2MC1A

Solution structure of the vav1 sh2 domain complexed with a syk-derived singly phosphorylated peptide
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
b'GHMQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene vav
publication title Differential recognition of syk-binding sites by each of the two phosphotyrosine-binding pockets of the Vav SH2 domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/protein binding
total genus 29
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2mc1A01
3TL0A 5EHPA 3VGOA 1KSWA 3VROA 1O4MA 1O4CA 2MC1A 1P13A 2EYVA 2CI8A 5HKZA 3N7YA 1GRIA 3M7FA 4U1PA 1HCSB 5IBMA 1AOUF 2FO0A 4JEGA 1TZEE 3HIZB 1O4DA 2K7AB 3CD3A 1YVLA 2HDXA 1BKMA 2DM0A 2AUGA 1JYRA 1FYRA 3S9KA 1JYUA 3ZNIA 1YVHA 3BUNB 1LUMA 2CS0A 2CIAA 1SHDA 2PTKA 3EACA 5DC4A 3IMDA 4OHEA 2DCRA 3VS6A 1TCEA 5GJIA 1UURA 1A1BA 1O4OA 1OPLA 4FBNA 1AD5A 5DC0B 1AYCA 1A09A 2FCIA 3K2MA 2MK2A 4M4ZA 1O45A 2EU0A 1A08A 1O4QA 3PSJA 1BHHB 2Y1NA 1CWEA 1B47A 1LUKA 3IMJA 3PJPA 2EO3A 2C0OA 5D0JA 3IN7A 2CI9A 5AXIA 2ETZA 1QADA 2XP1A 1LKKA 1O4GA 2LNXA 2HUWA 1O4KA 2JYQA 3VRNA 1BHHA 5GJHA 1R1SA 3OB1B 2IUHA 1D4TA 3EAZA 2DLYA 5BO4A 2BBUA 4L1BB 2EKXA 3VRYA 1F1WA 1H9OA 1CWDL 3IN8A 2HCKA 3PSKA 3OV1A 4OHHA 4DGPA 1BKLA 4F5AA 4E93A 3GXWA 1KA7A 3S8LA 2L6KA 5I6VA 1BFIA 5HKYA 2L3TA 3N8MA 4JGHA 2L4KA 4JE4A 1O4IA 3MXCA 1BLKA 1LUNA 4K44A 4D8KA 1IJRA 5AULA 3CWGA 1BMBA 1RJAA 1Y57A 5DF6A 2DVJA 1BM2A 1O42A 3UF4A 5KAZA 1O44A 1R1QA 2RVFA 2CBLA 4GPLB 4H1OA 3GXXA 2ECDA 1SHBA 4NWGA 3BKBA 2GE9A 2C9WA 1HCTB 1NZVA 3QWYA 1O4BA 3GQIB 2LQNA 5EELA 1O43A 2B3OA 4LUDA 3VS5A 1GHUA 2ABLA 2IZVA 2MRKA 1OO4A 1BFJA 4X6SA 1AYAA 4F59A 1MW4A 2RORA 1SPSA 1AYDA 1OPKA 1O4PA 2YSXA 4H34A 1OO3A 1F2FA 2RSYA 4OHIA 4LUEA 1FU6A 2CRHA 1O4HA 1K9AA 1JU5A 1KA6A 1LUIA 3VS2A 4U17A 1FBVA 4K2RA 