3M7FA

Crystal structure of the nedd4 c2/grb10 sh2 complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
IHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCEDDGQTFFSLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Growth factor receptor-bound protein 10
publication title Structural Basis for the Interaction between the Growth Factor-binding Protein GRB10 and the E3 Ubiquitin Ligase NEDD4.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/ligase
total genus 29
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3m7fA00
3VS3A 1O46A 1O47A 3VRYA 1FHSA 1O41A 1TZEE 5AXIA 1GHUA 2VIFA 5CDWA 1H9OA 2EO3A 4F5BA 3VGOA 2RMXA 1JYQA 1TCEA 3C7IA 1O4MA 3S8OA 4K2RA 1FU6A 2KK6A 1A09A 5EHPA 1AYBA 1O49A 3CBLA 3CXLA 4P9ZA 2CI8A 2ABLA 3MXYA 1CSYA 2IUGA 2DVJA 1BM2A 4OHLA 1RPYA 2K7AB 1O4CA 1FYRA 2EL8A 1F1WA 2EOBA 1A07A 1OO3A 2MQIA 1NZVA 2CBLA 1OPKA 2JYQA 3VS0A 2EYVA 5IBMA 1SHBA 4E68A 2EYZA 2LCTA 3PSKA 1AD5A 1LCJA 1KC2A 4L1BB 1BLJA 5I6VA 4D8KA 1G83A 2EYYA 1YVLA 3HCKA 4ROJA 3OVEA 3VROA 1SHDA 2DX0A 1AYCA 3VS4A 4A4BA 1O48A 1SKJA 1SHAA 5GJHA 1O42A 2BBUA 1F2FA 3IMJA 1SPSA 4LUDA 2AOAA 4E93A 3MAZA 1JWOA 3VRQA 2PLDA 4K11A 3GXWA 2ETZA 1O4EA 1BHHA 2SRCA 1O4PA 1Z3KA 1LCKA 3IMDA 1O43A 2HCKA 4M4ZA 3VRRA 4XZ0A 1BKMA 1FBZA 3S9KA 2ECDA 2XP1A 2KNOA 5DC9A 3WA4A 1LKKA 3VS1A 5EG3B 1R1PA 3M7FA 4EY0A 3PSJA 1WQUA 3OV1A 2LNXA 3PS5A 2PNBA 5BO4A 1MW4A 5EEQA 1QADA 2LNWA 1O4LA 3S8NA 2L4KA 2IUIA 4GL9E 3VRPA 2PTKA 2RSYA 2PNAA 3BUOB 5D0JA 1A1CA 3VRNA 2MRJA 1O44A 4EIHA 2Y1MA 2DLZA 2C0IA 3IN7A 2RVFA 1Y1UA 2C0TA 1OPLA 1CSZA 1O4HA 1O4RA 1AOTF 1CJ1A 4JEGA 4TZIA 1M27A 3OB2B 4DGPA 5DC0B 1B47A 3N84A 1AOUF 5IBSA 2Y1NA 1CWEA 4F59A 5KAZA 1I3ZA 1LKLA 3UF4A 1PICA 2GSBA 2EO6A 3US4A 3PJPA 2MRKA 2H46E 1QG1E 1O4KA 3QWXX 1NZLA 3GQIB 2PLEA 2AUGA 1AB2A 2DLYA 1NRVA 1AYDA 3KFJA 3OP0A 4FBNA 3CWGA 4QSYA 1HCSB 3VS5A 1BF5A 2HDVA 3TKZA 3BUNB 2CR4A 1R1SA 1O4GA 2YU7A 1A08A 2DCRA 1O4NA 3K2MA 3T04A 3VS2A 1O4IA 1LUKA 2L3TA 3UYOA 4XZ1A 1A1EA 1O4DA 1JYRA 4FL3A 1YVHA 1JU5A 5GJIA 1D4WA 1AYAA 1QCFA 3PFVA 4JGHA 1A1AA 1O4FA 4A4CA 3VS6A 1ZFPE 2FO0A 2H5KA 1BLKA 5HKZA 3GXXA 3QWYA 4FL2A 2LQWA 2CRHA 4JE4A 1BFIA 1MILA 5AULA 1O4QA 2IZVA 4GWFA 1XA6A 2H8HA 3VS7A 1O4AA 1M61A 1OO4A 2EKXA 3N8MA 2DM0A 4X6SA 5HKWA 1D1ZA 1Y57A 1CWDL 4LUEA 3HHMB 5EHRA 4WWQA 1IS0A 1FMKA 5EELA 1KA6A 3BKBA 3CD3A 4DGXA 2YSXA 4GPLB 