3EACA

Crystal structure of sh2 domain of human csk (carboxyl-terminal src kinase), oxidized form.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
b'AGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase CSK
publication title Combining biophysical methods to analyze the disulfide bond in SH2 domain of C-terminal Src kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 22
structure length 101
sequence length 101
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3eacA00
1A1BA 1JWOA 3K2MA 3S8OA 4NWGA 4OHHA 1F2FA 2CI9A 2AOAA 1O47A 5KAZA 3N8MA 2PTKA 1O4PA 2PNBA 3GXWA 4GL9E 4K44A 3OB2B 2KK6A 1AOTF 1OO3A 1F1WA 5HKYA 5CDWA 4DGXA 1BFIA 2QMSA 5DC9A 4QSYA 1FBVA 2YU7A 1RQQC 1R1PA 4WWQA 3VRQA 1BKMA 1FHSA 3OV1A 1O4AA 2JYQA 3NHNA 3IN8A 1BFJA 1NRVA 2EYVA 4E68A 2EYYA 1LKKA 3S9KA 1O4BA 2DX0A 1QG1E 3BKBA 1ZFPE 5AULA 3TKZA 2CR4A 1G83A 1IS0A 3VRNA 1FBZA 1FU6A 5IBMA 1YVLA 3QWXX 5HKWA 1BLJA 2L3TA 1O4IA 2IZVA 1AYCA 3CD3A 2FO0A 1O4HA 1LKLA 1X27A 5DC4A 3M7FA 3VS7A 3CXLA 1X0NA 1NZVA 1Y57A 2HCKA 4EIHA 3BUNB 1OPLA 2H8HA 1BM2A 2PLEA 4D8KA 1M61A 1CWEA 3TL0A 2EKXA 1LUIA 3IMJA 1BKLA 1RJAA 1O43A 1GHUA 1SKJA 2MRKA 1O4LA 4P9VA 4F59A 3CWGA 2ETZA 3PJPA 4XZ1A 4E93A 5EHRA 3KFJA 3WA4A 1O4RA 2EL8A 3VRPA 4EY0A 1SHAA 1SHDA 1BHFA 4FL3A 1O4OA 2C0TA 2DCRA 1P13A 1A1AA 2YSXA 1OO4A 3VROA 2IUHA 2MRJA 4JE4A 3MXYA 1O41A 1A1EA 2KNOA 3VS4A 3BUWB 3BUXB 1O4CA 3UYOA 2VIFA 4OHIA 5EEQA 1R1QA 4FBNA 2EU0A 1O4MA 3MXCA 2L6KA 1AB2A 1HCSB 5BO4A 3N7YA 3VRRA 4DGPA 1BLKA 1CJ1A 2EO6A 2LQWA 1RPYA 4A4BA 1CSYA 2OZOA 3HIZB 2CS0A 1TCEA 2LCTA 1KC2A 1JYUA 2XP1A 1BG1A 1UUSA 3PFVA 1B47A 4A4CA 3HHMB 4ROJA 3EAZA 1QCFA 2CI8A 5DF6A 2ECDA 2B3OA 2OQ1A 3MAZA 1MILA 4L1BB 2LQNA 4XZ0A 5EG3B 1OPKA 1O46A 5EHPA 5J3XA 5AXIA 1BMBA 4K2RA 4U1PA 5GJIA 4K11A 1JU5A 2IUGA 1QADA 4GPLB 4U17A 1IJRA 1HCTB 1SPSA 1CSZA 2RSYA 3T04A 4JGHA 3EACA 3UF4A 2LNXA 3ZNIA 3BUMB 1I3ZA 1A07A 3PSJA 1LCJA 4TZIA 1K9AA 1AOUF 4LUDA 2EOBA 3C7IA 1BHHB 2DVJA 4NWFA 3VS5A 3BUOB 2EYZA 3PSKA 3US4A 2AUGA 3OVEA 5I6VA 1O4NA 1D1ZA 1YVHA 2RMXA 1D4TA 5EELA 2GSBA 1GRIA 1AD5A 1LUMA 1M27A 1AYBA 2SHPA 1AYDA 2DLYA 4OHLA 3VS3A 1FMKA 3PLFB 3S8NA 1O49A 1O4JA 2Y1MA 1CWDL 1NZLA 2C9WA 1O4KA 1A08A 1AYAA 2HUWA 1KA6A 3VS1A 4X6SA 2CRHA 5IBSA 1O4FA 2DM0A 2Y1NA 1SHBA 3GQIB 1A81A 1WQUA 1O48A 3VRZA 3IN7A 2GE9A 1Z3KA 3VRYA 2PLDA 2BBUA 2EO3A 1O4GA 5HKZA 