1HCTB

Nmr structure of the human src sh2 domain complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
107
structure length
107
Chain Sequence
MDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ACETYL-PYEEIE-OH
publication title Solution structure of the human pp60c-src SH2 domain complexed with a phosphorylated tyrosine pentapeptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (signal transduction/peptide)
total genus 14
structure length 107
sequence length 107
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1hctB00
2PNAA 1IJRA 3VGOA 4A4CA 4OHLA 4U1PA 1O42A 2IUIA 2VIFA 1A07A 3PS5A 5GJHA 2DCRA 2L3TA 4OHHA 1AD5A 1A1CA 5HKZA 1QG1E 3PSKA 1K9AA 2EL8A 1O4IA 2K79B 3OV1A 1O4RA 3VS3A 2KK6A 4ROJA 4P9ZA 4F5BA 1LUKA 1X27A 1CWDL 4JE4A 3VS1A 2EKXA 1A1BA 5KAZA 2JYQA 3OVEA 1D1ZA 1NZLA 4GL9E 1OPKA 1RJAA 4QSYA 2LNXA 1LCJA 1CSYA 1R1QA 1O4JA 1R1PA 1BHHA 3TKZA 1HCTB 2PLEA 4EY0A 1D4WA 1JYUA 2AUGA 3HHMB 1F1WA 2RVFA 2MC1A 1O4NA 1D4TA 2AOAA 1QCFA 4K44A 1TCEA 1OO4A 2FO0A 4K2RA 2ECDA 3S8LA 1YVHA 2YU7A 1JWOA 5HKWA 1AOUF 2CBLA 1GRIA 3VRYA 3ZNIA 1RPYA 3EACA 1SKJA 4A4BA 2SHPA 1X6CA 2H5KA 5GJIA 2CIAA 3MXYA 3MXCA 3MAZA 5AULA 4OHIA 3N84A 1BHFA 1O47A 1O4QA 3VROA 1MILA 1O49A 2IUHA 1O4DA 3PLFB 1AYDA 5EHPA 4OHDA 3QWYA 3IMJA 1O43A 2EO3A 1O4HA 1OPLA 1FHSA 1SHAA 1SPRA 1KSWA 1Y57A 3CBLA 1BFJA 1IS0A 3BKBA 3VRRA 1A81A 2RSYA 1BG1A 1JYRA 4NWFA 3CWGA 3BUXB 1LUNA 1PICA 4X6SA 1AYBA 2LQWA 2GSBA 1LKKA 2CS0A 2L6KA 3BUMB 1KA6A 2GE9A 3UF4A 4DGXA 1CJ1A 5EG3B 2RMXA 1BFIA 5EELA 3VRQA 4TZIA 2PLDA 5EHRA 1F2FA 1MW4A 2HCKA 2ABLA 3KFJA 1AYCA 5I6VA 5DC4A 3HIZB 5DC9A 1O4AA 5BO4A 3PFVA 1A09A 1BKMA 3PQZA 1WQUA 1O4PA 4FBNA 3OB1B 1CWEA 3PJPA 2DM0A 2SRCA 4H1OA 1FMKA 3VS5A 4P9VA 3OP0A 1A08A 4FL3A 2BBUA 3EAZA 5EEQA 3UYOA 2Y3AB 1BMBA 3VRZA 1KA7A 1GHUA 1O4BA 2XP1A 1BLJA 4FL2A 5CDWA 3CXLA 1XA6A 2IUGA 1H9OA 2QMSA 1SPSA 1G83A 3GQIB 2CR4A 1CSZA 2PNBA 2C9WA 1Z3KA 1ZFPE 4K45A 1LCKA 3OB2B 4WWQA 1UUSA 2EOBA 2HUWA 1JU5A 4M4ZA 1FBZA 3VRPA 5DF6A 1QADA 3VS7A 3T04A 3GXXA 3VS6A 2AOBA 1O48A 4XZ0A 5IBSA 3C7IA 1OO3A 2OQ1A 1AYAA 2DVJA 3IMDA 5IBMA 2EYZA 2MQIA 2L4KA 4JGHA 4L1BB 1FU6A 1B47A 3S9KA 1I3ZA 1A1EA 1O44A 2MRJA 4GPLB 4GWFA 3VRNA 3BUOB 4XZ1A 1SHDA 4F59A 1O4OA 2MK2A 3N7YA 4EIHA 3QWXX 3IN7A 1LUIA 2Y1NA 3VS0A 1JYQA 3CD3A 3BUWB 3VS2A 4H34A 2CI8A 2HDXA 1O4KA 1YVLA 1O4GA 2EU0A 2FCIA 3PSJA 