2H46E 4EIHA 1D4WA 2AOAA 3S8NA 4DGXA 1O49A 1ZFPE 5EG3B 1SHAA 2MRJA 1R1PA 1AYBA 1O4AA 1D1ZA 1LCJA 2DX0A 3VS3A 4GWFA 4A4CA 1O41A 1O46A 1PICA 3VS4A 4F5BA 3KFJA 3BUXB 4FL2A 1M61A 4P9VA 1IS0A 2EO6A 3PQZA 1LCKA 5EEQA 1O4NA 1CJ1A 1Y1UA 1FU5A 5HKWA 2PLEA 4A4BA 5CDWA 2LNWA 1QCFA 5J3XA 3VS7A 2KNOA 1O4EA 1G83A 2AOBA 2EYYA 4OHDA 1KC2A 2OQ1A 1A07A 2EOBA 3PFVA 3MXYA 2Y1MA 2OZOA 3UYOA 3TKZA 2HDVA 2H8HA 4XZ0A 1A81A 3BUOB 1LKLA 1NZLA 2RMXA 4E68A 2YU7A 3BUWB 4GL9E 5IBSA 2HMHA 2SRCA 3BUMB 4ROJA 4FL3A 1UUSA 1I3ZA 1O4FA 1A1AA 3VRQA 1BHFA 1O48A 5EHRA 3CBLA 1X27A 2C0IA 1XA6A 1JWOA 2PNAA 3US4A 3HHMB 3S8OA 1BF5A 3OB2B 1FHSA 1O47A 1SKJA 3N84A 1A1CA 4K45A 4TZIA 1QG1E 1M27A 2Y3AB 1BG1A 3OP0A 4NWFA 3QWXX 4WWQA 1AB2A 3CXLA 5DC9A 3VRRA 2PNBA 1NRVA 3VRZA 2C0TA 2LQWA 2EL8A 2DLZA 2IUGA 4QSYA 2KK6A 1O4RA 2GSBA 1X6CA 3VS0A 2QMSA 3PLFB 2MQIA 1MILA 1RQQC 1CSYA 1A1EA 1WQUA 1Z3KA 1CSZA 3HCKA 1AOTF 1JYQA 3MAZA 2LCTA 2K79B 3VRPA 1RPYA 1X0NA 4K11A 1FMKA 2EYZA 3VS1A 3WA4A 3NHNA 1BLJA 1O4JA 1FBZA 2IUIA 2SHPA 1SPRA 2H5KA 4P9ZA 2PLDA 2CR4A 3OVEA 3PS5A 4EY0A 3T04A 2VIFA 4OHLA 1O4LA 4XZ1A 3C7IA
chains in the Genus database with same CATH superfamily
3TL0A 5EHPA 3VGOA 1KSWA 3VROA 1O4MA 1O4CA 2MC1A 1P13A 2EYVA 2CI8A 5HKZA 3N7YA 1GRIA 3M7FA 4U1PA 1HCSB 5IBMA 1AOUF 2FO0A 4JEGA 1TZEE 3HIZB 1O4DA 2K7AB 3CD3A 1YVLA 2HDXA 1BKMA 2DM0A 2AUGA 1JYRA 1FYRA 3S9KA 1JYUA 3ZNIA 1YVHA 3BUNB 1LUMA 2CS0A 2CIAA 1SHDA 2PTKA 3EACA 5DC4A 3IMDA 4OHEA 2DCRA 3VS6A 1TCEA 5GJIA 1UURA 1A1BA 1O4OA 1OPLA 4FBNA 1AD5A 5DC0B 1AYCA 1A09A 2FCIA 3K2MA 2MK2A 4M4ZA 1O45A 2EU0A 1A08A 1O4QA 3PSJA 1BHHB 2Y1NA 1CWEA 1B47A 1LUKA 3IMJA 3PJPA 2EO3A 2C0OA 5D0JA 3IN7A 2CI9A 5AXIA 2ETZA 1QADA 2XP1A 1LKKA 1O4GA 2LNXA 2HUWA 1O4KA 2JYQA 3VRNA 1BHHA 3LYVA 5GJHA 1R1SA 3OB1B 2IUHA 1D4TA 3EAZA 2DLYA 5BO4A 2BBUA 