1FBVA 4U17A 1JYUA 2RORA 1SPRA 3S8LA 4H34A 2OQ1A 4NWGA 5HKYA 1X27A 3VRZA 1KA7A 1X6CA 2MC1A 5DC4A 3BUXB 2SHPA 3TL0A 2CIAA 3MXCA 4K44A 1O45A 2L6KA 3BUWB 3PQZA 1BFJA 1BG1A 2CS0A 5DF6A 2CI9A 2OZOA 3EAZA 2GE9A 1O4OA 1HCTB 4K45A 3ZNIA 3HIZB 4U1PA 1IJRA 2EU0A 2LQNA 4OHIA 3OB1B 2MK2A 1D4TA 2K79B 1K9AA 1GRIA 1O4JA 1FU5A 3BUMB 4H1OA 2IUHA 1O4BA 3EACA 1RQQC 1A1BA 2HMHA 1BHHB 1BMBA 2AOBA 1BHFA 1KSWA 1LUIA 3IN8A 2B3OA 1RJAA 4OHEA 2C0OA 1LUNA 1LUMA 4NWFA 2HUWA 1BKLA 3PLFB 5J3XA 1P13A 2QMSA 2Y3AB 1R1QA 1A81A 1X0NA 1UURA 2C9WA 4OHDA 2FCIA 1UUSA 3NHNA 2HDXA 4F5AA 4OHHA 3N7YA 4P9VA
chains in the Genus database with same CATH superfamily
3VS3A 1O46A 1O47A 3VRYA 1FHSA 1O41A 1TZEE 5AXIA 1GHUA 2VIFA 5CDWA 1H9OA 2EO3A 4F5BA 3VGOA 2RMXA 1JYQA 1TCEA 3C7IA 1O4MA 3S8OA 2KGYA 4K2RA 1FU6A 2KK6A 1A09A 5EHPA 1AYBA 1O49A 3CBLA 3CXLA 3K2TA 4P9ZA 2CI8A 2ABLA 3MXYA 1CSYA 2IUGA 2DVJA 1BM2A 4OHLA 1RPYA 2K7AB 1O4CA 1FYRA 2EL8A 1F1WA 2EOBA 1A07A 1OO3A 2MQIA 1NZVA 2CBLA 1OPKA 2JYQA 3VS0A 2EYVA 5IBMA 1SHBA 4E68A 2EYZA 2LCTA 3PSKA 1AD5A 1LCJA 1KC2A 4L1BB 1BLJA 5I6VA 4D8KA 1G83A 2EYYA 1YVLA 3HCKA 4ROJA 3OVEA 3VROA 1SHDA 2DX0A 1AYCA 3VS4A 4A4BA 1O48A 1SKJA 1SHAA 5GJHA 1O42A 2BBUA 1F2FA 3IMJA 1SPSA 4LUDA 2AOAA 4E93A 3MAZA 1JWOA 3VRQA 2PLDA 4K11A 3GXWA 2ETZA 1O4EA 1BHHA 2SRCA 1O4PA 1Z3KA 1LCKA 3IMDA 1O43A 2HCKA 4M4ZA 3VRRA 4XZ0A 1BKMA 1FBZA 3S9KA 2ECDA 2XP1A 2KNOA 5DC9A 3WA4A 1LKKA 3VS1A 5EG3B 1R1PA 3M7FA 4EY0A 3PSJA 1WQUA 3OV1A 2LNXA 3PS5A 2PNBA 5BO4A 1MW4A 5EEQA 1QADA 2LNWA 1O4LA 3S8NA 2L4KA 2IUIA 4GL9E 3VRPA 2PTKA 2RSYA 2PNAA 3BUOB 5D0JA 1A1CA 3VRNA 2MRJA 1O44A 4EIHA 2Y1MA 2DLZA 2C0IA 3IN7A 2RVFA 1Y1UA 2C0TA 1OPLA 1CSZA 1O4HA 1O4RA 1AOTF 1CJ1A 4JEGA 4TZIA 1M27A 3OB2B 4DGPA 5DC0B 1B47A 3N84A 1AOUF 5IBSA 2Y1NA 1CWEA 4F59A 5KAZA 1I3ZA 1LKLA 3UF4A 1PICA 2GSBA 2EO6A 3US4A 3PJPA 2MRKA 2H46E 1QG1E 1O4KA 3QWXX 1NZLA 3GQIB 2PLEA 2AUGA 1AB2A 2DLYA 1NRVA 1AYDA 3KFJA 3OP0A 4FBNA 3CWGA 4QSYA 1HCSB 3VS5A 1BF5A 2HDVA 3TKZA 3BUNB 2CR4A 1R1SA 1O4GA 2YU7A 1A08A 2DCRA 1O4NA 3K2MA 3T04A 3VS2A 1O4IA 1LUKA 2L3TA 3UYOA 4XZ1A 1A1EA 1O4DA 1JYRA 4FL3A 1YVHA 1JU5A 5GJIA 1D4WA 1AYAA 1QCFA 3PFVA 4JGHA 1A1AA 1O4FA 4A4CA 3VS6A 1ZFPE 2FO0A 2H5KA 1BLKA 5HKZA 3GXXA 3QWYA 4FL2A 2LQWA 2CRHA 4JE4A 1BFIA 1MILA 5AULA 1O4QA 2IZVA 4GWFA 1XA6A 2H8HA 3VS7A 1O4AA 1M61A 1OO4A 2EKXA 3N8MA 2DM0A 4X6SA 5HKWA 