3IN8A

Crystal structure of the grb2 sh2 domain in complex with a flexible ac-ptyr-ile-asn-nh2 tripeptide mimic
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
b'MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth factor receptor-bound protein 2
publication title Thermodynamic and Structural Effects of Conformational Constraints in Protein-Ligand Interactions. Entropic Paradoxy Associated with Ligand Preorganization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2009-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3in8A00
1O4AA 1QG1E 1B47A 4GPLB 4K44A 1FBZA 2DM0A 1QCFA 2EO3A 1FU5A 4DGPA 3S8LA 1H9OA 1LKLA 4L1BB 1HCSB 1A1AA 2EYZA 3GXXA 4OHHA 4FBNA 2L6KA 1D4TA 2PNAA 1X27A 4QSYA 3VRNA 2LNXA 1CWEA 1F1WA 1A1BA 1UURA 2MC1A 2EOBA 1O4HA 3TL0A 3VROA 1OPLA 5EHPA 1Y57A 1ZFPE 2H46E 1IS0A 2EO6A 1TZEE 3KFJA 1CWDL 1D1ZA 2PLDA 4FL2A 2HCKA 1O4BA 1O4PA 2GE9A 4DGXA 5AXIA 1O4MA 1LCKA 1AOUF 1O49A 3VS1A 1OO4A 3OP0A 4FL3A 1FBVA 3EAZA 5HKYA 1O44A 3IMJA 5DC0B 2C0IA 4X6SA 1BLKA 1AB2A 2B3OA 3BUOB 2RVFA 2CR4A 2H8HA 2IUIA 2Y3AB 4H34A 2LCTA 2DLZA 3PSJA 3US4A 1FYRA 2YSXA 1O47A 1A1EA 1O4JA 4GWFA 1M27A 1SPSA 3IN7A 1R1PA 2CRHA 3VRPA 2EKXA 4ROJA 3EACA 2KNOA 3BKBA 3GQIB 1FMKA 1A09A 3VGOA 2JYQA 1O48A 5HKZA 1CSYA 3M7FA 5EG3B 3OB1B 1LUNA 3UF4A 4K11A 2HDVA 2DLYA 3BUNB 4F5AA 5J3XA 5KAZA 1IJRA 2AOBA 3VS3A 2C0OA 1TCEA 4LUDA 2K79B 4E93A 3CXLA 3PFVA 4A4BA 2ECDA 5CDWA 3VS5A 3UYOA 2EL8A 2AOAA 1YVLA 1KC2A 1O4OA 2PNBA 2CI9A 1YVHA 3GXWA 5EEQA 1RJAA 3VRZA 2PTKA 5IBMA 1O4LA 3VS0A 4OHEA 2LNWA 1R1SA 3MXYA 3MAZA 1D4WA 5DF6A 1SKJA 4NWFA 4A4CA 1AYBA 2SRCA 1AYAA 2LQWA 1BMBA 2IUHA 4WWQA 3VRYA 4EY0A 2VIFA 1R1QA 1KSWA 1BKMA 1LKKA 1M61A 3BUMB 1MW4A 1LUIA 4P9VA 1BHHA 4F5BA 1WQUA 1I3ZA 1PICA 3WA4A 1LCJA 4OHDA 2MQIA 2ETZA 3PLFB 1MILA 2HDXA 4EIHA 4GL9E 2QMSA 2K7AB 2Y1MA 4U17A 1GRIA 3QWYA 3T04A 1F2FA 1A1CA 2AUGA 3BUWB 4XZ1A 5AULA 1SHAA 1Y1UA 2RSYA 1X0NA 1AYDA 3VS6A 1O4DA 1O4NA 2OZOA 5GJHA 4U1PA 3VRQA 2PLEA 4E68A 1O4EA 4F59A 1GHUA 1O43A 1QADA 4JGHA 1Z3KA 1BHFA 3OB2B 1BFIA 2MK2A 1OO3A 5GJIA 3CBLA 2DVJA 3PS5A 1NRVA 3IN8A 2C9WA 2DX0A 1BKLA 1K9AA 1HCTB 1XA6A 3HIZB 1A07A 1SHDA 1LUKA 3IMDA 2RORA 3CWGA 4K45A 1O4RA 3PQZA 1FU6A 2CBLA 3OVEA 5HKWA 1LUMA 1O41A 2IUGA 3BUXB 3K2MA 1RPYA 3NHNA 5EELA 3S9KA 3N84A 1RQQC 4JE4A 1X6CA 1NZLA 1O4KA 2YU7A 3QWXX 3PSKA 1AYCA 3C7IA 2L4KA 1P13A 