1UURA 1TZEE 1PICA 1A1CA 2Y3AB 2RORA 3VS0A 5D0JA 1D4WA 1O4DA 2CIAA 1KA7A 1R1SA 4OHDA 3OB1B 1MW4A 3OP0A 1O44A 2SRCA 5DC0B 4OHEA 2H5KA 5GJHA 1FU5A 3PS5A 1KSWA 2PNAA 1LCKA 3VS6A 1XA6A 2AOBA 1JYQA 2RVFA 2FCIA 4H1OA 3N84A 1H9OA 3CBLA 3IMDA 2K79B 2H46E 2HDXA 1O42A 4F5AA 1Y1UA 1BHHA 2MC1A 3S8LA 3GXXA 4P9ZA 3VGOA 1LUNA 4M4ZA 2K7AB 1O4QA 4K45A 3VS2A 2LNWA 4GWFA 1JYRA 1LUKA 1O45A 3HCKA 1FYRA 3QWYA 1SPRA 2DLZA 2IUIA 1O4EA 2ABLA 1BF5A 1A09A 1X6CA 2CBLA 2L4KA 2MQIA 4LUEA 2C0OA 2HDVA 2MK2A 4JEGA 4FL2A 2C0IA 4F5BA 2HMHA 3PQZA 4H34A
chains in the Genus database with same CATH superfamily
1A1BA 1JWOA 3K2MA 3S8OA 4NWGA 3K2TA 4OHHA 1F2FA 2CI9A 2AOAA 1O47A 5KAZA 3N8MA 2PTKA 1O4PA 2PNBA 3GXWA 4GL9E 4K44A 3OB2B 2KK6A 1AOTF 1OO3A 1F1WA 5HKYA 5CDWA 4DGXA 1BFIA 2QMSA 5DC9A 4QSYA 1FBVA 2YU7A 1RQQC 1R1PA 4WWQA 3VRQA 1BKMA 1FHSA 3OV1A 1O4AA 2JYQA 3NHNA 3IN8A 1BFJA 1NRVA 2EYVA 4E68A 2EYYA 1LKKA 3S9KA 1O4BA 2DX0A 1QG1E 3BKBA 1ZFPE 5AULA 3TKZA 2CR4A 1G83A 1IS0A 3VRNA 1FBZA 1FU6A 5IBMA 1YVLA 3QWXX 5HKWA 1BLJA 2L3TA 1O4IA 2IZVA 1AYCA 3CD3A 2FO0A 1O4HA 1LKLA 1X27A 5DC4A 3M7FA 3VS7A 3CXLA 1X0NA 1NZVA 1Y57A 2HCKA 4EIHA 3BUNB 1OPLA 2H8HA 1BM2A 2PLEA 4D8KA 1M61A 1CWEA 3TL0A 2EKXA 1LUIA 3IMJA 1BKLA 1RJAA 1O43A 1GHUA 1SKJA 2MRKA 1O4LA 4P9VA 4F59A 3CWGA 2ETZA 3PJPA 4XZ1A 4E93A 5EHRA 3KFJA 3WA4A 1O4RA 2EL8A 3VRPA 4EY0A 1SHAA 1SHDA 1BHFA 4FL3A 1O4OA 2C0TA 2DCRA 1P13A 1A1AA 2YSXA 1OO4A 3VROA 2IUHA 2MRJA 4JE4A 3MXYA 1O41A 1A1EA 2KNOA 3VS4A 3BUWB 3BUXB 1O4CA 3UYOA 2VIFA 4OHIA 5EEQA 1R1QA 4FBNA 2EU0A 1O4MA 3MXCA 2L6KA 1AB2A 1HCSB 5BO4A 3N7YA 3VRRA 4DGPA 1BLKA 1CJ1A 2EO6A 2LQWA 1RPYA 4A4BA 1CSYA 2OZOA 3HIZB 2CS0A 1TCEA 2LCTA 1KC2A 1JYUA 2XP1A 1BG1A 1UUSA 3PFVA 1B47A 4A4CA 3HHMB 4ROJA 3EAZA 1QCFA 2CI8A 5DF6A 2ECDA 2B3OA 2OQ1A 3MAZA 1MILA 4L1BB 2LQNA 4XZ0A 5EG3B 1OPKA 1O46A 5EHPA 5J3XA 5AXIA 1BMBA 4K2RA 4U1PA 5GJIA 4K11A 1JU5A 2IUGA 1QADA 4GPLB 4U17A 1IJRA 1HCTB 1SPSA 1CSZA 2KGYA 2RSYA 3T04A 4JGHA 3EACA 3UF4A 2LNXA 3ZNIA 3BUMB 1I3ZA 1A07A 3PSJA 1LCJA 4TZIA 1K9AA 1AOUF 4LUDA 2EOBA 3C7IA 1BHHB 2DVJA 4NWFA 3VS5A 3BUOB 2EYZA 3PSKA 3US4A 2AUGA 3OVEA 5I6VA 1O4NA 1D1ZA 1YVHA 2RMXA 1D4TA 5EELA 2GSBA 1GRIA 1AD5A 1LUMA 1M27A 1AYBA 2SHPA 1AYDA 2DLYA 4OHLA 3VS3A 1FMKA 3PLFB 3S8NA 1O49A 1O4JA 2Y1MA 1CWDL 1NZLA 2C9WA 1O4KA 1A08A 1AYAA 3LYVA 2HUWA 1KA6A 3VS1A 4X6SA 2CRHA 5IBSA 