1D1ZA 1Y57A 1CWDL 4LUEA 3HHMB 5EHRA 4WWQA 1IS0A 1FMKA 5EELA 1KA6A 3BKBA 3CD3A 4DGXA 2YSXA 4GPLB 1FBVA 4U17A 1JYUA 2RORA 1SPRA 3S8LA 4H34A 2OQ1A 4NWGA 5HKYA 1X27A 3VRZA 1KA7A 1X6CA 2MC1A 5DC4A 3BUXB 2SHPA 3TL0A 2CIAA 3MXCA 4K44A 1O45A 2L6KA 3BUWB 3PQZA 1BFJA 1BG1A 2CS0A 5DF6A 2CI9A 2OZOA 3EAZA 2GE9A 1O4OA 1HCTB 4K45A 3ZNIA 3HIZB 4U1PA 1IJRA 2EU0A 2LQNA 4OHIA 3OB1B 2MK2A 2LRAA 1D4TA 2K79B 1K9AA 1GRIA 1O4JA 1FU5A 3BUMB 4H1OA 2IUHA 1O4BA 3EACA 1RQQC 1A1BA 2HMHA 1BHHB 1BMBA 2AOBA 1BHFA 1KSWA 1LUIA 3IN8A 2B3OA 1RJAA 4OHEA 2C0OA 1LUNA 1LUMA 4NWFA 2HUWA 1BKLA 3PLFB 5J3XA 1P13A 2QMSA 2Y3AB 1R1QA 1A81A 1X0NA 1UURA 2C9WA 4OHDA 2FCIA 1UUSA 3NHNA 2HDXA 4F5AA 3LYVA 4OHHA 3N7YA 4P9VA
chains in the Genus database with same CATH topology
3VS3A 1O46A 1O47A 3VRYA 1FHSA 1O41A 1TZEE 5AXIA 1GHUA 2VIFA 5CDWA 1H9OA 2EO3A 4F5BA 3VGOA 2RMXA 1JYQA 1TCEA 3C7IA 1O4MA 3S8OA 4K2RA 1FU6A 2KK6A 1A09A 5EHPA 1AYBA 1O49A 3CBLA 3CXLA 4P9ZA 2CI8A 2ABLA 3MXYA 1CSYA 2IUGA 2DVJA 1BM2A 4OHLA 1RPYA 2K7AB 1O4CA 1FYRA 2EL8A 1F1WA 2EOBA 1A07A 1OO3A 2MQIA 1NZVA 2CBLA 1OPKA 2JYQA 3VS0A 2EYVA 5IBMA 1SHBA 4E68A 2EYZA 2LCTA 3PSKA 1AD5A 1LCJA 1KC2A 4L1BB 1BLJA 5I6VA 4D8KA 1G83A 2EYYA 1YVLA 3HCKA 4ROJA 3OVEA 3VROA 1SHDA 2DX0A 1AYCA 3VS4A 4A4BA 1O48A 1SKJA 1SHAA 5GJHA 1O42A 2BBUA 1F2FA 3IMJA 1SPSA 4LUDA 2AOAA 4E93A 3MAZA 1JWOA 3VRQA 2PLDA 4K11A 3GXWA 2ETZA 1O4EA 1BHHA 2SRCA 1O4PA 1Z3KA 1LCKA 3IMDA 1O43A 2HCKA 4M4ZA 3VRRA 4XZ0A 1BKMA 1FBZA 3S9KA 2ECDA 2XP1A 2KNOA 5DC9A 3WA4A 1LKKA 3VS1A 5EG3B 1R1PA 3M7FA 4EY0A 3PSJA 1WQUA 3OV1A 2LNXA 3PS5A 2PNBA 5BO4A 1MW4A 5EEQA 1QADA 2LNWA 1O4LA 3S8NA 2L4KA 2IUIA 4GL9E 3VRPA 2PTKA 2RSYA 2PNAA 3BUOB 5D0JA 1A1CA 3VRNA 2MRJA 1O44A 4EIHA 2Y1MA 2DLZA 2C0IA 3IN7A 2RVFA 1Y1UA 2C0TA 1OPLA 1CSZA 1O4HA 1O4RA 1AOTF 1CJ1A 4JEGA 4TZIA 1M27A 3OB2B 4DGPA 5DC0B 1B47A 3N84A 1AOUF 5IBSA 2Y1NA 1CWEA 4F59A 5KAZA 1I3ZA 1LKLA 3UF4A 1PICA 2GSBA 2EO6A 3US4A 3PJPA 2MRKA 2H46E 1QG1E 1O4KA 3QWXX 1NZLA 3GQIB 2PLEA 2AUGA 1AB2A 2DLYA 1NRVA 1AYDA 3KFJA 3OP0A 4FBNA 3CWGA 4QSYA 1HCSB 3VS5A 1BF5A 2HDVA 3TKZA 3BUNB 2CR4A 1R1SA 1O4GA 2YU7A 1A08A 2DCRA 1O4NA 3K2MA 3T04A 3VS2A 1O4IA 1LUKA 2L3TA 3UYOA 4XZ1A 1A1EA 1O4DA 1JYRA 4FL3A 1YVHA 1JU5A 5GJIA 1D4WA 1AYAA 1QCFA 3PFVA 4JGHA 1A1AA 1O4FA 4A4CA 3VS6A 1ZFPE 2FO0A 2H5KA 1BLKA 5HKZA 3GXXA 3QWYA 4FL2A 2LQWA 2CRHA 4JE4A 1BFIA 