3S8OA 1UUSA 5IBSA 2H5KA 1O4CA 1NZVA 2L3TA 2EU0A 4H1OA 2HUWA 1SPRA 1JYRA 1O45A 2MRJA 2LQNA 2FO0A 1A81A 3VS4A 1KA6A 3MXCA 3N7YA 5DC4A 3ZNIA 4OHLA 1O4GA 4LUEA 2EYYA 3CD3A 1FHSA 1OPKA 2KK6A 4P9ZA 1SHBA 2Y1NA 2HMHA 2SHPA 4XZ0A 3S8NA 1CJ1A 1A08A 2BBUA 2CIAA 1G83A 1BFJA 3VS7A 3PJPA 1AOTF 5I6VA 1JWOA 1BHHB 2ABLA 2DCRA 5D0JA 1BM2A 4JEGA 1JU5A 3HCKA 2CS0A 1O4FA 1JYUA 1JYQA 3VRRA 5DC9A 2CI8A 2EYVA 2C0TA 1O4QA 4OHIA 4TZIA 2IZVA 1O46A 2OQ1A 2XP1A 1KA7A 4K2RA 1CSZA 3HHMB 1AD5A 2MRKA 2FCIA 1BLJA 3OV1A 1O4IA 3N8MA 5EHRA 3VS2A 1BG1A 5BO4A 4M4ZA 4NWGA 4D8KA 3TKZA 1O42A 2RMXA 1BF5A 2GSBA
chains in the Genus database with same CATH superfamily
1O4AA 1QG1E 1B47A 4GPLB 4K44A 1FBZA 2DM0A 1QCFA 2EO3A 1FU5A 4DGPA 3S8LA 1H9OA 1LKLA 4L1BB 1HCSB 1A1AA 2EYZA 3GXXA 4OHHA 4FBNA 2L6KA 1D4TA 2PNAA 1X27A 4QSYA 3VRNA 2LNXA 1CWEA 1F1WA 1A1BA 1UURA 2MC1A 2EOBA 1O4HA 3TL0A 3VROA 1OPLA 5EHPA 1Y57A 1ZFPE 2H46E 1IS0A 2EO6A 1TZEE 3KFJA 1CWDL 1D1ZA 2PLDA 4FL2A 2HCKA 1O4BA 1O4PA 2GE9A 4DGXA 5AXIA 1O4MA 1LCKA 1AOUF 1O49A 3VS1A 1OO4A 3OP0A 4FL3A 1FBVA 3EAZA 5HKYA 1O44A 3IMJA 5DC0B 2LRAA 2C0IA 4X6SA 1BLKA 1AB2A 2B3OA 3BUOB 2RVFA 2CR4A 2H8HA 2IUIA 2Y3AB 4H34A 2LCTA 2DLZA 3PSJA 3US4A 1FYRA 2YSXA 1O47A 1A1EA 1O4JA 4GWFA 1M27A 1SPSA 3IN7A 1R1PA 2CRHA 3VRPA 2EKXA 4ROJA 3EACA 2KNOA 3BKBA 3GQIB 1FMKA 1A09A 3VGOA 2JYQA 1O48A 5HKZA 1CSYA 3M7FA 5EG3B 3OB1B 1LUNA 2KGYA 3UF4A 4K11A 2HDVA 2DLYA 3BUNB 4F5AA 5J3XA 5KAZA 1IJRA 2AOBA 3VS3A 2C0OA 1TCEA 4LUDA 2K79B 4E93A 3CXLA 3PFVA 4A4BA 2ECDA 5CDWA 3VS5A 3LYVA 2EL8A 2AOAA 3UYOA 1YVLA 1KC2A 1O4OA 2PNBA 2CI9A 1YVHA 3GXWA 5EEQA 1RJAA 3VRZA 2PTKA 5IBMA 1O4LA 3VS0A 4OHEA 2LNWA 1R1SA 3MXYA 3MAZA 1D4WA 5DF6A 1SKJA 4NWFA 4A4CA 1AYBA 2SRCA 1AYAA 2LQWA 1BMBA 2IUHA 4WWQA 3VRYA 4EY0A 2VIFA 1R1QA 1KSWA 1BKMA 1LKKA 1M61A 3BUMB 1MW4A 1LUIA 4P9VA 1BHHA 4F5BA 1WQUA 1I3ZA 1PICA 3WA4A 1LCJA 4OHDA 2MQIA 2ETZA 3PLFB 1MILA 2HDXA 4EIHA 4GL9E 2QMSA 2K7AB 2Y1MA 4U17A 1GRIA 3QWYA 3T04A 1F2FA 1A1CA 2AUGA 3BUWB 4XZ1A 5AULA 1SHAA 1Y1UA 2RSYA 1X0NA 1AYDA 3VS6A 3K2TA 1O4DA 1O4NA 2OZOA 5GJHA 4U1PA 3VRQA 2PLEA 4E68A 1O4EA 4F59A 1GHUA 1O43A 1QADA 4JGHA 1Z3KA 1BHFA 3OB2B 1BFIA 2MK2A 1OO3A 5GJIA 3CBLA 2DVJA 3PS5A 1NRVA 3IN8A 2C9WA 2DX0A 1BKLA 1K9AA 1HCTB 1XA6A 3HIZB 1A07A 1SHDA 1LUKA 3IMDA 2RORA 3CWGA 4K45A 1O4RA 3PQZA 1FU6A 2CBLA 3OVEA 5HKWA 1LUMA 1O41A 2IUGA 3BUXB 