O4M A;  2EYV A;  2MRJ A;  4M4Z A;  1Y57 A;  4XZ1 A;  3VRO A;  2YU7 A;  4OHL A;  1SKJ A;  2Y3A B;  2DM0 A;  2LNX A;  3HCK A;  3VS1 A;  2EO3 A;  4XZ0 A;  2CS0 A;  1FU6 A;  1O4G A;  2LCT A;  1LUM A;  4X6S A;  2RSY A;  3VRN A;  3M7F A;  4OHH A;  4FBN A;  2SRC A;  1O42 A;  1R1S A;  2CR4 A;  2K7A B;  2MK2 A;  3IMJ A;  2AOA A;  1UUR A;  2HDV A;  1M27 A;  1FMK A;  5DF6 A;  2QMS A;  1O41 A;  1LUK A;  1BFJ A;  3BUM B;  1O4J A;  1LUN A;  1OO4 A;  3S9K A;  2H5K A;  4H34 A;  1AB2 A;  2GE9 A;  4A4C A;  3VGO A;  3C7I A;  1RQQ C;  3VS4 A;  5EHP A;  1A81 A;  2HUW A;  1AYC A;  1NZV A;  3PSK A;  1JYU A;  2ECD A;  2IUH A;  3S8O A;  2CRH A;  1X0N A;  2CIA A;  2DVJ A;  4K11 A;  3VS2 A;  4ROJ A;  2CI9 A;  1O4I A;  2ETZ A;  1KA6 A;  2PLE A;  4OHD A;  1A09 A;  1HCT B;  2EKX A;  5EEL A;  1H9O A;  1A1C A;  1SPS A;  1CSY A;  1NZL A;  4QSY A;  5AXI A;  2OZO A;  3OB2 B;  2ROR A;  4JGH A;  1D4T A;  3VRP A;  3BKB A;  2IZV A;  1G83 A;  1O4N A;  2DCR A;  1BLJ A;  2H8H A;  1O4R A;  1ZFP E;  3PS5 A;  2L6K A;  2LQW A;  1MW4 A;  2C0O A;  4A4B A;  1JYR A;  2IUI A;  5EHR A;  2RMX A;  1AYB A;  1LUI A;  1I3Z A;  2L3T A;  2Y1N A;  2B3O A;  2HMH A;  5DC9 A;  3K2M A;  1AOU F;  3GQI B;  3VRZ A;  1O4B A;  3EAC A;  3OP0 A;  1BM2 A;  1Z3K A;  1BHH A;  4K45 A;  4EY0 A;  2DLY A;  1BHF A;  3PFV A;  5EEQ A;  4P9Z A;  1FYR A;  1F1W A;  1JU5 A;  3VS3 A;  2EYZ A;  1AYA A;  1MIL A;  3GXW A;  1OPK A;  4FL3 A;  1BFI A;  4F5A A;  2MRK A;  1LCK A;  1O4K A;  1A07 A;  1O4D A;  5GJI A;  4D8K A;  1BMB A;  4F5B A;  1O49 A;  1TZE E;  2BBU A;  1FU5 A;  2DLZ A;  3VRR A;  3VS6 A;  4K2R A;  1RPY A;  1K9A A;  5IBM A;  1A1B A;  1CSZ A;  5EG3 B;  1B47 A;  4LUD A;  3N8M A;  1GHU A;  2EOB A;  1O4C A;  1BLK A;  2GSB A;  2C0I A;  2AOB A;  3VS5 A;  1O44 A;  5CDW A;  1PIC A;  3BUN B;  1XA6 A;  3WA4 A;  3UF4 A;  5HKY A;  1HCS B;  5AUL A;  5J3X A;  2MQI A;  4LUE A;  3BUW B;  1AD5 A;  1BKM A;  1BKL A; 
#chains in the Genus database with same CATH topology