4L1BB 2EKXA 3VRYA 1F1WA 1H9OA 1CWDL 3IN8A 2HCKA 3PSKA 3OV1A 4OHHA 4DGPA 1BKLA 4F5AA 4E93A 3GXWA 1KA7A 3S8LA 2L6KA 5I6VA 1BFIA 5HKYA 2L3TA 3N8MA 4JGHA 2L4KA 4JE4A 1O4IA 3MXCA 1BLKA 1LUNA 4K44A 4D8KA 1IJRA 5AULA 3CWGA 1BMBA 1RJAA 1Y57A 5DF6A 2DVJA 1BM2A 1O42A 3UF4A 5KAZA 1O44A 1R1QA 2RVFA 2CBLA 4GPLB 4H1OA 3GXXA 2ECDA 1SHBA 4NWGA 3BKBA 2GE9A 2C9WA 1HCTB 1NZVA 3QWYA 1O4BA 3GQIB 2LQNA 5EELA 1O43A 2B3OA 4LUDA 3VS5A 2KGYA 1GHUA 2ABLA 2IZVA 2MRKA 1OO4A 1BFJA 4X6SA 1AYAA 4F59A 1MW4A 2RORA 1SPSA 1AYDA 1OPKA 1O4PA 2YSXA 3K2TA 4H34A 1OO3A 1F2FA 2RSYA 4OHIA 4LUEA 1FU6A 2CRHA 1O4HA 1K9AA 1JU5A 1KA6A 1LUIA 3VS2A 4U17A 1FBVA 4K2RA 2H46E 4EIHA 1D4WA 2AOAA 3S8NA 4DGXA 1O49A 1ZFPE 5EG3B 1SHAA 2MRJA 1R1PA 1AYBA 1O4AA 1D1ZA 1LCJA 2DX0A 3VS3A 4GWFA 4A4CA 1O41A 1O46A 1PICA 3VS4A 4F5BA 3KFJA 3BUXB 4FL2A 1M61A 4P9VA 1IS0A 2EO6A 3PQZA 1LCKA 5EEQA 1O4NA 1CJ1A 1Y1UA 1FU5A 5HKWA 2PLEA 4A4BA 5CDWA 2LNWA 1QCFA 5J3XA 3VS7A 2KNOA 1O4EA 1G83A 2AOBA 2EYYA 4OHDA 1KC2A 2OQ1A 1A07A 2EOBA 3PFVA 3MXYA 2Y1MA 2OZOA 3UYOA 3TKZA 2HDVA 2H8HA 4XZ0A 1A81A 3BUOB 1LKLA 1NZLA 2RMXA 4E68A 2YU7A 3BUWB 4GL9E 5IBSA 2HMHA 2SRCA 3BUMB 4ROJA 4FL3A 1UUSA 1I3ZA 1O4FA 1A1AA 3VRQA 1BHFA 1O48A 5EHRA 3CBLA 1X27A 2C0IA 1XA6A 1JWOA 2PNAA 3US4A 3HHMB 3S8OA 1BF5A 3OB2B 1FHSA 1O47A 1SKJA 3N84A 1A1CA 4K45A 4TZIA 1QG1E 1M27A 2Y3AB 1BG1A 3OP0A 4NWFA 3QWXX 4WWQA 1AB2A 3CXLA 5DC9A 3VRRA 2PNBA 1NRVA 3VRZA 2C0TA 2LQWA 2EL8A 2DLZA 2IUGA 4QSYA 2KK6A 1O4RA 2GSBA 1X6CA 3VS0A 2QMSA 3PLFB 2MQIA 1MILA 1RQQC 1CSYA 1A1EA 1WQUA 1Z3KA 1CSZA 3HCKA 1AOTF 1JYQA 3MAZA 2LCTA 2K79B 3VRPA 1RPYA 1X0NA 4K11A 1FMKA 2EYZA 3VS1A 3WA4A 3NHNA 1BLJA 1O4JA 1FBZA 2LRAA 2IUIA 2SHPA 1SPRA 2H5KA 4P9ZA 2PLDA 2CR4A 3OVEA 3PS5A 4EY0A 3T04A 2VIFA 4OHLA 1O4LA 4XZ1A 3C7IA
chains in the Genus database with same CATH topology