3K2MA 1RPYA 3NHNA 5EELA 3S9KA 3N84A 1RQQC 4JE4A 1X6CA 1NZLA 1O4KA 2YU7A 3QWXX 3PSKA 1AYCA 3C7IA 2L4KA 1P13A 3S8OA 1UUSA 5IBSA 2H5KA 1O4CA 1NZVA 2L3TA 2EU0A 4H1OA 2HUWA 1SPRA 1JYRA 1O45A 2MRJA 2LQNA 2FO0A 1A81A 3VS4A 1KA6A 3MXCA 3N7YA 5DC4A 3ZNIA 4OHLA 1O4GA 4LUEA 2EYYA 3CD3A 1FHSA 1OPKA 2KK6A 4P9ZA 1SHBA 2Y1NA 2HMHA 2SHPA 4XZ0A 3S8NA 1CJ1A 1A08A 2BBUA 2CIAA 1G83A 1BFJA 3VS7A 3PJPA 1AOTF 5I6VA 1JWOA 1BHHB 2ABLA 2DCRA 5D0JA 1BM2A 4JEGA 1JU5A 3HCKA 2CS0A 1O4FA 1JYUA 1JYQA 3VRRA 5DC9A 2CI8A 2EYVA 2C0TA 1O4QA 4OHIA 4TZIA 2IZVA 1O46A 2OQ1A 2XP1A 1KA7A 4K2RA 1CSZA 3HHMB 1AD5A 2MRKA 2FCIA 1BLJA 3OV1A 1O4IA 3N8MA 5EHRA 3VS2A 1BG1A 5BO4A 4M4ZA 4NWGA 4D8KA 3TKZA 1O42A 2RMXA 1BF5A 2GSBA
chains in the Genus database with same CATH topology
1O4AA 1QG1E 1B47A 4GPLB 4K44A 1FBZA 2DM0A 1QCFA 2EO3A 1FU5A 4DGPA 3S8LA 1H9OA 1LKLA 4L1BB 1HCSB 1A1AA 2EYZA 3GXXA 4OHHA 4FBNA 2L6KA 1D4TA 2PNAA 1X27A 4QSYA 3VRNA 2LNXA 1CWEA 1F1WA 1A1BA 1UURA 2MC1A 2EOBA 1O4HA 3TL0A 3VROA 1OPLA 5EHPA 1Y57A 1ZFPE 2H46E 1IS0A 2EO6A 1TZEE 3KFJA 1CWDL 1D1ZA 2PLDA 4FL2A 2HCKA 1O4BA 1O4PA 2GE9A 4DGXA 5AXIA 1O4MA 1LCKA 1AOUF 1O49A 3VS1A 1OO4A 3OP0A 4FL3A 1FBVA 3EAZA 5HKYA 1O44A 3IMJA 5DC0B 2C0IA 4X6SA 1BLKA 1AB2A 2B3OA 3BUOB 2RVFA 2CR4A 2H8HA 2IUIA 2Y3AB 4H34A 2LCTA 2DLZA 3PSJA 3US4A 1FYRA 2YSXA 1O47A 1A1EA 1O4JA 4GWFA 1M27A 1SPSA 3IN7A 1R1PA 2CRHA 3VRPA 2EKXA 4ROJA 3EACA 2KNOA 3BKBA 3GQIB 1FMKA 1A09A 3VGOA 2JYQA 1O48A 5HKZA 1CSYA 3M7FA 5EG3B 3OB1B 1LUNA 3UF4A 4K11A 2HDVA 2DLYA 3BUNB 4F5AA 5J3XA 5KAZA 1IJRA 2AOBA 3VS3A 2C0OA 1TCEA 4LUDA 2K79B 4E93A 3CXLA 3PFVA 4A4BA 2ECDA 5CDWA 3VS5A 3UYOA 2EL8A 2AOAA 1YVLA 1KC2A 1O4OA 2PNBA 2CI9A 1YVHA 3GXWA 5EEQA 1RJAA 3VRZA 2PTKA 5IBMA 1O4LA 3VS0A 4OHEA 2LNWA 1R1SA 3MXYA 3MAZA 1D4WA 5DF6A 1SKJA 4NWFA 4A4CA 1AYBA 2SRCA 1AYAA 2LQWA 1BMBA 2IUHA 4WWQA 3VRYA 4EY0A 2VIFA 1R1QA 1KSWA 1BKMA 1LKKA 1M61A 3BUMB 1MW4A 1LUIA 4P9VA 1BHHA 4F5BA 1WQUA 1I3ZA 1PICA 3WA4A 1LCJA 4OHDA 2MQIA 2ETZA 3PLFB 1MILA 2HDXA 4EIHA 4GL9E 2QMSA 2K7AB 2Y1MA 4U17A 1GRIA 3QWYA 3T04A 1F2FA 1A1CA 2AUGA 3BUWB 4XZ1A 5AULA 1SHAA 1Y1UA 2RSYA 1X0NA 1AYDA 3VS6A 1O4DA 1O4NA 2OZOA 5GJHA 4U1PA 3VRQA 2PLEA 4E68A 1O4EA 4F59A 1GHUA 1O43A 1QADA 4JGHA 1Z3KA 1BHFA 3OB2B 1BFIA 2MK2A 1OO3A 5GJIA 3CBLA 2DVJA 3PS5A 1NRVA 3IN8A 2C9WA 2DX0A 1BKLA 1K9AA 1HCTB 1XA6A 3HIZB 1A07A 1SHDA 1LUKA 3IMDA 