1MILA 5AULA 1O4QA 2IZVA 4GWFA 1XA6A 2H8HA 3VS7A 1O4AA 1M61A 1OO4A 2EKXA 3N8MA 2DM0A 4X6SA 5HKWA 1D1ZA 1Y57A 1CWDL 4LUEA 3HHMB 5EHRA 4WWQA 1IS0A 1FMKA 5EELA 1KA6A 3BKBA 3CD3A 4DGXA 2YSXA 4GPLB 1FBVA 4U17A 1JYUA 2RORA 1SPRA 3S8LA 4H34A 2OQ1A 4NWGA 5HKYA 1X27A 3VRZA 1KA7A 1X6CA 2MC1A 5DC4A 3BUXB 2SHPA 3TL0A 2CIAA 3MXCA 4K44A 1O45A 2L6KA 3BUWB 3PQZA 1BFJA 1BG1A 2CS0A 5DF6A 2CI9A 2OZOA 3EAZA 2GE9A 1O4OA 1HCTB 4K45A 3ZNIA 3HIZB 4U1PA 1IJRA 2EU0A 2LQNA 4OHIA 3OB1B 2MK2A 1D4TA 2K79B 1K9AA 1GRIA 1O4JA 1FU5A 3BUMB 4H1OA 2IUHA 1O4BA 3EACA 1RQQC 1A1BA 2HMHA 1BHHB 1BMBA 2AOBA 1BHFA 1KSWA 1LUIA 3IN8A 2B3OA 1RJAA 4OHEA 2C0OA 1LUNA 1LUMA 4NWFA 2HUWA 1BKLA 3PLFB 5J3XA 1P13A 2QMSA 2Y3AB 1R1QA 1A81A 1X0NA 1UURA 2C9WA 4OHDA 2FCIA 1UUSA 3NHNA 2HDXA 4F5AA 4OHHA 3N7YA 4P9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VS3 A;  1O46 A;  1O47 A;  3VRY A;  1FHS A;  1O41 A;  1TZE E;  5AXI A;  1GHU A;  2VIF A;  5CDW A;  1H9O A;  2EO3 A;  4F5B A;  3VGO A;  2RMX A;  1JYQ A;  1TCE A;  3C7I A;  1O4M A;  3S8O A;  4K2R A;  1FU6 A;  2KK6 A;  1A09 A;  5EHP A;  1AYB A;  1O49 A;  3CBL A;  3CXL A;  4P9Z A;  2CI8 A;  2ABL A;  3MXY A;  1CSY A;  2IUG A;  2DVJ A;  1BM2 A;  4OHL A;  1RPY A;  2K7A B;  1O4C A;  1FYR A;  2EL8 A;  1F1W A;  2EOB A;  1A07 A;  1OO3 A;  2MQI A;  1NZV A;  2CBL A;  1OPK A;  2JYQ A;  3VS0 A;  2EYV A;  5IBM A;  1SHB A;  4E68 A;  2EYZ A;  2LCT A;  3PSK A;  1AD5 A;  1LCJ A;  1KC2 A;  4L1B B;  1BLJ A;  5I6V A;  4D8K A;  1G83 A;  2EYY A;  1YVL A;  3HCK A;  4ROJ A;  3OVE A;  3VRO A;  1SHD A;  2DX0 A;  1AYC A;  3VS4 A;  4A4B A;  1O48 A;  1SKJ A;  1SHA A;  5GJH A;  1O42 A;  2BBU A;  1F2F A;  3IMJ A;  1SPS A;  4LUD A;  2AOA A;  4E93 A;  3MAZ A;  1JWO A;  3VRQ A;  2PLD A;  4K11 A;  3GXW A;  2ETZ A;  1O4E A;  1BHH A;  2SRC A;  1O4P A;  1Z3K A;  1LCK A;  3IMD A;  1O43 A;  2HCK A;  4M4Z A;  3VRR A;  4XZ0 A;  1BKM A;  1FBZ A;  3S9K A;  2ECD A;  2XP1 A;  2KNO A;  5DC9 A;  3WA4 A;  1LKK A;  3VS1 A;  5EG3 B;  1R1P A;  3M7F A;  4EY0 A;  3PSJ A;  1WQU A;  3OV1 A;  2LNX A;  3PS5 A;  2PNB A;  5BO4 A;  1MW4 A;  5EEQ A;  1QAD A;  2LNW A;  1O4L A;  3S8N A;  2L4K A;  2IUI A;  4GL9 E;  3VRP A;  2PTK A;  2RSY A;  2PNA A;  3BUO B;  5D0J A;  1A1C A;  3VRN A;  2MRJ A;  1O44 A;  4EIH A;  2Y1M A;  2DLZ A;  2C0I A;  3IN7 A;  2RVF A;  1Y1U A;  2C0T A;  1OPL A;  1CSZ A;  