 1CWD L;  1BG1 A;  3QWX X;  4JEG A;  2Y1M A;  5HKZ A;  4K44 A;  1WQU A;  2YSX A;  1OPL A;  2MC1 A;  2EO6 A;  2FCI A;  1Y1U A;  1P13 A;  3IMD A;  3IN8 A;  4GWF A;  1QCF A;  3VRY A;  3ZNI A;  4E68 A;  1D4W A;  1O4A A;  1A1A A;  1KSW A;  3PJP A;  1LKK A;  2CI8 A;  3HIZ B;  1IJR A;  1O4Q A;  4WWQ A;  4GL9 E;  2LQN A;  1IS0 A;  3IN7 A;  3CBL A;  4NWG A;  5DC0 B;  4DGX A;  5DC4 A;  1R1P A;  2C9W A;  1A08 A;  1QG1 E;  1O46 A;  1SHB A;  2HDX A;  1AOT F;  1O4P A;  3S8L A;  2RVF A;  2ABL A;  3OVE A;  1O4O A;  1BHH B;  3US4 A;  4H1O A;  3VS0 A;  2SHP A;  1OO3 A;  2L4K A;  2OQ1 A;  1GRI A;  1QAD A;  2JYQ A;  3TKZ A;  1RJA A;  3CXL A;  2LRA A;  1A1E A;  2FO0 A;  1R1Q A;  3KFJ A;  1F2F A;  2DX0 A;  1SPR A;  4P9V A;  1KC2 A;  3N84 A;  2EU0 A;  1FBV A;  3OV1 A;  4JE4 A;  3MXC A;  4U1P A;  3OB1 B;  3PLF B;  1O45 A;  1YVL A;  1O48 A;  5IBS A;  1JWO A;  3TL0 A;  3VS7 A;  2EYY A;  1O43 A;  3EAZ A;  2IUG A;  1X27 A;  2EL8 A;  5KAZ A;  3HHM B;  1O47 A;  2PNB A;  1JYQ A;  1M61 A;  2PNA A;  3GXX A;  2XP1 A;  4GPL B;  1LCJ A;  3S8N A;  4TZI A;  1LKL A;  1TCE A;  2K79 B;  1D1Z A;  2C0T A;  1X6C A;  3NHN A;  2LNW A;  3CD3 A;  5I6V A;  4DGP A;  1SHA A;  4F59 A;  3N7Y A;  2H46 E;  4OHE A;  2PTK A;  1FBZ A;  4U17 A;  3VRQ A;  1O4L A;  1CJ1 A;  2PLD A;  4EIH A;  4NWF A;  4OHI A;  1FHS A;  2KGY A;  3QWY A;  1O4F A;  3CWG A;  2CBL A;  5D0J A;  3UYO A;  4E93 A;  1CWE A;  2VIF A;  1UUS A;  1SHD A;  4L1B B;  5HKW A;  1KA7 A;  5BO4 A;  3PQZ A;  2HCK A;  2KK6 A;  2KNO A;  4FL2 A;  1YVH A;  3MAZ A;  3BUO B;  3BUX B;  3MXY A;  3K2T A;  1NRV A;  3T04 A;  1O4H A;  3PSJ A;  1O4E A;  5GJH A;  2AUG A;  1BF5 A;  1AYD A;  1O4M A;  2EYV A;  2MRJ A;  4M4Z A;  1Y57 A;  4XZ1 A;  3VRO A;  2YU7 A;  4OHL A;  1SKJ A;  2Y3A B;  2DM0 A;  2LNX A;  3HCK A;  3VS1 A;  2EO3 A;  4XZ0 A;  2CS0 A;  1FU6 A;  1O4G A;  2LCT A;  1LUM A;  4X6S A;  2RSY A;  3VRN A;  3M7F A;  4OHH A;  4FBN A;  2SRC A;  1O42 A;  1R1S A;  2CR4 A;  2K7A B;  2MK2 A;  3IMJ A;  2AOA A;  1UUR A;  2HDV A;  1M27 A;  1FMK A;  5DF6 A;  2QMS A;  1O41 A;  1LUK A;  1BFJ A;  3BUM B;  1O4J A;  1LUN A;  1OO4 A;  3S9K A;  2H5K A;  4H34 A;  1AB2 A;  2GE9 A;  4A4C A;  3VGO A;  3C7I A;  1RQQ C;  3VS4 A;  5EHP A;  1A81 A;  2HUW A;  1AYC A;  1NZV A;  3PSK A;  1JYU A;  2ECD A;  2IUH A;  3S8O A;  2CRH A;  1X0N A;  2CIA A;  2DVJ A;  4K11 A;  3VS2 A;  4ROJ A;  2CI9 A;  1O4I A;  2ETZ A;  1KA6 A;  2PLE A;  4OHD A;  1A09 A;  1HCT B;  2EKX A;  5EEL A;  1H9O A;  1A1C A;  1SPS A;  1CSY A;  1NZL A;  4QSY A;  5AXI A;  2OZO A;  3OB2 B;  2ROR A;  4JGH A;  1D4T A;  3VRP A;  3BKB A;  2IZV A;  1G83 A;  1O4N A;  2DCR A;  1BLJ A;  