2RORA 3CWGA 4K45A 1O4RA 3PQZA 1FU6A 2CBLA 3OVEA 5HKWA 1LUMA 1O41A 2IUGA 3BUXB 3K2MA 1RPYA 3NHNA 5EELA 3S9KA 3N84A 1RQQC 4JE4A 1X6CA 1NZLA 1O4KA 2YU7A 3QWXX 3PSKA 1AYCA 3C7IA 2L4KA 1P13A 3S8OA 1UUSA 5IBSA 2H5KA 1O4CA 1NZVA 2L3TA 2EU0A 4H1OA 2HUWA 1SPRA 1JYRA 1O45A 2MRJA 2LQNA 2FO0A 1A81A 3VS4A 1KA6A 3MXCA 3N7YA 5DC4A 3ZNIA 4OHLA 1O4GA 4LUEA 2EYYA 3CD3A 1FHSA 1OPKA 2KK6A 4P9ZA 1SHBA 2Y1NA 2HMHA 2SHPA 4XZ0A 3S8NA 1CJ1A 1A08A 2BBUA 2CIAA 1G83A 1BFJA 3VS7A 3PJPA 1AOTF 5I6VA 1JWOA 1BHHB 2ABLA 2DCRA 5D0JA 1BM2A 4JEGA 1JU5A 3HCKA 2CS0A 1O4FA 1JYUA 1JYQA 3VRRA 5DC9A 2CI8A 2EYVA 2C0TA 1O4QA 4OHIA 4TZIA 2IZVA 1O46A 2OQ1A 2XP1A 1KA7A 4K2RA 1CSZA 3HHMB 1AD5A 2MRKA 2FCIA 1BLJA 3OV1A 1O4IA 3N8MA 5EHRA 3VS2A 1BG1A 5BO4A 4M4ZA 4NWGA 4D8KA 3TKZA 1O42A 2RMXA 1BF5A 2GSBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O4A A;  1QG1 E;  1B47 A;  4GPL B;  4K44 A;  1FBZ A;  2DM0 A;  1QCF A;  2EO3 A;  1FU5 A;  4DGP A;  3S8L A;  1H9O A;  1LKL A;  4L1B B;  1HCS B;  1A1A A;  2EYZ A;  3GXX A;  4OHH A;  4FBN A;  2L6K A;  1D4T A;  2PNA A;  1X27 A;  4QSY A;  3VRN A;  2LNX A;  1CWE A;  1F1W A;  1A1B A;  1UUR A;  2MC1 A;  2EOB A;  1O4H A;  3TL0 A;  3VRO A;  1OPL A;  5EHP A;  1Y57 A;  1ZFP E;  2H46 E;  1IS0 A;  2EO6 A;  1TZE E;  3KFJ A;  1CWD L;  1D1Z A;  2PLD A;  4FL2 A;  2HCK A;  1O4B A;  1O4P A;  2GE9 A;  4DGX A;  5AXI A;  1O4M A;  1LCK A;  1AOU F;  1O49 A;  3VS1 A;  1OO4 A;  3OP0 A;  4FL3 A;  1FBV A;  3EAZ A;  5HKY A;  1O44 A;  3IMJ A;  5DC0 B;  2C0I A;  4X6S A;  1BLK A;  1AB2 A;  2B3O A;  3BUO B;  2RVF A;  2CR4 A;  2H8H A;  2IUI A;  2Y3A B;  4H34 A;  2LCT A;  2DLZ A;  3PSJ A;  3US4 A;  1FYR A;  2YSX A;  1O47 A;  1A1E A;  1O4J A;  4GWF A;  1M27 A;  1SPS A;  3IN7 A;  1R1P A;  2CRH A;  3VRP A;  2EKX A;  4ROJ A;  3EAC A;  2KNO A;  3BKB A;  3GQI B;  1FMK A;  1A09 A;  3VGO A;  2JYQ A;  1O48 A;  5HKZ A;  1CSY A;  3M7F A;  5EG3 B;  3OB1 B;  1LUN A;  3UF4 A;  4K11 A;  2HDV A;  2DLY A;  3BUN B;  4F5A A;  5J3X A;  5KAZ A;  1IJR A;  2AOB A;  3VS3 A;  2C0O A;  1TCE A;  4LUD A;  2K79 B;  4E93 A;  3CXL A;  3PFV A;  4A4B A;  2ECD A;  5CDW A;  3VS5 A;  3UYO A;  2EL8 A;  2AOA A;  1YVL A;  1KC2 A;  1O4O A;  2PNB A;  2CI9 A;  1YVH A;  3GXW A;  5EEQ A;  1RJA A;  3VRZ A;  2PTK A;  5IBM A;  1O4L A;  3VS0 A;  4OHE A;  2LNW A;  1R1S A;  3MXY A;  3MAZ A;  1D4W A;  5DF6 