3TL0A 5EHPA 3VGOA 1KSWA 3VROA 1O4MA 1O4CA 2MC1A 1P13A 2EYVA 2CI8A 5HKZA 3N7YA 1GRIA 3M7FA 4U1PA 1HCSB 5IBMA 1AOUF 2FO0A 4JEGA 1TZEE 3HIZB 1O4DA 2K7AB 3CD3A 1YVLA 2HDXA 1BKMA 2DM0A 2AUGA 1JYRA 1FYRA 3S9KA 1JYUA 3ZNIA 1YVHA 3BUNB 1LUMA 2CS0A 2CIAA 1SHDA 2PTKA 3EACA 5DC4A 3IMDA 4OHEA 2DCRA 3VS6A 1TCEA 5GJIA 1UURA 1A1BA 1O4OA 1OPLA 4FBNA 1AD5A 5DC0B 1AYCA 1A09A 2FCIA 3K2MA 2MK2A 4M4ZA 1O45A 2EU0A 1A08A 1O4QA 3PSJA 1BHHB 2Y1NA 1CWEA 1B47A 1LUKA 3IMJA 3PJPA 2EO3A 2C0OA 5D0JA 3IN7A 2CI9A 5AXIA 2ETZA 1QADA 2XP1A 1LKKA 1O4GA 2LNXA 2HUWA 1O4KA 2JYQA 3VRNA 1BHHA 5GJHA 1R1SA 3OB1B 2IUHA 1D4TA 3EAZA 2DLYA 5BO4A 2BBUA 4L1BB 2EKXA 3VRYA 1F1WA 1H9OA 1CWDL 3IN8A 2HCKA 3PSKA 3OV1A 4OHHA 4DGPA 1BKLA 4F5AA 4E93A 3GXWA 1KA7A 3S8LA 2L6KA 5I6VA 1BFIA 5HKYA 2L3TA 3N8MA 4JGHA 2L4KA 4JE4A 1O4IA 3MXCA 1BLKA 1LUNA 4K44A 4D8KA 1IJRA 5AULA 3CWGA 1BMBA 1RJAA 1Y57A 5DF6A 2DVJA 1BM2A 1O42A 3UF4A 5KAZA 1O44A 1R1QA 2RVFA 2CBLA 4GPLB 4H1OA 3GXXA 2ECDA 1SHBA 4NWGA 3BKBA 2GE9A 2C9WA 1HCTB 1NZVA 3QWYA 1O4BA 3GQIB 2LQNA 5EELA 1O43A 2B3OA 4LUDA 3VS5A 1GHUA 2ABLA 2IZVA 2MRKA 1OO4A 1BFJA 4X6SA 1AYAA 4F59A 1MW4A 2RORA 1SPSA 1AYDA 1OPKA 1O4PA 2YSXA 4H34A 1OO3A 1F2FA 2RSYA 4OHIA 4LUEA 1FU6A 2CRHA 1O4HA 1K9AA 1JU5A 1KA6A 1LUIA 3VS2A 4U17A 1FBVA 4K2RA 2H46E 4EIHA 1D4WA 2AOAA 3S8NA 4DGXA 1O49A 1ZFPE 5EG3B 1SHAA 2MRJA 1R1PA 1AYBA 1O4AA 1D1ZA 1LCJA 2DX0A 3VS3A 4GWFA 4A4CA 1O41A 1O46A 1PICA 3VS4A 4F5BA 3KFJA 3BUXB 4FL2A 1M61A 4P9VA 1IS0A 2EO6A 3PQZA 1LCKA 5EEQA 1O4NA 1CJ1A 1Y1UA 1FU5A 5HKWA 2PLEA 4A4BA 5CDWA 2LNWA 1QCFA 5J3XA 3VS7A 2KNOA 1O4EA 1G83A 2AOBA 2EYYA 4OHDA 1KC2A 2OQ1A 1A07A 2EOBA 3PFVA 3MXYA 2Y1MA 2OZOA 3UYOA 3TKZA 2HDVA 2H8HA 4XZ0A 1A81A 3BUOB 1LKLA 1NZLA 2RMXA 4E68A 2YU7A 3BUWB 4GL9E 5IBSA 2HMHA 2SRCA 3BUMB 4ROJA 4FL3A 1UUSA 1I3ZA 1O4FA 