4LUEA 1O4MA 3S8NA 1FYRA 2KNOA 1NZVA 3TL0A 1M27A 2PTKA 2CRHA 1KC2A 2ETZA 1RQQC 1FU5A 1LKLA 1BKLA 2C0TA 1O4EA 4U17A 1LUMA 2HDVA 1R1SA 5J3XA 1HCSB 1Y1UA 2Y1MA 1O45A 2B3OA 3WA4A 1A1AA 1AB2A 2DX0A 2OZOA 5D0JA 1TZEE 3S8OA 3BUNB 1O4CA 3HCKA 1O46A 2LNWA 4F5AA 4DGPA 4E68A 4K11A 2H46E 2EYYA 4OHEA 1O4FA 1M61A 1FBVA 1BHHB 3US4A 1UURA 2EYVA 5HKYA 3GXWA 3K2MA 2HMHA 2LCTA 5DC0B 2DLZA 3N8MA 4JEGA 1O41A 1P13A 4D8KA 3NHNA 1BM2A 3IN8A 1SHBA 2CI9A 1X0NA 2K7AB 2LQNA 2IZVA 2DLYA 3VS4A 2RORA 4E93A 3M7FA 4LUDA 1AOTF 2EO6A 2MRKA 1BF5A 1O4LA 2H8HA 2YSXA 1NRVA 4NWGA 2C0OA 1BLKA 5AXIA 2C0IA
chains in the Genus database with same CATH superfamily
2PNAA 1IJRA 3VGOA 4A4CA 4OHLA 4U1PA 1O42A 2IUIA 2VIFA 1A07A 3PS5A 5GJHA 2DCRA 2L3TA 2LRAA 4OHHA 1AD5A 1A1CA 5HKZA 1QG1E 3PSKA 1K9AA 2EL8A 1O4IA 2K79B 3OV1A 1O4RA 3VS3A 2KK6A 4ROJA 4P9ZA 4F5BA 1LUKA 1X27A 1CWDL 4JE4A 3VS1A 2EKXA 1A1BA 5KAZA 2JYQA 3OVEA 1D1ZA 1NZLA 4GL9E 1OPKA 1RJAA 4QSYA 2LNXA 1LCJA 1CSYA 1R1QA 1O4JA 1R1PA 1BHHA 3TKZA 1HCTB 2PLEA 4EY0A 1D4WA 1JYUA 2AUGA 3HHMB 1F1WA 2RVFA 2MC1A 1O4NA 1D4TA 2AOAA 1QCFA 4K44A 1TCEA 1OO4A 2FO0A 4K2RA 2ECDA 3S8LA 1YVHA 2YU7A 1JWOA 5HKWA 1AOUF 2CBLA 1GRIA 3VRYA 3ZNIA 1RPYA 3EACA 1SKJA 4A4BA 2SHPA 1X6CA 2H5KA 5GJIA 2CIAA 3MXYA 3MXCA 3MAZA 5AULA 4OHIA 3N84A 1BHFA 1O47A 1O4QA 3VROA 1MILA 1O49A 2IUHA 1O4DA 3PLFB 1AYDA 5EHPA 4OHDA 3QWYA 3IMJA 1O43A 2EO3A 1O4HA 1OPLA 1FHSA 1SHAA 1SPRA 1KSWA 1Y57A 3CBLA 1BFJA 1IS0A 3BKBA 3VRRA 1A81A 2RSYA 1BG1A 1JYRA 4NWFA 3CWGA 3BUXB 1LUNA 1PICA 4X6SA 1AYBA 2LQWA 2GSBA 1LKKA 2CS0A 2L6KA 3BUMB 1KA6A 2GE9A 3UF4A 4DGXA 1CJ1A 5EG3B 2RMXA 1BFIA 5EELA 3VRQA 4TZIA 2PLDA 5EHRA 1F2FA 1MW4A 2HCKA 2ABLA 3KFJA 1AYCA 5I6VA 5DC4A 3HIZB 5DC9A 1O4AA 5BO4A 3PFVA 1A09A 1BKMA 3PQZA 1WQUA 1O4PA 4FBNA 3OB1B 1CWEA 3PJPA 2DM0A 2SRCA 4H1OA 1FMKA 3VS5A 4P9VA 3OP0A 1A08A 4FL3A 2BBUA 3EAZA 5EEQA 3UYOA 2Y3AB 1BMBA 3VRZA 1KA7A 1GHUA 1O4BA 2XP1A 1BLJA 4FL2A 5CDWA 3CXLA 1XA6A 2IUGA 1H9OA 2QMSA 1SPSA 1G83A 3GQIB 2CR4A 1CSZA 2PNBA 2C9WA 1Z3KA 1ZFPE 4K45A 1LCKA 3OB2B 4WWQA 1UUSA 2EOBA 2HUWA 1JU5A 4M4ZA 1FBZA 3VRPA 5DF6A 1QADA 3VS7A 3T04A 3GXXA 3LYVA 3VS6A 2AOBA 1O48A 2KGYA 4XZ0A 5IBSA 3C7IA 1OO3A 2OQ1A 1AYAA 2DVJA 3IMDA 5IBMA 2EYZA 2MQIA 2L4KA 4JGHA 4L1BB 1FU6A 1B47A 3S9KA 1I3ZA 1A1EA 1O44A 2MRJA 4GPLB 4GWFA 3K2TA 3VRNA 3BUOB 4XZ1A 1SHDA 4F59A 1O4OA 2MK2A 3N7YA 4EIHA 