1O4H A;  1O4R A;  1AOT F;  1CJ1 A;  4JEG A;  4TZI A;  1M27 A;  3OB2 B;  4DGP A;  5DC0 B;  1B47 A;  3N84 A;  1AOU F;  5IBS A;  2Y1N A;  1CWE A;  4F59 A;  5KAZ A;  1I3Z A;  1LKL A;  3UF4 A;  1PIC A;  2GSB A;  2EO6 A;  3US4 A;  3PJP A;  2MRK A;  2H46 E;  1QG1 E;  1O4K A;  3QWX X;  1NZL A;  3GQI B;  2PLE A;  2AUG A;  1AB2 A;  2DLY A;  1NRV A;  1AYD A;  3KFJ A;  3OP0 A;  4FBN A;  3CWG A;  4QSY A;  1HCS B;  3VS5 A;  1BF5 A;  2HDV A;  3TKZ A;  3BUN B;  2CR4 A;  1R1S A;  1O4G A;  2YU7 A;  1A08 A;  2DCR A;  1O4N A;  3K2M A;  3T04 A;  3VS2 A;  1O4I A;  1LUK A;  2L3T A;  3UYO A;  4XZ1 A;  1A1E A;  1O4D A;  1JYR A;  4FL3 A;  1YVH A;  1JU5 A;  5GJI A;  1D4W A;  1AYA A;  1QCF A;  3PFV A;  4JGH A;  1A1A A;  1O4F A;  4A4C A;  3VS6 A;  1ZFP E;  2FO0 A;  2H5K A;  1BLK A;  5HKZ A;  3GXX A;  3QWY A;  4FL2 A;  2LQW A;  2CRH A;  4JE4 A;  1BFI A;  1MIL A;  5AUL A;  1O4Q A;  2IZV A;  4GWF A;  1XA6 A;  2H8H A;  3VS7 A;  1O4A A;  1M61 A;  1OO4 A;  2EKX A;  3N8M A;  2DM0 A;  4X6S A;  5HKW A;  1D1Z A;  1Y57 A;  1CWD L;  4LUE A;  3HHM B;  5EHR A;  4WWQ A;  1IS0 A;  1FMK A;  5EEL A;  1KA6 A;  3BKB A;  3CD3 A;  4DGX A;  2YSX A;  4GPL B;  1FBV A;  4U17 A;  1JYU A;  2ROR A;  1SPR A;  3S8L A;  4H34 A;  2OQ1 A;  4NWG A;  5HKY A;  1X27 A;  3VRZ A;  1KA7 A;  1X6C A;  2MC1 A;  5DC4 A;  3BUX B;  2SHP A;  3TL0 A;  2CIA A;  3MXC A;  4K44 A;  1O45 A;  2L6K A;  3BUW B;  3PQZ A;  1BFJ A;  1BG1 A;  2CS0 A;  5DF6 A;  2CI9 A;  2OZO A;  3EAZ A;  2GE9 A;  1O4O A;  1HCT B;  4K45 A;  3ZNI A;  3HIZ B;  4U1P A;  1IJR A;  2EU0 A;  2LQN A;  4OHI A;  3OB1 B;  2MK2 A;  1D4T A;  2K79 B;  1K9A A;  1GRI A;  1O4J A;  1FU5 A;  3BUM B;  4H1O A;  2IUH A;  1O4B A;  3EAC A;  1RQQ C;  1A1B A;  2HMH A;  1BHH B;  1BMB A;  2AOB A;  1BHF A;  1KSW A;  1LUI A;  3IN8 A;  2B3O A;  1RJA A;  4OHE A;  2C0O A;  1LUN A;  1LUM A;  4NWF A;  2HUW A;  1BKL A;  3PLF B;  5J3X A;  1P13 A;  2QMS A;  2Y3A B;  1R1Q A;  1A81 A;  1X0N A;  1UUR A;  2C9W A;  4OHD A;  2FCI A;  1UUS A;  3NHN A;  2HDX A;  4F5A A;  4OHH A;  3N7Y A;  4P9V A; 
#chains in the Genus database with same CATH topology