A;  1SKJ A;  4NWF A;  4A4C A;  1AYB A;  2SRC A;  1AYA A;  2LQW A;  1BMB A;  2IUH A;  4WWQ A;  3VRY A;  4EY0 A;  2VIF A;  1R1Q A;  1KSW A;  1BKM A;  1LKK A;  1M61 A;  3BUM B;  1MW4 A;  1LUI A;  4P9V A;  1BHH A;  4F5B A;  1WQU A;  1I3Z A;  1PIC A;  3WA4 A;  1LCJ A;  4OHD A;  2MQI A;  2ETZ A;  3PLF B;  1MIL A;  2HDX A;  4EIH A;  4GL9 E;  2QMS A;  2K7A B;  2Y1M A;  4U17 A;  1GRI A;  3QWY A;  3T04 A;  1F2F A;  1A1C A;  2AUG A;  3BUW B;  4XZ1 A;  5AUL A;  1SHA A;  1Y1U A;  2RSY A;  1X0N A;  1AYD A;  3VS6 A;  1O4D A;  1O4N A;  2OZO A;  5GJH A;  4U1P A;  3VRQ A;  2PLE A;  4E68 A;  1O4E A;  4F59 A;  1GHU A;  1O43 A;  1QAD A;  4JGH A;  1Z3K A;  1BHF A;  3OB2 B;  1BFI A;  2MK2 A;  1OO3 A;  5GJI A;  3CBL A;  2DVJ A;  3PS5 A;  1NRV A;  3IN8 A;  2C9W A;  2DX0 A;  1BKL A;  1K9A A;  1HCT B;  1XA6 A;  3HIZ B;  1A07 A;  1SHD A;  1LUK A;  3IMD A;  2ROR A;  3CWG A;  4K45 A;  1O4R A;  3PQZ A;  1FU6 A;  2CBL A;  3OVE A;  5HKW A;  1LUM A;  1O41 A;  2IUG A;  3BUX B;  3K2M A;  1RPY A;  3NHN A;  5EEL A;  3S9K A;  3N84 A;  1RQQ C;  4JE4 A;  1X6C A;  1NZL A;  1O4K A;  2YU7 A;  3QWX X;  3PSK A;  1AYC A;  3C7I A;  2L4K A;  1P13 A;  3S8O A;  1UUS A;  5IBS A;  2H5K A;  1O4C A;  1NZV A;  2L3T A;  2EU0 A;  4H1O A;  2HUW A;  1SPR A;  1JYR A;  1O45 A;  2MRJ A;  2LQN A;  2FO0 A;  1A81 A;  3VS4 A;  1KA6 A;  3MXC A;  3N7Y A;  5DC4 A;  3ZNI A;  4OHL A;  1O4G A;  4LUE A;  2EYY A;  3CD3 A;  1FHS A;  1OPK A;  2KK6 A;  4P9Z A;  1SHB A;  2Y1N A;  2HMH A;  2SHP A;  4XZ0 A;  3S8N A;  1CJ1 A;  1A08 A;  2BBU A;  2CIA A;  1G83 A;  1BFJ A;  3VS7 A;  3PJP A;  1AOT F;  5I6V A;  1JWO A;  1BHH B;  2ABL A;  2DCR A;  5D0J A;  1BM2 A;  4JEG A;  1JU5 A;  3HCK A;  2CS0 A;  1O4F A;  1JYU A;  1JYQ A;  3VRR A;  5DC9 A;  2CI8 A;  2EYV A;  2C0T A;  1O4Q A;  4OHI A;  4TZI A;  2IZV A;  1O46 A;  2OQ1 A;  2XP1 A;  1KA7 A;  4K2R A;  1CSZ A;  3HHM B;  1AD5 A;  2MRK A;  2FCI A;  1BLJ A;  3OV1 A;  1O4I A;  3N8M A;  5EHR A;  3VS2 A;  1BG1 A;  5BO4 A;  4M4Z A;  4NWG A;  4D8K A;  3TKZ A;  1O42 A;  2RMX A;  1BF5 A;  2GSB A; 
#chains in the Genus database with same CATH topology