3QWXX 3IN7A 1LUIA 2Y1NA 3VS0A 1JYQA 3CD3A 3BUWB 3VS2A 4H34A 2CI8A 2HDXA 1O4KA 1YVLA 1O4GA 2EU0A 2FCIA 3PSJA 4LUEA 1O4MA 3S8NA 1FYRA 2KNOA 1NZVA 3TL0A 1M27A 2PTKA 2CRHA 1KC2A 2ETZA 1RQQC 1FU5A 1LKLA 1BKLA 2C0TA 1O4EA 4U17A 1LUMA 2HDVA 1R1SA 5J3XA 1HCSB 1Y1UA 2Y1MA 1O45A 2B3OA 3WA4A 1A1AA 1AB2A 2DX0A 2OZOA 5D0JA 1TZEE 3S8OA 3BUNB 1O4CA 3HCKA 1O46A 2LNWA 4F5AA 4DGPA 4E68A 4K11A 2H46E 2EYYA 4OHEA 1O4FA 1M61A 1FBVA 1BHHB 3US4A 1UURA 2EYVA 5HKYA 3GXWA 3K2MA 2HMHA 2LCTA 5DC0B 2DLZA 3N8MA 4JEGA 1O41A 1P13A 4D8KA 3NHNA 1BM2A 3IN8A 1SHBA 2CI9A 1X0NA 2K7AB 2LQNA 2IZVA 2DLYA 3VS4A 2RORA 4E93A 3M7FA 4LUDA 1AOTF 2EO6A 2MRKA 1BF5A 1O4LA 2H8HA 2YSXA 1NRVA 4NWGA 2C0OA 1BLKA 5AXIA 2C0IA
chains in the Genus database with same CATH topology
2PNAA 1IJRA 3VGOA 4A4CA 4OHLA 4U1PA 1O42A 2IUIA 2VIFA 1A07A 3PS5A 5GJHA 2DCRA 2L3TA 4OHHA 1AD5A 1A1CA 5HKZA 1QG1E 3PSKA 1K9AA 2EL8A 1O4IA 2K79B 3OV1A 1O4RA 3VS3A 2KK6A 4ROJA 4P9ZA 4F5BA 1LUKA 1X27A 1CWDL 4JE4A 3VS1A 2EKXA 1A1BA 5KAZA 2JYQA 3OVEA 1D1ZA 1NZLA 4GL9E 1OPKA 1RJAA 4QSYA 2LNXA 1LCJA 1CSYA 1R1QA 1O4JA 1R1PA 1BHHA 3TKZA 1HCTB 2PLEA 4EY0A 1D4WA 1JYUA 2AUGA 3HHMB 1F1WA 2RVFA 2MC1A 1O4NA 1D4TA 2AOAA 1QCFA 4K44A 1TCEA 1OO4A 2FO0A 4K2RA 2ECDA 3S8LA 1YVHA 2YU7A 1JWOA 5HKWA 1AOUF 2CBLA 1GRIA 3VRYA 3ZNIA 1RPYA 3EACA 1SKJA 4A4BA 2SHPA 1X6CA 2H5KA 5GJIA 2CIAA 3MXYA 3MXCA 3MAZA 5AULA 4OHIA 3N84A 1BHFA 1O47A 1O4QA 3VROA 1MILA 1O49A 2IUHA 1O4DA 3PLFB 1AYDA 5EHPA 4OHDA 3QWYA 3IMJA 1O43A 2EO3A 1O4HA 1OPLA 1FHSA 1SHAA 1SPRA 1KSWA 1Y57A 3CBLA 1BFJA 1IS0A 3BKBA 3VRRA 1A81A 2RSYA 1BG1A 1JYRA 4NWFA 3CWGA 3BUXB 1LUNA 1PICA 4X6SA 1AYBA 2LQWA 2GSBA 1LKKA 2CS0A 2L6KA 3BUMB 1KA6A 2GE9A 3UF4A 4DGXA 1CJ1A 5EG3B 2RMXA 1BFIA 5EELA 3VRQA 4TZIA 2PLDA 5EHRA 1F2FA 1MW4A 2HCKA 2ABLA 3KFJA 1AYCA 5I6VA 5DC4A 3HIZB 5DC9A 1O4AA 5BO4A 3PFVA 1A09A 1BKMA 3PQZA 1WQUA 1O4PA 4FBNA 3OB1B 1CWEA 3PJPA 2DM0A 2SRCA 4H1OA 1FMKA 3VS5A 4P9VA 3OP0A 1A08A 4FL3A 2BBUA 3EAZA 5EEQA 3UYOA 2Y3AB 1BMBA 3VRZA 1KA7A 1GHUA 1O4BA 2XP1A 1BLJA 4FL2A 5CDWA 3CXLA 1XA6A 2IUGA 1H9OA 2QMSA 1SPSA 1G83A 3GQIB 2CR4A 1CSZA 2PNBA 2C9WA 1Z3KA 1ZFPE 4K45A 1LCKA 3OB2B 4WWQA 1UUSA 2EOBA 2HUWA 1JU5A 4M4ZA 1FBZA 3VRPA 5DF6A 1QADA 3VS7A 3T04A 3GXXA 3VS6A 2AOBA 1O48A 4XZ0A 5IBSA 3C7IA 1OO3A 2OQ1A 1AYAA 2DVJA 3IMDA 5IBMA 2EYZA 2MQIA 2L4KA 4JGHA 4L1BB 1FU6A 1B47A 3S9KA 1I3ZA 1A1EA 