 3VS3 A;  1O46 A;  1O47 A;  3VRY A;  1FHS A;  1O41 A;  1TZE E;  5AXI A;  1GHU A;  2VIF A;  5CDW A;  1H9O A;  2EO3 A;  4F5B A;  3VGO A;  2RMX A;  1JYQ A;  1TCE A;  3C7I A;  1O4M A;  3S8O A;  2KGY A;  4K2R A;  1FU6 A;  2KK6 A;  1A09 A;  5EHP A;  1AYB A;  1O49 A;  3CBL A;  3CXL A;  3K2T A;  4P9Z A;  2CI8 A;  2ABL A;  3MXY A;  1CSY A;  2IUG A;  2DVJ A;  1BM2 A;  4OHL A;  1RPY A;  2K7A B;  1O4C A;  1FYR A;  2EL8 A;  1F1W A;  2EOB A;  1A07 A;  1OO3 A;  2MQI A;  1NZV A;  2CBL A;  1OPK A;  2JYQ A;  3VS0 A;  2EYV A;  5IBM A;  1SHB A;  4E68 A;  2EYZ A;  2LCT A;  3PSK A;  1AD5 A;  1LCJ A;  1KC2 A;  4L1B B;  1BLJ A;  5I6V A;  4D8K A;  1G83 A;  2EYY A;  1YVL A;  3HCK A;  4ROJ A;  3OVE A;  3VRO A;  1SHD A;  2DX0 A;  1AYC A;  3VS4 A;  4A4B A;  1O48 A;  1SKJ A;  1SHA A;  5GJH A;  1O42 A;  2BBU A;  1F2F A;  3IMJ A;  1SPS A;  4LUD A;  2AOA A;  4E93 A;  3MAZ A;  1JWO A;  3VRQ A;  2PLD A;  4K11 A;  3GXW A;  2ETZ A;  1O4E A;  1BHH A;  2SRC A;  1O4P A;  1Z3K A;  1LCK A;  3IMD A;  1O43 A;  2HCK A;  4M4Z A;  3VRR A;  4XZ0 A;  1BKM A;  1FBZ A;  3S9K A;  2ECD A;  2XP1 A;  2KNO A;  5DC9 A;  3WA4 A;  1LKK A;  3VS1 A;  5EG3 B;  1R1P A;  3M7F A;  4EY0 A;  3PSJ A;  1WQU A;  3OV1 A;  2LNX A;  3PS5 A;  2PNB A;  5BO4 A;  1MW4 A;  5EEQ A;  1QAD A;  2LNW A;  1O4L A;  3S8N A;  2L4K A;  2IUI A;  4GL9 E;  3VRP A;  2PTK A;  2RSY A;  2PNA A;  3BUO B;  5D0J A;  1A1C A;  3VRN A;  2MRJ A;  1O44 A;  4EIH A;  2Y1M A;  2DLZ A;  2C0I A;  3IN7 A;  2RVF A;  1Y1U A;  2C0T A;  1OPL A;  1CSZ A;  1O4H A;  1O4R A;  1AOT F;  1CJ1 A;  4JEG A;  4TZI A;  1M27 A;  3OB2 B;  4DGP A;  5DC0 B;  1B47 A;  3N84 A;  1AOU F;  5IBS A;  2Y1N A;  1CWE A;  4F59 A;  5KAZ A;  1I3Z A;  1LKL A;  3UF4 A;  1PIC A;  2GSB A;  2EO6 A;  3US4 A;  3PJP A;  2MRK A;  2H46 E;  1QG1 E;  1O4K A;  3QWX X;  1NZL A;  3GQI B;  2PLE A;  2AUG A;  1AB2 A;  2DLY A;  1NRV A;  1AYD A;  3KFJ A;  3OP0 A;  4FBN A;  3CWG A;  4QSY A;  1HCS B;  3VS5 A;  1BF5 A;  2HDV A;  3TKZ A;  3BUN B;  2CR4 A;  1R1S A;  1O4G A;  2YU7 A;  1A08 A;  2DCR A;  1O4N A;  3K2M A;  3T04 A;  3VS2 A;  1O4I A;  1LUK A;  2L3T A;  3UYO A;  4XZ1 A;  1A1E A;  1O4D A;  1JYR A;  4FL3 A;  1YVH A;  1JU5 A;  5GJI A;  1D4W A;  1AYA A;  1QCF A;  3PFV A;  4JGH A;  1A1A A;  1O4F A;  4A4C A;  3VS6 A;  1ZFP E;  2FO0 A;  2H5K A;  1BLK A;  5HKZ A;  3GXX A;  3QWY A;  4FL2 A;  2LQW A;  2CRH A;  4JE4 A;  1BFI A;  1MIL A;  5AUL A;  1O4Q A;  2IZV A;  4GWF A;  1XA6 A;  2H8H A;  3VS7 A;  1O4A A;  1M61 A;  1OO4 A;  2EKX A;  3N8M A;  2DM0 A;  4X6S A;  5HKW A;  1D1Z A;  1Y57 A;  1CWD L;  4LUE A;  