 1O4A A;  1QG1 E;  1B47 A;  4GPL B;  4K44 A;  1FBZ A;  2DM0 A;  1QCF A;  2EO3 A;  1FU5 A;  4DGP A;  3S8L A;  1H9O A;  1LKL A;  4L1B B;  1HCS B;  1A1A A;  2EYZ A;  3GXX A;  4OHH A;  4FBN A;  2L6K A;  1D4T A;  2PNA A;  1X27 A;  4QSY A;  3VRN A;  2LNX A;  1CWE A;  1F1W A;  1A1B A;  1UUR A;  2MC1 A;  2EOB A;  1O4H A;  3TL0 A;  3VRO A;  1OPL A;  5EHP A;  1Y57 A;  1ZFP E;  2H46 E;  1IS0 A;  2EO6 A;  1TZE E;  3KFJ A;  1CWD L;  1D1Z A;  2PLD A;  4FL2 A;  2HCK A;  1O4B A;  1O4P A;  2GE9 A;  4DGX A;  5AXI A;  1O4M A;  1LCK A;  1AOU F;  1O49 A;  3VS1 A;  1OO4 A;  3OP0 A;  4FL3 A;  1FBV A;  3EAZ A;  5HKY A;  1O44 A;  3IMJ A;  5DC0 B;  2LRA A;  2C0I A;  4X6S A;  1BLK A;  1AB2 A;  2B3O A;  3BUO B;  2RVF A;  2CR4 A;  2H8H A;  2IUI A;  2Y3A B;  4H34 A;  2LCT A;  2DLZ A;  3PSJ A;  3US4 A;  1FYR A;  2YSX A;  1O47 A;  1A1E A;  1O4J A;  4GWF A;  1M27 A;  1SPS A;  3IN7 A;  1R1P A;  2CRH A;  3VRP A;  2EKX A;  4ROJ A;  3EAC A;  2KNO A;  3BKB A;  3GQI B;  1FMK A;  1A09 A;  3VGO A;  2JYQ A;  1O48 A;  5HKZ A;  1CSY A;  3M7F A;  5EG3 B;  3OB1 B;  1LUN A;  2KGY A;  3UF4 A;  4K11 A;  2HDV A;  2DLY A;  3BUN B;  4F5A A;  5J3X A;  5KAZ A;  1IJR A;  2AOB A;  3VS3 A;  2C0O A;  1TCE A;  4LUD A;  2K79 B;  4E93 A;  3CXL A;  3PFV A;  4A4B A;  2ECD A;  5CDW A;  3VS5 A;  3LYV A;  2EL8 A;  2AOA A;  3UYO A;  1YVL A;  1KC2 A;  1O4O A;  2PNB A;  2CI9 A;  1YVH A;  3GXW A;  5EEQ A;  1RJA A;  3VRZ A;  2PTK A;  5IBM A;  1O4L A;  3VS0 A;  4OHE A;  2LNW A;  1R1S A;  3MXY A;  3MAZ A;  1D4W A;  5DF6 A;  1SKJ A;  4NWF A;  4A4C A;  1AYB A;  2SRC A;  1AYA A;  2LQW A;  1BMB A;  2IUH A;  4WWQ A;  3VRY A;  4EY0 A;  2VIF A;  1R1Q A;  1KSW A;  1BKM A;  1LKK A;  1M61 A;  3BUM B;  1MW4 A;  1LUI A;  4P9V A;  1BHH A;  4F5B A;  1WQU A;  1I3Z A;  1PIC A;  3WA4 A;  1LCJ A;  4OHD A;  2MQI A;  2ETZ A;  3PLF B;  1MIL A;  2HDX A;  4EIH A;  4GL9 E;  2QMS A;  2K7A B;  2Y1M A;  4U17 A;  1GRI A;  3QWY A;  3T04 A;  1F2F A;  1A1C A;  2AUG A;  3BUW B;  4XZ1 A;  5AUL A;  1SHA A;  1Y1U A;  2RSY A;  1X0N A;  1AYD A;  3VS6 A;  3K2T A;  1O4D A;  1O4N A;  2OZO A;  5GJH A;  4U1P A;  3VRQ A;  2PLE A;  4E68 A;  1O4E A;  4F59 A;  1GHU A;  1O43 A;  1QAD A;  4JGH A;  1Z3K A;  1BHF A;  3OB2 B;  1BFI A;  2MK2 A;  1OO3 A;  5GJI A;  3CBL A;  2DVJ A;  3PS5 A;  1NRV A;  3IN8 A;  2C9W A;  2DX0 A;  1BKL A;  1K9A A;  1HCT B;  1XA6 A;  3HIZ B;  1A07 A;  1SHD A;  1LUK A;  3IMD A;  2ROR A;  3CWG A;  4K45 A;  1O4R A;  3PQZ A;  1FU6 A;  2CBL A;  3OVE A;  5HKW A;  1LUM A;  1O41 A;  2IUG A;  3BUX B;  3K2M A;  1RPY A;  3NHN A;  5EEL A;  3S9K