1O44A 2MRJA 4GPLB 4GWFA 3VRNA 3BUOB 4XZ1A 1SHDA 4F59A 1O4OA 2MK2A 3N7YA 4EIHA 3QWXX 3IN7A 1LUIA 2Y1NA 3VS0A 1JYQA 3CD3A 3BUWB 3VS2A 4H34A 2CI8A 2HDXA 1O4KA 1YVLA 1O4GA 2EU0A 2FCIA 3PSJA 4LUEA 1O4MA 3S8NA 1FYRA 2KNOA 1NZVA 3TL0A 1M27A 2PTKA 2CRHA 1KC2A 2ETZA 1RQQC 1FU5A 1LKLA 1BKLA 2C0TA 1O4EA 4U17A 1LUMA 2HDVA 1R1SA 5J3XA 1HCSB 1Y1UA 2Y1MA 1O45A 2B3OA 3WA4A 1A1AA 1AB2A 2DX0A 2OZOA 5D0JA 1TZEE 3S8OA 3BUNB 1O4CA 3HCKA 1O46A 2LNWA 4F5AA 4DGPA 4E68A 4K11A 2H46E 2EYYA 4OHEA 1O4FA 1M61A 1FBVA 1BHHB 3US4A 1UURA 2EYVA 5HKYA 3GXWA 3K2MA 2HMHA 2LCTA 5DC0B 2DLZA 3N8MA 4JEGA 1O41A 1P13A 4D8KA 3NHNA 1BM2A 3IN8A 1SHBA 2CI9A 1X0NA 2K7AB 2LQNA 2IZVA 2DLYA 3VS4A 2RORA 4E93A 3M7FA 4LUDA 1AOTF 2EO6A 2MRKA 1BF5A 1O4LA 2H8HA 2YSXA 1NRVA 4NWGA 2C0OA 1BLKA 5AXIA 2C0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNA A;  1IJR A;  3VGO A;  4A4C A;  4OHL A;  4U1P A;  1O42 A;  2IUI A;  2VIF A;  1A07 A;  3PS5 A;  5GJH A;  2DCR A;  2L3T A;  4OHH A;  1AD5 A;  1A1C A;  5HKZ A;  1QG1 E;  3PSK A;  1K9A A;  2EL8 A;  1O4I A;  2K79 B;  3OV1 A;  1O4R A;  3VS3 A;  2KK6 A;  4ROJ A;  4P9Z A;  4F5B A;  1LUK A;  1X27 A;  1CWD L;  4JE4 A;  3VS1 A;  2EKX A;  1A1B A;  5KAZ A;  2JYQ A;  3OVE A;  1D1Z A;  1NZL A;  4GL9 E;  1OPK A;  1RJA A;  4QSY A;  2LNX A;  1LCJ A;  1CSY A;  1R1Q A;  1O4J A;  1R1P A;  1BHH A;  3TKZ A;  1HCT B;  2PLE A;  4EY0 A;  1D4W A;  1JYU A;  2AUG A;  3HHM B;  1F1W A;  2RVF A;  2MC1 A;  1O4N A;  1D4T A;  2AOA A;  1QCF A;  4K44 A;  1TCE A;  1OO4 A;  2FO0 A;  4K2R A;  2ECD A;  3S8L A;  1YVH A;  2YU7 A;  1JWO A;  5HKW A;  1AOU F;  2CBL A;  1GRI A;  3VRY A;  3ZNI A;  1RPY A;  3EAC A;  1SKJ A;  4A4B A;  2SHP A;  1X6C A;  2H5K A;  5GJI A;  2CIA A;  3MXY A;  3MXC A;  3MAZ A;  5AUL A;  4OHI A;  3N84 A;  1BHF A;  1O47 A;  1O4Q A;  3VRO A;  1MIL A;  1O49 A;  2IUH A;  1O4D A;  3PLF B;  1AYD A;  5EHP A;  4OHD A;  3QWY A;  3IMJ A;  1O43 A;  2EO3 A;  1O4H A;  1OPL A;  1FHS A;  1SHA A;  1SPR A;  1KSW A;  1Y57 A;  3CBL A;  1BFJ A;  1IS0 A;  3BKB A;  3VRR A;  1A81 A;  2RSY A;  1BG1 A;  1JYR A;  4NWF A;  3CWG A;  3BUX B;  1LUN A;  1PIC A;  4X6S A;  1AYB A;  2LQW A;  2GSB A;  1LKK A;  2CS0 A;  2L6K A;  3BUM B;  1KA6 A;  2GE9 A;  3UF4 A;  4DGX A;  1CJ1 A;  5EG3 B;  2RMX A;  1BFI A;  5EEL A;  3VRQ A;  4TZI A;  2PLD A;  5EHR A;  1F2F A;  1MW4 A;  2HCK A;  