3HHM B;  5EHR A;  4WWQ A;  1IS0 A;  1FMK A;  5EEL A;  1KA6 A;  3BKB A;  3CD3 A;  4DGX A;  2YSX A;  4GPL B;  1FBV A;  4U17 A;  1JYU A;  2ROR A;  1SPR A;  3S8L A;  4H34 A;  2OQ1 A;  4NWG A;  5HKY A;  1X27 A;  3VRZ A;  1KA7 A;  1X6C A;  2MC1 A;  5DC4 A;  3BUX B;  2SHP A;  3TL0 A;  2CIA A;  3MXC A;  4K44 A;  1O45 A;  2L6K A;  3BUW B;  3PQZ A;  1BFJ A;  1BG1 A;  2CS0 A;  5DF6 A;  2CI9 A;  2OZO A;  3EAZ A;  2GE9 A;  1O4O A;  1HCT B;  4K45 A;  3ZNI A;  3HIZ B;  4U1P A;  1IJR A;  2EU0 A;  2LQN A;  4OHI A;  3OB1 B;  2MK2 A;  2LRA A;  1D4T A;  2K79 B;  1K9A A;  1GRI A;  1O4J A;  1FU5 A;  3BUM B;  4H1O A;  2IUH A;  1O4B A;  3EAC A;  1RQQ C;  1A1B A;  2HMH A;  1BHH B;  1BMB A;  2AOB A;  1BHF A;  1KSW A;  1LUI A;  3IN8 A;  2B3O A;  1RJA A;  4OHE A;  2C0O A;  1LUN A;  1LUM A;  4NWF A;  2HUW A;  1BKL A;  3PLF B;  5J3X A;  1P13 A;  2QMS A;  2Y3A B;  1R1Q A;  1A81 A;  1X0N A;  1UUR A;  2C9W A;  4OHD A;  2FCI A;  1UUS A;  3NHN A;  2HDX A;  4F5A A;  3LYV A;  4OHH A;  3N7Y A;  4P9V A; 
#chains in the Genus database with same CATH homology
 3VS3 A;  1O46 A;  1O47 A;  3VRY A;  1FHS A;  1O41 A;  1TZE E;  5AXI A;  1GHU A;  2VIF A;  5CDW A;  1H9O A;  2EO3 A;  4F5B A;  3VGO A;  2RMX A;  1JYQ A;  1TCE A;  3C7I A;  1O4M A;  3S8O A;  4K2R A;  1FU6 A;  2KK6 A;  1A09 A;  5EHP A;  1AYB A;  1O49 A;  3CBL A;  3CXL A;  4P9Z A;  2CI8 A;  2ABL A;  3MXY A;  1CSY A;  2IUG A;  2DVJ A;  1BM2 A;  4OHL A;  1RPY A;  2K7A B;  1O4C A;  1FYR A;  2EL8 A;  1F1W A;  2EOB A;  1A07 A;  1OO3 A;  2MQI A;  1NZV A;  2CBL A;  1OPK A;  2JYQ A;  3VS0 A;  2EYV A;  5IBM A;  1SHB A;  4E68 A;  2EYZ A;  2LCT A;  3PSK A;  1AD5 A;  1LCJ A;  1KC2 A;  4L1B B;  1BLJ A;  5I6V A;  4D8K A;  1G83 A;  2EYY A;  1YVL A;  3HCK A;  4ROJ A;  3OVE A;  3VRO A;  1SHD A;  2DX0 A;  1AYC A;  3VS4 A;  4A4B A;  1O48 A;  1SKJ A;  1SHA A;  5GJH A;  1O42 A;  2BBU A;  1F2F A;  3IMJ A;  1SPS A;  4LUD A;  2AOA A;  4E93 A;  3MAZ A;  1JWO A;  3VRQ A;  2PLD A;  4K11 A;  3GXW A;  2ETZ A;  1O4E A;  1BHH A;  2SRC A;  1O4P A;  1Z3K A;  1LCK A;  3IMD A;  1O43 A;  2HCK A;  4M4Z A;  3VRR A;  4XZ0 A;  1BKM A;  1FBZ A;  3S9K A;  2ECD A;  2XP1 A;  2KNO A;  5DC9 A;  3WA4 A;  1LKK A;  3VS1 A;  5EG3 B;  1R1P A;  3M7F A;  4EY0 A;  3PSJ A;  1WQU A;  3OV1 A;  2LNX A;  3PS5 A;  2PNB A;  5BO4 A;  1MW4 A;  5EEQ A;  1QAD A;  2LNW