1O4FA 2DM0A 2Y1NA 1SHBA 3GQIB 1A81A 1WQUA 1O48A 3VRZA 3IN7A 2GE9A 1Z3KA 3VRYA 2PLDA 2BBUA 2EO3A 1O4GA 5HKZA 1UURA 1TZEE 1PICA 1A1CA 2Y3AB 2RORA 3VS0A 5D0JA 1D4WA 1O4DA 2CIAA 1KA7A 1R1SA 4OHDA 3OB1B 1MW4A 3OP0A 1O44A 2SRCA 5DC0B 4OHEA 2H5KA 5GJHA 1FU5A 3PS5A 1KSWA 2PNAA 1LCKA 3VS6A 1XA6A 2AOBA 1JYQA 2RVFA 2FCIA 4H1OA 3N84A 1H9OA 3CBLA 3IMDA 2K79B 2H46E 2HDXA 1O42A 4F5AA 1Y1UA 1BHHA 2MC1A 3S8LA 3GXXA 4P9ZA 3VGOA 1LUNA 4M4ZA 2K7AB 2LRAA 1O4QA 4K45A 3VS2A 2LNWA 4GWFA 1JYRA 1LUKA 1O45A 3HCKA 1FYRA 3QWYA 1SPRA 2DLZA 2IUIA 1O4EA 2ABLA 1BF5A 1A09A 1X6CA 2CBLA 2L4KA 2MQIA 4LUEA 2C0OA 2HDVA 2MK2A 4JEGA 4FL2A 2C0IA 4F5BA 2HMHA 3PQZA 4H34A
chains in the Genus database with same CATH topology
1A1BA 1JWOA 3K2MA 3S8OA 4NWGA 4OHHA 1F2FA 2CI9A 2AOAA 1O47A 5KAZA 3N8MA 2PTKA 1O4PA 2PNBA 3GXWA 4GL9E 4K44A 3OB2B 2KK6A 1AOTF 1OO3A 1F1WA 5HKYA 5CDWA 4DGXA 1BFIA 2QMSA 5DC9A 4QSYA 1FBVA 2YU7A 1RQQC 1R1PA 4WWQA 3VRQA 1BKMA 1FHSA 3OV1A 1O4AA 2JYQA 3NHNA 3IN8A 1BFJA 1NRVA 2EYVA 4E68A 2EYYA 1LKKA 3S9KA 1O4BA 2DX0A 1QG1E 3BKBA 1ZFPE 5AULA 3TKZA 2CR4A 1G83A 1IS0A 3VRNA 1FBZA 1FU6A 5IBMA 1YVLA 3QWXX 5HKWA 1BLJA 2L3TA 1O4IA 2IZVA 1AYCA 3CD3A 2FO0A 1O4HA 1LKLA 1X27A 5DC4A 3M7FA 3VS7A 3CXLA 1X0NA 1NZVA 1Y57A 2HCKA 4EIHA 3BUNB 1OPLA 2H8HA 1BM2A 2PLEA 4D8KA 1M61A 1CWEA 3TL0A 2EKXA 1LUIA 3IMJA 1BKLA 1RJAA 1O43A 1GHUA 1SKJA 2MRKA 1O4LA 4P9VA 4F59A 3CWGA 2ETZA 3PJPA 4XZ1A 4E93A 5EHRA 3KFJA 3WA4A 1O4RA 2EL8A 3VRPA 4EY0A 1SHAA 1SHDA 1BHFA 4FL3A 1O4OA 2C0TA 2DCRA 1P13A 1A1AA 2YSXA 1OO4A 3VROA 2IUHA 2MRJA 4JE4A 3MXYA 1O41A 1A1EA 2KNOA 3VS4A 3BUWB 3BUXB 1O4CA 3UYOA 2VIFA 4OHIA 5EEQA 1R1QA 4FBNA 2EU0A 1O4MA 3MXCA 2L6KA 1AB2A 1HCSB 5BO4A 3N7YA 3VRRA 4DGPA 1BLKA 1CJ1A 2EO6A 2LQWA 1RPYA 4A4BA 1CSYA 2OZOA 3HIZB 2CS0A 1TCEA 2LCTA 1KC2A 1JYUA 2XP1A 1BG1A 1UUSA 3PFVA 1B47A 4A4CA 3HHMB 4ROJA 3EAZA 1QCFA 2CI8A 5DF6A 2ECDA 2B3OA 2OQ1A 3MAZA 1MILA 4L1BB 2LQNA 4XZ0A 5EG3B 1OPKA 1O46A 5EHPA 5J3XA 5AXIA 1BMBA 4K2RA 4U1PA 5GJIA 4K11A 1JU5A 2IUGA 1QADA 4GPLB 4U17A 1IJRA 1HCTB 1SPSA 1CSZA 2RSYA 3T04A 4JGHA 3EACA 3UF4A 2LNXA 3ZNIA 3BUMB 1I3ZA 1A07A 3PSJA 1LCJA 4TZIA 1K9AA 1AOUF 4LUDA 2EOBA 3C7IA 1BHHB 2DVJA 4NWFA 3VS5A 3BUOB 2EYZA 3PSKA 3US4A 2AUGA 3OVEA 5I6VA 1O4NA 1D1ZA 1YVHA 2RMXA 1D4TA 5EELA 2GSBA 1GRIA 1AD5A 1LUMA 1M27A 1AYBA 2SHPA 1AYDA 2DLYA 4OHLA 3VS3A 1FMKA 3PLFB 