2H8H A;  1O4R A;  1ZFP E;  3PS5 A;  2L6K A;  2LQW A;  1MW4 A;  2C0O A;  4A4B A;  1JYR A;  2IUI A;  5EHR A;  2RMX A;  1AYB A;  1LUI A;  1I3Z A;  2L3T A;  2Y1N A;  2B3O A;  2HMH A;  5DC9 A;  3K2M A;  1AOU F;  3GQI B;  3VRZ A;  1O4B A;  3EAC A;  3OP0 A;  1BM2 A;  1Z3K A;  1BHH A;  4K45 A;  4EY0 A;  2DLY A;  1BHF A;  3PFV A;  5EEQ A;  4P9Z A;  1FYR A;  1F1W A;  1JU5 A;  3VS3 A;  2EYZ A;  1AYA A;  1MIL A;  3GXW A;  1OPK A;  4FL3 A;  1BFI A;  4F5A A;  2MRK A;  1LCK A;  1O4K A;  1A07 A;  1O4D A;  5GJI A;  4D8K A;  1BMB A;  4F5B A;  1O49 A;  1TZE E;  2BBU A;  1FU5 A;  2DLZ A;  3VRR A;  3VS6 A;  4K2R A;  1RPY A;  1K9A A;  5IBM A;  1A1B A;  1CSZ A;  5EG3 B;  1B47 A;  4LUD A;  3N8M A;  1GHU A;  2EOB A;  1O4C A;  1BLK A;  2GSB A;  2C0I A;  2AOB A;  3VS5 A;  1O44 A;  5CDW A;  1PIC A;  3BUN B;  1XA6 A;  3WA4 A;  3UF4 A;  5HKY A;  1HCS B;  5AUL A;  5J3X A;  2MQI A;  4LUE A;  3LYV A;  3BUW B;  1AD5 A;  1BKM A;  1BKL A; 
#chains in the Genus database with same CATH homology
 1CWD L;  1BG1 A;  3QWX X;  4JEG A;  2Y1M A;  5HKZ A;  4K44 A;  1WQU A;  2YSX A;  1OPL A;  2MC1 A;  2EO6 A;  2FCI A;  1Y1U A;  1P13 A;  3IMD A;  3IN8 A;  4GWF A;  1QCF A;  3VRY A;  3ZNI A;  4E68 A;  1D4W A;  1O4A A;  1A1A A;  1KSW A;  3PJP A;  1LKK A;  2CI8 A;  3HIZ B;  1IJR A;  1O4Q A;  4WWQ A;  4GL9 E;  2LQN A;  1IS0 A;  3IN7 A;  3CBL A;  4NWG A;  5DC0 B;  4DGX A;  5DC4 A;  1R1P A;  2C9W A;  1A08 A;  1QG1 E;  1O46 A;  1SHB A;  2HDX A;  1AOT F;  1O4P A;  3S8L A;  2RVF A;  2ABL A;  3OVE A;  1O4O A;  1BHH B;  3US4 A;  4H1O A;  3VS0 A;  2SHP A;  1OO3 A;  2L4K A;  2OQ1 A;  1GRI A;  1QAD A;  2JYQ A;  3TKZ A;  1RJA A;  3CXL A;  1A1E A;  2FO0 A;  1R1Q A;  3KFJ A;  1F2F A;  2DX0 A;  1SPR A;  4P9V A;  1KC2 A;  3N84 A;  2EU0 A;  1FBV A;  3OV1 A;  4JE4 A;  3MXC A;  4U1P A;  3OB1 B;  3PLF B;  1O45 A;  1YVL A;  1O48 A;  5IBS A;  1JWO A;  3TL0 A;  3VS7 A;  2EYY A;  1O43 A;  3EAZ A;  2IUG A;  1X27 A;  2EL8 A;  5KAZ A;  3HHM B;  1O47 A;  2PNB A;  1JYQ A;  1M61 A;  2PNA A;  3GXX A;  2XP1 A;  4GPL B;  1LCJ A;  3S8N A;  4TZI A;  1LKL A;  1TCE A;  2K79 B;  1D1Z A;  2C0T A;  1X6C A;  3NHN A;  2LNW A;  3CD3 A;  5I6V A;  4DGP A;  1SHA A;  4F59 A;  3N7Y A;  2H46 E;  4OHE A;  2PTK A;  1FBZ A;  4U17 A;  3VRQ A;  1O4L A;  1CJ1 A;  2PLD A;  4EIH A;  4NWF A;  