A;  1O4L A;  3S8N A;  2L4K A;  2IUI A;  4GL9 E;  3VRP A;  2PTK A;  2RSY A;  2PNA A;  3BUO B;  5D0J A;  1A1C A;  3VRN A;  2MRJ A;  1O44 A;  4EIH A;  2Y1M A;  2DLZ A;  2C0I A;  3IN7 A;  2RVF A;  1Y1U A;  2C0T A;  1OPL A;  1CSZ A;  1O4H A;  1O4R A;  1AOT F;  1CJ1 A;  4JEG A;  4TZI A;  1M27 A;  3OB2 B;  4DGP A;  5DC0 B;  1B47 A;  3N84 A;  1AOU F;  5IBS A;  2Y1N A;  1CWE A;  4F59 A;  5KAZ A;  1I3Z A;  1LKL A;  3UF4 A;  1PIC A;  2GSB A;  2EO6 A;  3US4 A;  3PJP A;  2MRK A;  2H46 E;  1QG1 E;  1O4K A;  3QWX X;  1NZL A;  3GQI B;  2PLE A;  2AUG A;  1AB2 A;  2DLY A;  1NRV A;  1AYD A;  3KFJ A;  3OP0 A;  4FBN A;  3CWG A;  4QSY A;  1HCS B;  3VS5 A;  1BF5 A;  2HDV A;  3TKZ A;  3BUN B;  2CR4 A;  1R1S A;  1O4G A;  2YU7 A;  1A08 A;  2DCR A;  1O4N A;  3K2M A;  3T04 A;  3VS2 A;  1O4I A;  1LUK A;  2L3T A;  3UYO A;  4XZ1 A;  1A1E A;  1O4D A;  1JYR A;  4FL3 A;  1YVH A;  1JU5 A;  5GJI A;  1D4W A;  1AYA A;  1QCF A;  3PFV A;  4JGH A;  1A1A A;  1O4F A;  4A4C A;  3VS6 A;  1ZFP E;  2FO0 A;  2H5K A;  1BLK A;  5HKZ A;  3GXX A;  3QWY A;  4FL2 A;  2LQW A;  2CRH A;  4JE4 A;  1BFI A;  1MIL A;  5AUL A;  1O4Q A;  2IZV A;  4GWF A;  1XA6 A;  2H8H A;  3VS7 A;  1O4A A;  1M61 A;  1OO4 A;  2EKX A;  3N8M A;  2DM0 A;  4X6S A;  5HKW A;  1D1Z A;  1Y57 A;  1CWD L;  4LUE A;  3HHM B;  5EHR A;  4WWQ A;  1IS0 A;  1FMK A;  5EEL A;  1KA6 A;  3BKB A;  3CD3 A;  4DGX A;  2YSX A;  4GPL B;  1FBV A;  4U17 A;  1JYU A;  2ROR A;  1SPR A;  3S8L A;  4H34 A;  2OQ1 A;  4NWG A;  5HKY A;  1X27 A;  3VRZ A;  1KA7 A;  1X6C A;  2MC1 A;  5DC4 A;  3BUX B;  2SHP A;  3TL0 A;  2CIA A;  3MXC A;  4K44 A;  1O45 A;  2L6K A;  3BUW B;  3PQZ A;  1BFJ A;  1BG1 A;  2CS0 A;  5DF6 A;  2CI9 A;  2OZO A;  3EAZ A;  2GE9 A;  1O4O A;  1HCT B;  4K45 A;  3ZNI A;  3HIZ B;  4U1P A;  1IJR A;  2EU0 A;  2LQN A;  4OHI A;  3OB1 B;  2MK2 A;  1D4T A;  2K79 B;  1K9A A;  1GRI A;  1O4J A;  1FU5 A;  3BUM B;  4H1O A;  2IUH A;  1O4B A;  3EAC A;  1RQQ C;  1A1B A;  2HMH A;  1BHH B;  1BMB A;  2AOB A;  1BHF A;  1KSW A;  1LUI A;  3IN8 A;  2B3O A;  1RJA A;  4OHE A;  2C0O A;  1LUN A;  1LUM A;  4NWF A;  2HUW A;  1BKL A;  3PLF B;  5J3X A;  1P13 A;  2QMS A;  2Y3A B;  1R1Q A;  1A81 A;  1X0N A;  1UUR A;  2C9W A;  4OHD A;  2FCI A;  1UUS A;  3NHN A;  2HDX A;  4F5A A;  4OHH A;  3N7Y A;  4P9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...