2ABL A;  3KFJ A;  1AYC A;  5I6V A;  5DC4 A;  3HIZ B;  5DC9 A;  1O4A A;  5BO4 A;  3PFV A;  1A09 A;  1BKM A;  3PQZ A;  1WQU A;  1O4P A;  4FBN A;  3OB1 B;  1CWE A;  3PJP A;  2DM0 A;  2SRC A;  4H1O A;  1FMK A;  3VS5 A;  4P9V A;  3OP0 A;  1A08 A;  4FL3 A;  2BBU A;  3EAZ A;  5EEQ A;  3UYO A;  2Y3A B;  1BMB A;  3VRZ A;  1KA7 A;  1GHU A;  1O4B A;  2XP1 A;  1BLJ A;  4FL2 A;  5CDW A;  3CXL A;  1XA6 A;  2IUG A;  1H9O A;  2QMS A;  1SPS A;  1G83 A;  3GQI B;  2CR4 A;  1CSZ A;  2PNB A;  2C9W A;  1Z3K A;  1ZFP E;  4K45 A;  1LCK A;  3OB2 B;  4WWQ A;  1UUS A;  2EOB A;  2HUW A;  1JU5 A;  4M4Z A;  1FBZ A;  3VRP A;  5DF6 A;  1QAD A;  3VS7 A;  3T04 A;  3GXX A;  3VS6 A;  2AOB A;  1O48 A;  4XZ0 A;  5IBS A;  3C7I A;  1OO3 A;  2OQ1 A;  1AYA A;  2DVJ A;  3IMD A;  5IBM A;  2EYZ A;  2MQI A;  2L4K A;  4JGH A;  4L1B B;  1FU6 A;  1B47 A;  3S9K A;  1I3Z A;  1A1E A;  1O44 A;  2MRJ A;  4GPL B;  4GWF A;  3VRN A;  3BUO B;  4XZ1 A;  1SHD A;  4F59 A;  1O4O A;  2MK2 A;  3N7Y A;  4EIH A;  3QWX X;  3IN7 A;  1LUI A;  2Y1N A;  3VS0 A;  1JYQ A;  3CD3 A;  3BUW B;  3VS2 A;  4H34 A;  2CI8 A;  2HDX A;  1O4K A;  1YVL A;  1O4G A;  2EU0 A;  2FCI A;  3PSJ A;  4LUE A;  1O4M A;  3S8N A;  1FYR A;  2KNO A;  1NZV A;  3TL0 A;  1M27 A;  2PTK A;  2CRH A;  1KC2 A;  2ETZ A;  1RQQ C;  1FU5 A;  1LKL A;  1BKL A;  2C0T A;  1O4E A;  4U17 A;  1LUM A;  2HDV A;  1R1S A;  5J3X A;  1HCS B;  1Y1U A;  2Y1M A;  1O45 A;  2B3O A;  3WA4 A;  1A1A A;  1AB2 A;  2DX0 A;  2OZO A;  5D0J A;  1TZE E;  3S8O A;  3BUN B;  1O4C A;  3HCK A;  1O46 A;  2LNW A;  4F5A A;  4DGP A;  4E68 A;  4K11 A;  2H46 E;  2EYY A;  4OHE A;  1O4F A;  1M61 A;  1FBV A;  1BHH B;  3US4 A;  1UUR A;  2EYV A;  5HKY A;  3GXW A;  3K2M A;  2HMH A;  2LCT A;  5DC0 B;  2DLZ A;  3N8M A;  4JEG A;  1O41 A;  1P13 A;  4D8K A;  3NHN A;  1BM2 A;  3IN8 A;  1SHB A;  2CI9 A;  1X0N A;  2K7A B;  2LQN A;  2IZV A;  2DLY A;  3VS4 A;  2ROR A;  4E93 A;  3M7F A;  4LUD A;  1AOT F;  2EO6 A;  2MRK A;  1BF5 A;  1O4L A;  2H8H A;  2YSX A;  1NRV A;  4NWG A;  2C0O A;  1BLK A;  5AXI A;  2C0I A; 
#chains in the Genus database with same CATH topology