3S8NA 1O49A 1O4JA 2Y1MA 1CWDL 1NZLA 2C9WA 1O4KA 1A08A 1AYAA 2HUWA 1KA6A 3VS1A 4X6SA 2CRHA 5IBSA 1O4FA 2DM0A 2Y1NA 1SHBA 3GQIB 1A81A 1WQUA 1O48A 3VRZA 3IN7A 2GE9A 1Z3KA 3VRYA 2PLDA 2BBUA 2EO3A 1O4GA 5HKZA 1UURA 1TZEE 1PICA 1A1CA 2Y3AB 2RORA 3VS0A 5D0JA 1D4WA 1O4DA 2CIAA 1KA7A 1R1SA 4OHDA 3OB1B 1MW4A 3OP0A 1O44A 2SRCA 5DC0B 4OHEA 2H5KA 5GJHA 1FU5A 3PS5A 1KSWA 2PNAA 1LCKA 3VS6A 1XA6A 2AOBA 1JYQA 2RVFA 2FCIA 4H1OA 3N84A 1H9OA 3CBLA 3IMDA 2K79B 2H46E 2HDXA 1O42A 4F5AA 1Y1UA 1BHHA 2MC1A 3S8LA 3GXXA 4P9ZA 3VGOA 1LUNA 4M4ZA 2K7AB 1O4QA 4K45A 3VS2A 2LNWA 4GWFA 1JYRA 1LUKA 1O45A 3HCKA 1FYRA 3QWYA 1SPRA 2DLZA 2IUIA 1O4EA 2ABLA 1BF5A 1A09A 1X6CA 2CBLA 2L4KA 2MQIA 4LUEA 2C0OA 2HDVA 2MK2A 4JEGA 4FL2A 2C0IA 4F5BA 2HMHA 3PQZA 4H34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1B A;  1JWO A;  3K2M A;  3S8O A;  4NWG A;  4OHH A;  1F2F A;  2CI9 A;  2AOA A;  1O47 A;  5KAZ A;  3N8M A;  2PTK A;  1O4P A;  2PNB A;  3GXW A;  4GL9 E;  4K44 A;  3OB2 B;  2KK6 A;  1AOT F;  1OO3 A;  1F1W A;  5HKY A;  5CDW A;  4DGX A;  1BFI A;  2QMS A;  5DC9 A;  4QSY A;  1FBV A;  2YU7 A;  1RQQ C;  1R1P A;  4WWQ A;  3VRQ A;  1BKM A;  1FHS A;  3OV1 A;  1O4A A;  2JYQ A;  3NHN A;  3IN8 A;  1BFJ A;  1NRV A;  2EYV A;  4E68 A;  2EYY A;  1LKK A;  3S9K A;  1O4B A;  2DX0 A;  1QG1 E;  3BKB A;  1ZFP E;  5AUL A;  3TKZ A;  2CR4 A;  1G83 A;  1IS0 A;  3VRN A;  1FBZ A;  1FU6 A;  5IBM A;  1YVL A;  3QWX X;  5HKW A;  1BLJ A;  2L3T A;  1O4I A;  2IZV A;  1AYC A;  3CD3 A;  2FO0 A;  1O4H A;  1LKL A;  1X27 A;  5DC4 A;  3M7F A;  3VS7 A;  3CXL A;  1X0N A;  1NZV A;  1Y57 A;  2HCK A;  4EIH A;  3BUN B;  1OPL A;  2H8H A;  1BM2 A;  2PLE A;  4D8K A;  1M61 A;  1CWE A;  3TL0 A;  2EKX A;  1LUI A;  3IMJ A;  1BKL A;  1RJA A;  1O43 A;  1GHU A;  1SKJ A;  2MRK A;  1O4L A;  4P9V A;  4F59 A;  3CWG A;  2ETZ A;  3PJP A;  4XZ1 A;  4E93 A;  5EHR A;  3KFJ A;  3WA4 A;  1O4R A;  2EL8 A;  3VRP A;  4EY0 A;  1SHA A;  1SHD A;  1BHF A;  4FL3 A;  1O4O A;  2C0T A;  2DCR A;  1P13 A;  1A1A A;  2YSX A;  1OO4 A;  3VRO A;  2IUH A;  2MRJ A;  4JE4 A;  3MXY A;  1O41 A;  1A1E A;  2KNO A;  3VS4 A;  3BUW B;  3BUX B;  1O4C A;  3UYO A;  2VIF A;  4OHI A;  5EEQ A;  1R1Q A;  4FBN A;  2EU0 A;  1O4M A;  3MXC A;  2L6K A;  1AB2 A;  1HCS B;  5BO4 A;  3N7Y A;  3VRR A;  4DGP A;  1BLK A;  1CJ1 A;  2EO6 A;  2LQW A;  1RPY A;  4A4B A;  