A;  3N84 A;  1RQQ C;  4JE4 A;  1X6C A;  1NZL A;  1O4K A;  2YU7 A;  3QWX X;  3PSK A;  1AYC A;  3C7I A;  2L4K A;  1P13 A;  3S8O A;  1UUS A;  5IBS A;  2H5K A;  1O4C A;  1NZV A;  2L3T A;  2EU0 A;  4H1O A;  2HUW A;  1SPR A;  1JYR A;  1O45 A;  2MRJ A;  2LQN A;  2FO0 A;  1A81 A;  3VS4 A;  1KA6 A;  3MXC A;  3N7Y A;  5DC4 A;  3ZNI A;  4OHL A;  1O4G A;  4LUE A;  2EYY A;  3CD3 A;  1FHS A;  1OPK A;  2KK6 A;  4P9Z A;  1SHB A;  2Y1N A;  2HMH A;  2SHP A;  4XZ0 A;  3S8N A;  1CJ1 A;  1A08 A;  2BBU A;  2CIA A;  1G83 A;  1BFJ A;  3VS7 A;  3PJP A;  1AOT F;  5I6V A;  1JWO A;  1BHH B;  2ABL A;  2DCR A;  5D0J A;  1BM2 A;  4JEG A;  1JU5 A;  3HCK A;  2CS0 A;  1O4F A;  1JYU A;  1JYQ A;  3VRR A;  5DC9 A;  2CI8 A;  2EYV A;  2C0T A;  1O4Q A;  4OHI A;  4TZI A;  2IZV A;  1O46 A;  2OQ1 A;  2XP1 A;  1KA7 A;  4K2R A;  1CSZ A;  3HHM B;  1AD5 A;  2MRK A;  2FCI A;  1BLJ A;  3OV1 A;  1O4I A;  3N8M A;  5EHR A;  3VS2 A;  1BG1 A;  5BO4 A;  4M4Z A;  4NWG A;  4D8K A;  3TKZ A;  1O42 A;  2RMX A;  1BF5 A;  2GSB A; 
#chains in the Genus database with same CATH homology
 1O4A A;  1QG1 E;  1B47 A;  4GPL B;  4K44 A;  1FBZ A;  2DM0 A;  1QCF A;  2EO3 A;  1FU5 A;  4DGP A;  3S8L A;  1H9O A;  1LKL A;  4L1B B;  1HCS B;  1A1A A;  2EYZ A;  3GXX A;  4OHH A;  4FBN A;  2L6K A;  1D4T A;  2PNA A;  1X27 A;  4QSY A;  3VRN A;  2LNX A;  1CWE A;  1F1W A;  1A1B A;  1UUR A;  2MC1 A;  2EOB A;  1O4H A;  3TL0 A;  3VRO A;  1OPL A;  5EHP A;  1Y57 A;  1ZFP E;  2H46 E;  1IS0 A;  2EO6 A;  1TZE E;  3KFJ A;  1CWD L;  1D1Z A;  2PLD A;  4FL2 A;  2HCK A;  1O4B A;  1O4P A;  2GE9 A;  4DGX A;  5AXI A;  1O4M A;  1LCK A;  1AOU F;  1O49 A;  3VS1 A;  1OO4 A;  3OP0 A;  4FL3 A;  1FBV A;  3EAZ A;  5HKY A;  1O44 A;  3IMJ A;  5DC0 B;  2C0I A;  4X6S A;  1BLK A;  1AB2 A;  2B3O A;  3BUO B;  2RVF A;  2CR4 A;  2H8H A;  2IUI A;  2Y3A B;  4H34 A;  2LCT A;  2DLZ A;  3PSJ A;  3US4 A;  1FYR A;  2YSX A;  1O47 A;  1A1E A;  1O4J A;  4GWF A;  1M27 A;  1SPS A;  3IN7 A;  1R1P A;  2CRH A;  3VRP A;  2EKX A;  4ROJ A;  3EAC A;  2KNO A;  3BKB A;  3GQI B;  1FMK A;  1A09 A;  3VGO A;  2JYQ A;  1O48 A;  5HKZ A;  1CSY A;  3M7F A;  5EG3 B;  3OB1 B;  1LUN A;  3UF4 A;  4K11 A;  2HDV A;  2DLY A;  3BUN B;  4F5A A;  5J3X A;  5KAZ A;  1IJR A;  2AOB A;  3VS3 A;  2C0O A;  1TCE A;  4LUD A;  2K79 B;  4E93 A;  3CXL A;  3PFV A;  4A4B A;  2ECD A;  5CDW