4OHI A;  1FHS A;  3QWY A;  1O4F A;  3CWG A;  2CBL A;  5D0J A;  3UYO A;  4E93 A;  1CWE A;  2VIF A;  1UUS A;  1SHD A;  4L1B B;  5HKW A;  1KA7 A;  5BO4 A;  3PQZ A;  2HCK A;  2KK6 A;  2KNO A;  4FL2 A;  1YVH A;  3MAZ A;  3BUO B;  3BUX B;  3MXY A;  1NRV A;  3T04 A;  1O4H A;  3PSJ A;  1O4E A;  5GJH A;  2AUG A;  1BF5 A;  1AYD A;  1O4M A;  2EYV A;  2MRJ A;  4M4Z A;  1Y57 A;  4XZ1 A;  3VRO A;  2YU7 A;  4OHL A;  1SKJ A;  2Y3A B;  2DM0 A;  2LNX A;  3HCK A;  3VS1 A;  2EO3 A;  4XZ0 A;  2CS0 A;  1FU6 A;  1O4G A;  2LCT A;  1LUM A;  4X6S A;  2RSY A;  3VRN A;  3M7F A;  4OHH A;  4FBN A;  2SRC A;  1O42 A;  1R1S A;  2CR4 A;  2K7A B;  2MK2 A;  3IMJ A;  2AOA A;  1UUR A;  2HDV A;  1M27 A;  1FMK A;  5DF6 A;  2QMS A;  1O41 A;  1LUK A;  1BFJ A;  3BUM B;  1O4J A;  1LUN A;  1OO4 A;  3S9K A;  2H5K A;  4H34 A;  1AB2 A;  2GE9 A;  4A4C A;  3VGO A;  3C7I A;  1RQQ C;  3VS4 A;  5EHP A;  1A81 A;  2HUW A;  1AYC A;  1NZV A;  3PSK A;  1JYU A;  2ECD A;  2IUH A;  3S8O A;  2CRH A;  1X0N A;  2CIA A;  2DVJ A;  4K11 A;  3VS2 A;  4ROJ A;  2CI9 A;  1O4I A;  2ETZ A;  1KA6 A;  2PLE A;  4OHD A;  1A09 A;  1HCT B;  2EKX A;  5EEL A;  1H9O A;  1A1C A;  1SPS A;  1CSY A;  1NZL A;  4QSY A;  5AXI A;  2OZO A;  3OB2 B;  2ROR A;  4JGH A;  1D4T A;  3VRP A;  3BKB A;  2IZV A;  1G83 A;  1O4N A;  2DCR A;  1BLJ A;  2H8H A;  1O4R A;  1ZFP E;  3PS5 A;  2L6K A;  2LQW A;  1MW4 A;  2C0O A;  4A4B A;  1JYR A;  2IUI A;  5EHR A;  2RMX A;  1AYB A;  1LUI A;  1I3Z A;  2L3T A;  2Y1N A;  2B3O A;  2HMH A;  5DC9 A;  3K2M A;  1AOU F;  3GQI B;  3VRZ A;  1O4B A;  3EAC A;  3OP0 A;  1BM2 A;  1Z3K A;  1BHH A;  4K45 A;  4EY0 A;  2DLY A;  1BHF A;  3PFV A;  5EEQ A;  4P9Z A;  1FYR A;  1F1W A;  1JU5 A;  3VS3 A;  2EYZ A;  1AYA A;  1MIL A;  3GXW A;  1OPK A;  4FL3 A;  1BFI A;  4F5A A;  2MRK A;  1LCK A;  1O4K A;  1A07 A;  1O4D A;  5GJI A;  4D8K A;  1BMB A;  4F5B A;  1O49 A;  1TZE E;  2BBU A;  1FU5 A;  2DLZ A;  3VRR A;  3VS6 A;  4K2R A;  1RPY A;  1K9A A;  5IBM A;  1A1B A;  1CSZ A;  5EG3 B;  1B47 A;  4LUD A;  3N8M A;  1GHU A;  2EOB A;  1O4C A;  1BLK A;  2GSB A;  2C0I A;  2AOB A;  3VS5 A;  1O44 A;  5CDW A;  1PIC A;  3BUN B;  1XA6 A;  3WA4 A;  3UF4 A;  5HKY A;  1HCS B;  5AUL A;  5J3X A;  2MQI A;  4LUE A;  3BUW B;  1AD5 A;  1BKM A;  1BKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...