1CSY A;  2OZO A;  3HIZ B;  2CS0 A;  1TCE A;  2LCT A;  1KC2 A;  1JYU A;  2XP1 A;  1BG1 A;  1UUS A;  3PFV A;  1B47 A;  4A4C A;  3HHM B;  4ROJ A;  3EAZ A;  1QCF A;  2CI8 A;  5DF6 A;  2ECD A;  2B3O A;  2OQ1 A;  3MAZ A;  1MIL A;  4L1B B;  2LQN A;  4XZ0 A;  5EG3 B;  1OPK A;  1O46 A;  5EHP A;  5J3X A;  5AXI A;  1BMB A;  4K2R A;  4U1P A;  5GJI A;  4K11 A;  1JU5 A;  2IUG A;  1QAD A;  4GPL B;  4U17 A;  1IJR A;  1HCT B;  1SPS A;  1CSZ A;  2RSY A;  3T04 A;  4JGH A;  3EAC A;  3UF4 A;  2LNX A;  3ZNI A;  3BUM B;  1I3Z A;  1A07 A;  3PSJ A;  1LCJ A;  4TZI A;  1K9A A;  1AOU F;  4LUD A;  2EOB A;  3C7I A;  1BHH B;  2DVJ A;  4NWF A;  3VS5 A;  3BUO B;  2EYZ A;  3PSK A;  3US4 A;  2AUG A;  3OVE A;  5I6V A;  1O4N A;  1D1Z A;  1YVH A;  2RMX A;  1D4T A;  5EEL A;  2GSB A;  1GRI A;  1AD5 A;  1LUM A;  1M27 A;  1AYB A;  2SHP A;  1AYD A;  2DLY A;  4OHL A;  3VS3 A;  1FMK A;  3PLF B;  3S8N A;  1O49 A;  1O4J A;  2Y1M A;  1CWD L;  1NZL A;  2C9W A;  1O4K A;  1A08 A;  1AYA A;  2HUW A;  1KA6 A;  3VS1 A;  4X6S A;  2CRH A;  5IBS A;  1O4F A;  2DM0 A;  2Y1N A;  1SHB A;  3GQI B;  1A81 A;  1WQU A;  1O48 A;  3VRZ A;  3IN7 A;  2GE9 A;  1Z3K A;  3VRY A;  2PLD A;  2BBU A;  2EO3 A;  1O4G A;  5HKZ A;  1UUR A;  1TZE E;  1PIC A;  1A1C A;  2Y3A B;  2ROR A;  3VS0 A;  5D0J A;  1D4W A;  1O4D A;  2CIA A;  1KA7 A;  1R1S A;  4OHD A;  3OB1 B;  1MW4 A;  3OP0 A;  1O44 A;  2SRC A;  5DC0 B;  4OHE A;  2H5K A;  5GJH A;  1FU5 A;  3PS5 A;  1KSW A;  2PNA A;  1LCK A;  3VS6 A;  1XA6 A;  2AOB A;  1JYQ A;  2RVF A;  2FCI A;  4H1O A;  3N84 A;  1H9O A;  3CBL A;  3IMD A;  2K79 B;  2H46 E;  2HDX A;  1O42 A;  4F5A A;  1Y1U A;  1BHH A;  2MC1 A;  3S8L A;  3GXX A;  4P9Z A;  3VGO A;  1LUN A;  4M4Z A;  2K7A B;  1O4Q A;  4K45 A;  3VS2 A;  2LNW A;  4GWF A;  1JYR A;  1LUK A;  1O45 A;  3HCK A;  1FYR A;  3QWY A;  1SPR A;  2DLZ A;  2IUI A;  1O4E A;  2ABL A;  1BF5 A;  1A09 A;  1X6C A;  2CBL A;  2L4K A;  2MQI A;  4LUE A;  2C0O A;  2HDV A;  2MK2 A;  4JEG A;  4FL2 A;  2C0I A;  4F5B A;  2HMH A;  3PQZ A;  4H34 A; 
#chains in the Genus database with same CATH topology