A;  3VS5 A;  3UYO A;  2EL8 A;  2AOA A;  1YVL A;  1KC2 A;  1O4O A;  2PNB A;  2CI9 A;  1YVH A;  3GXW A;  5EEQ A;  1RJA A;  3VRZ A;  2PTK A;  5IBM A;  1O4L A;  3VS0 A;  4OHE A;  2LNW A;  1R1S A;  3MXY A;  3MAZ A;  1D4W A;  5DF6 A;  1SKJ A;  4NWF A;  4A4C A;  1AYB A;  2SRC A;  1AYA A;  2LQW A;  1BMB A;  2IUH A;  4WWQ A;  3VRY A;  4EY0 A;  2VIF A;  1R1Q A;  1KSW A;  1BKM A;  1LKK A;  1M61 A;  3BUM B;  1MW4 A;  1LUI A;  4P9V A;  1BHH A;  4F5B A;  1WQU A;  1I3Z A;  1PIC A;  3WA4 A;  1LCJ A;  4OHD A;  2MQI A;  2ETZ A;  3PLF B;  1MIL A;  2HDX A;  4EIH A;  4GL9 E;  2QMS A;  2K7A B;  2Y1M A;  4U17 A;  1GRI A;  3QWY A;  3T04 A;  1F2F A;  1A1C A;  2AUG A;  3BUW B;  4XZ1 A;  5AUL A;  1SHA A;  1Y1U A;  2RSY A;  1X0N A;  1AYD A;  3VS6 A;  1O4D A;  1O4N A;  2OZO A;  5GJH A;  4U1P A;  3VRQ A;  2PLE A;  4E68 A;  1O4E A;  4F59 A;  1GHU A;  1O43 A;  1QAD A;  4JGH A;  1Z3K A;  1BHF A;  3OB2 B;  1BFI A;  2MK2 A;  1OO3 A;  5GJI A;  3CBL A;  2DVJ A;  3PS5 A;  1NRV A;  3IN8 A;  2C9W A;  2DX0 A;  1BKL A;  1K9A A;  1HCT B;  1XA6 A;  3HIZ B;  1A07 A;  1SHD A;  1LUK A;  3IMD A;  2ROR A;  3CWG A;  4K45 A;  1O4R A;  3PQZ A;  1FU6 A;  2CBL A;  3OVE A;  5HKW A;  1LUM A;  1O41 A;  2IUG A;  3BUX B;  3K2M A;  1RPY A;  3NHN A;  5EEL A;  3S9K A;  3N84 A;  1RQQ C;  4JE4 A;  1X6C A;  1NZL A;  1O4K A;  2YU7 A;  3QWX X;  3PSK A;  1AYC A;  3C7I A;  2L4K A;  1P13 A;  3S8O A;  1UUS A;  5IBS A;  2H5K A;  1O4C A;  1NZV A;  2L3T A;  2EU0 A;  4H1O A;  2HUW A;  1SPR A;  1JYR A;  1O45 A;  2MRJ A;  2LQN A;  2FO0 A;  1A81 A;  3VS4 A;  1KA6 A;  3MXC A;  3N7Y A;  5DC4 A;  3ZNI A;  4OHL A;  1O4G A;  4LUE A;  2EYY A;  3CD3 A;  1FHS A;  1OPK A;  2KK6 A;  4P9Z A;  1SHB A;  2Y1N A;  2HMH A;  2SHP A;  4XZ0 A;  3S8N A;  1CJ1 A;  1A08 A;  2BBU A;  2CIA A;  1G83 A;  1BFJ A;  3VS7 A;  3PJP A;  1AOT F;  5I6V A;  1JWO A;  1BHH B;  2ABL A;  2DCR A;  5D0J A;  1BM2 A;  4JEG A;  1JU5 A;  3HCK A;  2CS0 A;  1O4F A;  1JYU A;  1JYQ A;  3VRR A;  5DC9 A;  2CI8 A;  2EYV A;  2C0T A;  1O4Q A;  4OHI A;  4TZI A;  2IZV A;  1O46 A;  2OQ1 A;  2XP1 A;  1KA7 A;  4K2R A;  1CSZ A;  3HHM B;  1AD5 A;  2MRK A;  2FCI A;  1BLJ A;  3OV1 A;  1O4I A;  3N8M A;  5EHR A;  3VS2 A;  1BG1 A;  5BO4 A;  4M4Z A;  4NWG A;  4D8K A;  3TKZ A;  1O42 A;  2RMX A;  1BF5 A;  2GSB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...