 2PNA A;  1IJR A;  3VGO A;  4A4C A;  4OHL A;  4U1P A;  1O42 A;  2IUI A;  2VIF A;  1A07 A;  3PS5 A;  5GJH A;  2DCR A;  2L3T A;  2LRA A;  4OHH A;  1AD5 A;  1A1C A;  5HKZ A;  1QG1 E;  3PSK A;  1K9A A;  2EL8 A;  1O4I A;  2K79 B;  3OV1 A;  1O4R A;  3VS3 A;  2KK6 A;  4ROJ A;  4P9Z A;  4F5B A;  1LUK A;  1X27 A;  1CWD L;  4JE4 A;  3VS1 A;  2EKX A;  1A1B A;  5KAZ A;  2JYQ A;  3OVE A;  1D1Z A;  1NZL A;  4GL9 E;  1OPK A;  1RJA A;  4QSY A;  2LNX A;  1LCJ A;  1CSY A;  1R1Q A;  1O4J A;  1R1P A;  1BHH A;  3TKZ A;  1HCT B;  2PLE A;  4EY0 A;  1D4W A;  1JYU A;  2AUG A;  3HHM B;  1F1W A;  2RVF A;  2MC1 A;  1O4N A;  1D4T A;  2AOA A;  1QCF A;  4K44 A;  1TCE A;  1OO4 A;  2FO0 A;  4K2R A;  2ECD A;  3S8L A;  1YVH A;  2YU7 A;  1JWO A;  5HKW A;  1AOU F;  2CBL A;  1GRI A;  3VRY A;  3ZNI A;  1RPY A;  3EAC A;  1SKJ A;  4A4B A;  2SHP A;  1X6C A;  2H5K A;  5GJI A;  2CIA A;  3MXY A;  3MXC A;  3MAZ A;  5AUL A;  4OHI A;  3N84 A;  1BHF A;  1O47 A;  1O4Q A;  3VRO A;  1MIL A;  1O49 A;  2IUH A;  1O4D A;  3PLF B;  1AYD A;  5EHP A;  4OHD A;  3QWY A;  3IMJ A;  1O43 A;  2EO3 A;  1O4H A;  1OPL A;  1FHS A;  1SHA A;  1SPR A;  1KSW A;  1Y57 A;  3CBL A;  1BFJ A;  1IS0 A;  3BKB A;  3VRR A;  1A81 A;  2RSY A;  1BG1 A;  1JYR A;  4NWF A;  3CWG A;  3BUX B;  1LUN A;  1PIC A;  4X6S A;  1AYB A;  2LQW A;  2GSB A;  1LKK A;  2CS0 A;  2L6K A;  3BUM B;  1KA6 A;  2GE9 A;  3UF4 A;  4DGX A;  1CJ1 A;  5EG3 B;  2RMX A;  1BFI A;  5EEL A;  3VRQ A;  4TZI A;  2PLD A;  5EHR A;  1F2F A;  1MW4 A;  2HCK A;  2ABL A;  3KFJ A;  1AYC A;  5I6V A;  5DC4 A;  3HIZ B;  5DC9 A;  1O4A A;  5BO4 A;  3PFV A;  1A09 A;  1BKM A;  3PQZ A;  1WQU A;  1O4P A;  4FBN A;  3OB1 B;  1CWE A;  3PJP A;  2DM0 A;  2SRC A;  4H1O A;  1FMK A;  3VS5 A;  4P9V A;  3OP0 A;  1A08 A;  4FL3 A;  2BBU A;  3EAZ A;  5EEQ A;  3UYO A;  2Y3A B;  1BMB A;  3VRZ A;  1KA7 A;  1GHU A;  1O4B A;  2XP1 A;  1BLJ A;  4FL2 A;  5CDW A;  3CXL A;  1XA6 A;  2IUG A;  1H9O A;  2QMS A;  1SPS A;  1G83 A;  3GQI B;  2CR4 A;  1CSZ A;  2PNB A;  2C9W A;  1Z3K A;  1ZFP E;  4K45 A;  1LCK A;  3OB2 B;  4WWQ A;  1UUS A;  2EOB A;  2HUW A;  1JU5 A;  4M4Z A;  1FBZ A;  3VRP A;  5DF6 A;  1QAD A;  3VS7 A;  3T04 A;  3GXX A;  3LYV A;  3VS6 A;  2AOB A;  1O48 A;  2KGY A;  4XZ0 A;  5IBS A;  3C7I A;  1OO3 A;  2OQ1 A;  1AYA A;  2DVJ A;  3IMD A;  5IBM A;  2EYZ A;  2MQI A;  2L4K A;  4JGH A;  4L1B B;  1FU6 A;  1B47 A;  3S9K A;  1I3Z A;  1A1E A;  1O44 A;  2MRJ A;  4GPL B;  4GWF A;  3K2T A;  3VRN A;  3BUO B;  4XZ1 A;  1SHD A;  4F59 A;  1O4O A;  2MK2 A;  3N7Y A;  4EIH A;  3QWX X;  3IN7 A;  1LUI A;  2Y1N A;  