 1A1B A;  1JWO A;  3K2M A;  3S8O A;  4NWG A;  3K2T A;  4OHH A;  1F2F A;  2CI9 A;  2AOA A;  1O47 A;  5KAZ A;  3N8M A;  2PTK A;  1O4P A;  2PNB A;  3GXW A;  4GL9 E;  4K44 A;  3OB2 B;  2KK6 A;  1AOT F;  1OO3 A;  1F1W A;  5HKY A;  5CDW A;  4DGX A;  1BFI A;  2QMS A;  5DC9 A;  4QSY A;  1FBV A;  2YU7 A;  1RQQ C;  1R1P A;  4WWQ A;  3VRQ A;  1BKM A;  1FHS A;  3OV1 A;  1O4A A;  2JYQ A;  3NHN A;  3IN8 A;  1BFJ A;  1NRV A;  2EYV A;  4E68 A;  2EYY A;  1LKK A;  3S9K A;  1O4B A;  2DX0 A;  1QG1 E;  3BKB A;  1ZFP E;  5AUL A;  3TKZ A;  2CR4 A;  1G83 A;  1IS0 A;  3VRN A;  1FBZ A;  1FU6 A;  5IBM A;  1YVL A;  3QWX X;  5HKW A;  1BLJ A;  2L3T A;  1O4I A;  2IZV A;  1AYC A;  3CD3 A;  2FO0 A;  1O4H A;  1LKL A;  1X27 A;  5DC4 A;  3M7F A;  3VS7 A;  3CXL A;  1X0N A;  1NZV A;  1Y57 A;  2HCK A;  4EIH A;  3BUN B;  1OPL A;  2H8H A;  1BM2 A;  2PLE A;  4D8K A;  1M61 A;  1CWE A;  3TL0 A;  2EKX A;  1LUI A;  3IMJ A;  1BKL A;  1RJA A;  1O43 A;  1GHU A;  1SKJ A;  2MRK A;  1O4L A;  4P9V A;  4F59 A;  3CWG A;  2ETZ A;  3PJP A;  4XZ1 A;  4E93 A;  5EHR A;  3KFJ A;  3WA4 A;  1O4R A;  2EL8 A;  3VRP A;  4EY0 A;  1SHA A;  1SHD A;  1BHF A;  4FL3 A;  1O4O A;  2C0T A;  2DCR A;  1P13 A;  1A1A A;  2YSX A;  1OO4 A;  3VRO A;  2IUH A;  2MRJ A;  4JE4 A;  3MXY A;  1O41 A;  1A1E A;  2KNO A;  3VS4 A;  3BUW B;  3BUX B;  1O4C A;  3UYO A;  2VIF A;  4OHI A;  5EEQ A;  1R1Q A;  4FBN A;  2EU0 A;  1O4M A;  3MXC A;  2L6K A;  1AB2 A;  1HCS B;  5BO4 A;  3N7Y A;  3VRR A;  4DGP A;  1BLK A;  1CJ1 A;  2EO6 A;  2LQW A;  1RPY A;  4A4B A;  1CSY A;  2OZO A;  3HIZ B;  2CS0 A;  1TCE A;  2LCT A;  1KC2 A;  1JYU A;  2XP1 A;  1BG1 A;  1UUS A;  3PFV A;  1B47 A;  4A4C A;  3HHM B;  4ROJ A;  3EAZ A;  1QCF A;  2CI8 A;  5DF6 A;  2ECD A;  2B3O A;  2OQ1 A;  3MAZ A;  1MIL A;  4L1B B;  2LQN A;  4XZ0 A;  5EG3 B;  1OPK A;  1O46 A;  5EHP A;  5J3X A;  5AXI A;  1BMB A;  4K2R A;  4U1P A;  5GJI A;  4K11 A;  1JU5 A;  2IUG A;  1QAD A;  4GPL B;  4U17 A;  1IJR A;  1HCT B;  1SPS A;  1CSZ A;  2KGY A;  2RSY A;  3T04 A;  4JGH A;  3EAC A;  3UF4 A;  2LNX A;  3ZNI A;  3BUM B;  1I3Z A;  1A07 A;  3PSJ A;  1LCJ A;  4TZI A;  1K9A A;  1AOU F;  4LUD A;  2EOB A;  3C7I A;  1BHH B;  2DVJ A;  4NWF A;  3VS5 A;  3BUO B;  2EYZ A;  3PSK A;  3US4 A;  2AUG A;  3OVE A;  5I6V A;  1O4N A;  1D1Z A;  1YVH A;  2RMX A;  1D4T A;  5EEL A;  2GSB A;  1GRI A;  1AD5 A;  1LUM A;  1M27 A;  1AYB A;  2SHP A;  1AYD A;  2DLY A;  4OHL A;  3VS3 A;  1FMK A;  3PLF B;  3S8N A;  1O49 A;  1O4J A;  2Y1M A;  1CWD L;  1NZL A;  2C9W A;  1O4K A;  1A08 A;  1AYA A;  3LYV A;  2HUW A;  1KA6 A;  3VS1 A;  4X6S A;  2CRH A;  5IBS A;  1O4F A;  2DM0 A;  2Y1N A;  1SHB A;  3GQI B;  1A81 A;  1WQU A;  1O48 A;  3VRZ A;  3IN7 A;  2GE9 A;  1Z3K A;  3VRY A;  2PLD A;  2BBU A;  2EO3 A;  1O4G A;  5HKZ A;  1UUR A;  1TZE E;  1PIC A;  1A1C A;  2Y3A B;  2ROR A;  3VS0 A;  5D0J A;  1D4W A;  1O4D A;  2CIA A;  1KA7 A;  1R1S A;  4OHD A;  3OB1 B;  1MW4 A;  3OP0 A;  1O44 A;  2SRC A;  5DC0 B;  4OHE A;  2H5K A;  5GJH A;  1FU5 A;  3PS5 A;  1KSW A;  2PNA A;  1LCK A;  3VS6 A;  1XA6 A;  2AOB A;  1JYQ A;  2RVF A;  2FCI A;  4H1O A;  3N84 A;  1H9O A;  3CBL A;  3IMD A;  2K79 B;  2H46 E;  2HDX A;  1O42 A;  4F5A A;  1Y1U A;  1BHH A;  2MC1 A;  3S8L A;  3GXX A;  4P9Z A;  3VGO A;  1LUN A;  4M4Z A;  2K7A B;  2LRA A;  1O4Q A;  4K45 A;  3VS2 A;  2LNW A;  4GWF A;  1JYR A;  1LUK A;  1O45 A;  3HCK A;  1FYR A;  3QWY A;  1SPR A;  2DLZ A;  2IUI A;  1O4E A;  2ABL A;  1BF5 A;  1A09 A;  1X6C A;  2CBL A;  2L4K A;  2MQI A;  4LUE A;  2C0O A;  2HDV A;  2MK2 A;  4JEG A;  4FL2 A;  2C0I A;  4F5B A;  2HMH A;  3PQZ A;  4H34 A; 
#chains in the Genus database with same CATH homology
 1A1B A;  1JWO A;  3K2M A;  3S8O A;  4NWG A;  4OHH A;  1F2F A;  2CI9 A;  2AOA A;  1O47 A;  5KAZ A;  3N8M A;  2PTK A;  1O4P A;  2PNB A;  3GXW A;  4GL9 E;  4K44 A;  3OB2 B;  2KK6 A;  1AOT F;  1OO3 A;  1F1W A;  5HKY A;  5CDW A;  4DGX A;  1BFI A;  2QMS A;  5DC9 A;  4QSY A;  1FBV A;  2YU7 A;  1RQQ C;  1R1P A;  4WWQ A;  3VRQ A;  1BKM A;  1FHS A;  3OV1 A;  1O4A A;  2JYQ A;  3NHN A;  3IN8 A;  1BFJ A;  1NRV A;  2EYV A;  4E68 A;  2EYY A;  1LKK A;  3S9K A;  1O4B A;  2DX0 A;  1QG1 E;  3BKB A;  1ZFP E;  5AUL A;  3TKZ A;  2CR4 A;  1G83 A;  1IS0 A;  3VRN A;  1FBZ A;  1FU6 A;  5IBM A;  1YVL A;  3QWX X;  5HKW A;  1BLJ A;  2L3T A;  1O4I A;  2IZV A;  1AYC A;  3CD3 A;  2FO0 A;  1O4H A;  1LKL A;  1X27 A;  5DC4 A;  3M7F A;  3VS7 A;  3CXL A;  1X0N A;  1NZV A;  1Y57 A;  2HCK A;  4EIH A;  3BUN B;  1OPL A;  2H8H A;  1BM2 A;  2PLE A;  4D8K A;  1M61 A;  1CWE A;  3TL0 A;  2EKX A;  1LUI A;  3IMJ A;  1BKL A;  1RJA A;  1O43 A;  1GHU A;  1SKJ A;  2MRK A;  1O4L A;  4P9V A;  4F59 A;  3CWG A;  2ETZ A;  3PJP A;  4XZ1 A;  4E93 A;  5EHR A;  3KFJ A;  3WA4 A;  1O4R A;  2EL8 A;  3VRP A;  4EY0 A;  1SHA A;  1SHD A;  1BHF A;  4FL3 A;  1O4O A;  2C0T A;  2DCR A;  1P13 A;  1A1A A;  2YSX A;  1OO4 A;  3VRO A;  2IUH A;  2MRJ A;  4JE4 A;  3MXY A;  1O41 A;  1A1E