3VS0 A;  1JYQ A;  3CD3 A;  3BUW B;  3VS2 A;  4H34 A;  2CI8 A;  2HDX A;  1O4K A;  1YVL A;  1O4G A;  2EU0 A;  2FCI A;  3PSJ A;  4LUE A;  1O4M A;  3S8N A;  1FYR A;  2KNO A;  1NZV A;  3TL0 A;  1M27 A;  2PTK A;  2CRH A;  1KC2 A;  2ETZ A;  1RQQ C;  1FU5 A;  1LKL A;  1BKL A;  2C0T A;  1O4E A;  4U17 A;  1LUM A;  2HDV A;  1R1S A;  5J3X A;  1HCS B;  1Y1U A;  2Y1M A;  1O45 A;  2B3O A;  3WA4 A;  1A1A A;  1AB2 A;  2DX0 A;  2OZO A;  5D0J A;  1TZE E;  3S8O A;  3BUN B;  1O4C A;  3HCK A;  1O46 A;  2LNW A;  4F5A A;  4DGP A;  4E68 A;  4K11 A;  2H46 E;  2EYY A;  4OHE A;  1O4F A;  1M61 A;  1FBV A;  1BHH B;  3US4 A;  1UUR A;  2EYV A;  5HKY A;  3GXW A;  3K2M A;  2HMH A;  2LCT A;  5DC0 B;  2DLZ A;  3N8M A;  4JEG A;  1O41 A;  1P13 A;  4D8K A;  3NHN A;  1BM2 A;  3IN8 A;  1SHB A;  2CI9 A;  1X0N A;  2K7A B;  2LQN A;  2IZV A;  2DLY A;  3VS4 A;  2ROR A;  4E93 A;  3M7F A;  4LUD A;  1AOT F;  2EO6 A;  2MRK A;  1BF5 A;  1O4L A;  2H8H A;  2YSX A;  1NRV A;  4NWG A;  2C0O A;  1BLK A;  5AXI A;  2C0I A; 
#chains in the Genus database with same CATH homology
 2PNA A;  1IJR A;  3VGO A;  4A4C A;  4OHL A;  4U1P A;  1O42 A;  2IUI A;  2VIF A;  1A07 A;  3PS5 A;  5GJH A;  2DCR A;  2L3T A;  4OHH A;  1AD5 A;  1A1C A;  5HKZ A;  1QG1 E;  3PSK A;  1K9A A;  2EL8 A;  1O4I A;  2K79 B;  3OV1 A;  1O4R A;  3VS3 A;  2KK6 A;  4ROJ A;  4P9Z A;  4F5B A;  1LUK A;  1X27 A;  1CWD L;  4JE4 A;  3VS1 A;  2EKX A;  1A1B A;  5KAZ A;  2JYQ A;  3OVE A;  1D1Z A;  1NZL A;  4GL9 E;  1OPK A;  1RJA A;  4QSY A;  2LNX A;  1LCJ A;  1CSY A;  1R1Q A;  1O4J A;  1R1P A;  1BHH A;  3TKZ A;  1HCT B;  2PLE A;  4EY0 A;  1D4W A;  1JYU A;  2AUG A;  3HHM B;  1F1W A;  2RVF A;  2MC1 A;  1O4N A;  1D4T A;  2AOA A;  1QCF A;  4K44 A;  1TCE A;  1OO4 A;  2FO0 A;  4K2R A;  2ECD A;  3S8L A;  1YVH A;  2YU7 A;  1JWO A;  5HKW A;  1AOU F;  2CBL A;  1GRI A;  3VRY A;  3ZNI A;  1RPY A;  3EAC A;  1SKJ A;  4A4B A;  2SHP A;  1X6C A;  2H5K A;  5GJI A;  2CIA A;  3MXY A;  3MXC A;  3MAZ A;  5AUL A;  4OHI A;  3N84 A;  1BHF A;  1O47 A;  1O4Q A;  3VRO A;  1MIL A;  1O49 A;  2IUH A;  1O4D A;  3PLF B;  1AYD A;  5EHP A;  4OHD A;  3QWY A;  3IMJ A;  1O43 A;  2EO3 A;  1O4H A;  1OPL A;  1FHS A;  1SHA A;  1SPR A;  1KSW A;  1Y57 A;  3CBL A;  1BFJ A;  1IS0 A;  3BKB A;  3VRR A;  1A81 A;  2RSY A;  1BG1 A;  1JYR A;  4NWF A;  3CWG A;  3BUX B;  1LUN