A;  2KNO A;  3VS4 A;  3BUW B;  3BUX B;  1O4C A;  3UYO A;  2VIF A;  4OHI A;  5EEQ A;  1R1Q A;  4FBN A;  2EU0 A;  1O4M A;  3MXC A;  2L6K A;  1AB2 A;  1HCS B;  5BO4 A;  3N7Y A;  3VRR A;  4DGP A;  1BLK A;  1CJ1 A;  2EO6 A;  2LQW A;  1RPY A;  4A4B A;  1CSY A;  2OZO A;  3HIZ B;  2CS0 A;  1TCE A;  2LCT A;  1KC2 A;  1JYU A;  2XP1 A;  1BG1 A;  1UUS A;  3PFV A;  1B47 A;  4A4C A;  3HHM B;  4ROJ A;  3EAZ A;  1QCF A;  2CI8 A;  5DF6 A;  2ECD A;  2B3O A;  2OQ1 A;  3MAZ A;  1MIL A;  4L1B B;  2LQN A;  4XZ0 A;  5EG3 B;  1OPK A;  1O46 A;  5EHP A;  5J3X A;  5AXI A;  1BMB A;  4K2R A;  4U1P A;  5GJI A;  4K11 A;  1JU5 A;  2IUG A;  1QAD A;  4GPL B;  4U17 A;  1IJR A;  1HCT B;  1SPS A;  1CSZ A;  2RSY A;  3T04 A;  4JGH A;  3EAC A;  3UF4 A;  2LNX A;  3ZNI A;  3BUM B;  1I3Z A;  1A07 A;  3PSJ A;  1LCJ A;  4TZI A;  1K9A A;  1AOU F;  4LUD A;  2EOB A;  3C7I A;  1BHH B;  2DVJ A;  4NWF A;  3VS5 A;  3BUO B;  2EYZ A;  3PSK A;  3US4 A;  2AUG A;  3OVE A;  5I6V A;  1O4N A;  1D1Z A;  1YVH A;  2RMX A;  1D4T A;  5EEL A;  2GSB A;  1GRI A;  1AD5 A;  1LUM A;  1M27 A;  1AYB A;  2SHP A;  1AYD A;  2DLY A;  4OHL A;  3VS3 A;  1FMK A;  3PLF B;  3S8N A;  1O49 A;  1O4J A;  2Y1M A;  1CWD L;  1NZL A;  2C9W A;  1O4K A;  1A08 A;  1AYA A;  2HUW A;  1KA6 A;  3VS1 A;  4X6S A;  2CRH A;  5IBS A;  1O4F A;  2DM0 A;  2Y1N A;  1SHB A;  3GQI B;  1A81 A;  1WQU A;  1O48 A;  3VRZ A;  3IN7 A;  2GE9 A;  1Z3K A;  3VRY A;  2PLD A;  2BBU A;  2EO3 A;  1O4G A;  5HKZ A;  1UUR A;  1TZE E;  1PIC A;  1A1C A;  2Y3A B;  2ROR A;  3VS0 A;  5D0J A;  1D4W A;  1O4D A;  2CIA A;  1KA7 A;  1R1S A;  4OHD A;  3OB1 B;  1MW4 A;  3OP0 A;  1O44 A;  2SRC A;  5DC0 B;  4OHE A;  2H5K A;  5GJH A;  1FU5 A;  3PS5 A;  1KSW A;  2PNA A;  1LCK A;  3VS6 A;  1XA6 A;  2AOB A;  1JYQ A;  2RVF A;  2FCI A;  4H1O A;  3N84 A;  1H9O A;  3CBL A;  3IMD A;  2K79 B;  2H46 E;  2HDX A;  1O42 A;  4F5A A;  1Y1U A;  1BHH A;  2MC1 A;  3S8L A;  3GXX A;  4P9Z A;  3VGO A;  1LUN A;  4M4Z A;  2K7A B;  1O4Q A;  4K45 A;  3VS2 A;  2LNW A;  4GWF A;  1JYR A;  1LUK A;  1O45 A;  3HCK A;  1FYR A;  3QWY A;  1SPR A;  2DLZ A;  2IUI A;  1O4E A;  2ABL A;  1BF5 A;  1A09 A;  1X6C A;  2CBL A;  2L4K A;  2MQI A;  4LUE A;  2C0O A;  2HDV A;  2MK2 A;  4JEG A;  4FL2 A;  2C0I A;  4F5B A;  2HMH A;  3PQZ A;  4H34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...