A;  1PIC A;  4X6S A;  1AYB A;  2LQW A;  2GSB A;  1LKK A;  2CS0 A;  2L6K A;  3BUM B;  1KA6 A;  2GE9 A;  3UF4 A;  4DGX A;  1CJ1 A;  5EG3 B;  2RMX A;  1BFI A;  5EEL A;  3VRQ A;  4TZI A;  2PLD A;  5EHR A;  1F2F A;  1MW4 A;  2HCK A;  2ABL A;  3KFJ A;  1AYC A;  5I6V A;  5DC4 A;  3HIZ B;  5DC9 A;  1O4A A;  5BO4 A;  3PFV A;  1A09 A;  1BKM A;  3PQZ A;  1WQU A;  1O4P A;  4FBN A;  3OB1 B;  1CWE A;  3PJP A;  2DM0 A;  2SRC A;  4H1O A;  1FMK A;  3VS5 A;  4P9V A;  3OP0 A;  1A08 A;  4FL3 A;  2BBU A;  3EAZ A;  5EEQ A;  3UYO A;  2Y3A B;  1BMB A;  3VRZ A;  1KA7 A;  1GHU A;  1O4B A;  2XP1 A;  1BLJ A;  4FL2 A;  5CDW A;  3CXL A;  1XA6 A;  2IUG A;  1H9O A;  2QMS A;  1SPS A;  1G83 A;  3GQI B;  2CR4 A;  1CSZ A;  2PNB A;  2C9W A;  1Z3K A;  1ZFP E;  4K45 A;  1LCK A;  3OB2 B;  4WWQ A;  1UUS A;  2EOB A;  2HUW A;  1JU5 A;  4M4Z A;  1FBZ A;  3VRP A;  5DF6 A;  1QAD A;  3VS7 A;  3T04 A;  3GXX A;  3VS6 A;  2AOB A;  1O48 A;  4XZ0 A;  5IBS A;  3C7I A;  1OO3 A;  2OQ1 A;  1AYA A;  2DVJ A;  3IMD A;  5IBM A;  2EYZ A;  2MQI A;  2L4K A;  4JGH A;  4L1B B;  1FU6 A;  1B47 A;  3S9K A;  1I3Z A;  1A1E A;  1O44 A;  2MRJ A;  4GPL B;  4GWF A;  3VRN A;  3BUO B;  4XZ1 A;  1SHD A;  4F59 A;  1O4O A;  2MK2 A;  3N7Y A;  4EIH A;  3QWX X;  3IN7 A;  1LUI A;  2Y1N A;  3VS0 A;  1JYQ A;  3CD3 A;  3BUW B;  3VS2 A;  4H34 A;  2CI8 A;  2HDX A;  1O4K A;  1YVL A;  1O4G A;  2EU0 A;  2FCI A;  3PSJ A;  4LUE A;  1O4M A;  3S8N A;  1FYR A;  2KNO A;  1NZV A;  3TL0 A;  1M27 A;  2PTK A;  2CRH A;  1KC2 A;  2ETZ A;  1RQQ C;  1FU5 A;  1LKL A;  1BKL A;  2C0T A;  1O4E A;  4U17 A;  1LUM A;  2HDV A;  1R1S A;  5J3X A;  1HCS B;  1Y1U A;  2Y1M A;  1O45 A;  2B3O A;  3WA4 A;  1A1A A;  1AB2 A;  2DX0 A;  2OZO A;  5D0J A;  1TZE E;  3S8O A;  3BUN B;  1O4C A;  3HCK A;  1O46 A;  2LNW A;  4F5A A;  4DGP A;  4E68 A;  4K11 A;  2H46 E;  2EYY A;  4OHE A;  1O4F A;  1M61 A;  1FBV A;  1BHH B;  3US4 A;  1UUR A;  2EYV A;  5HKY A;  3GXW A;  3K2M A;  2HMH A;  2LCT A;  5DC0 B;  2DLZ A;  3N8M A;  4JEG A;  1O41 A;  1P13 A;  4D8K A;  3NHN A;  1BM2 A;  3IN8 A;  1SHB A;  2CI9 A;  1X0N A;  2K7A B;  2LQN A;  2IZV A;  2DLY A;  3VS4 A;  2ROR A;  4E93 A;  3M7F A;  4LUD A;  1AOT F;  2EO6 A;  2MRK A;  1BF5 A;  1O4L A;  2H8H A;  2YSX A;  1NRV A;  4NWG A;  2C0O A;  1BLK A;  5AXI A;  2C0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...