1A1AA 3VRQA 1BHFA 1O48A 5EHRA 3CBLA 1X27A 2C0IA 1XA6A 1JWOA 2PNAA 3US4A 3HHMB 3S8OA 1BF5A 3OB2B 1FHSA 1O47A 1SKJA 3N84A 1A1CA 4K45A 4TZIA 1QG1E 1M27A 2Y3AB 1BG1A 3OP0A 4NWFA 3QWXX 4WWQA 1AB2A 3CXLA 5DC9A 3VRRA 2PNBA 1NRVA 3VRZA 2C0TA 2LQWA 2EL8A 2DLZA 2IUGA 4QSYA 2KK6A 1O4RA 2GSBA 1X6CA 3VS0A 2QMSA 3PLFB 2MQIA 1MILA 1RQQC 1CSYA 1A1EA 1WQUA 1Z3KA 1CSZA 3HCKA 1AOTF 1JYQA 3MAZA 2LCTA 2K79B 3VRPA 1RPYA 1X0NA 4K11A 1FMKA 2EYZA 3VS1A 3WA4A 3NHNA 1BLJA 1O4JA 1FBZA 2IUIA 2SHPA 1SPRA 2H5KA 4P9ZA 2PLDA 2CR4A 3OVEA 3PS5A 4EY0A 3T04A 2VIFA 4OHLA 1O4LA 4XZ1A 3C7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TL0 A;  5EHP A;  3VGO A;  1KSW A;  3VRO A;  1O4M A;  1O4C A;  2MC1 A;  1P13 A;  2EYV A;  2CI8 A;  5HKZ A;  3N7Y A;  1GRI A;  3M7F A;  4U1P A;  1HCS B;  5IBM A;  1AOU F;  2FO0 A;  4JEG A;  1TZE E;  3HIZ B;  1O4D A;  2K7A B;  3CD3 A;  1YVL A;  2HDX A;  1BKM A;  2DM0 A;  2AUG A;  1JYR A;  1FYR A;  3S9K A;  1JYU A;  3ZNI A;  1YVH A;  3BUN B;  1LUM A;  2CS0 A;  2CIA A;  1SHD A;  2PTK A;  3EAC A;  5DC4 A;  3IMD A;  4OHE A;  2DCR A;  3VS6 A;  1TCE A;  5GJI A;  1UUR A;  1A1B A;  1O4O A;  1OPL A;  4FBN A;  1AD5 A;  5DC0 B;  1AYC A;  1A09 A;  2FCI A;  3K2M A;  2MK2 A;  4M4Z A;  1O45 A;  2EU0 A;  1A08 A;  1O4Q A;  3PSJ A;  1BHH B;  2Y1N A;  1CWE A;  1B47 A;  1LUK A;  3IMJ A;  3PJP A;  2EO3 A;  2C0O A;  5D0J A;  3IN7 A;  2CI9 A;  5AXI A;  2ETZ A;  1QAD A;  2XP1 A;  1LKK A;  1O4G A;  2LNX A;  2HUW A;  1O4K A;  2JYQ A;  3VRN A;  1BHH A;  5GJH A;  1R1S A;  3OB1 B;  2IUH A;  1D4T A;  3EAZ A;  2DLY A;  5BO4 A;  2BBU A;  4L1B B;  2EKX A;  3VRY A;  1F1W A;  1H9O A;  1CWD L;  3IN8 A;  2HCK A;  3PSK A;  3OV1 A;  4OHH A;  4DGP A;  1BKL A;  4F5A A;  4E93 A;  3GXW A;  1KA7 A;  3S8L A;  2L6K A;  5I6V A;  1BFI A;  5HKY A;  2L3T A;  3N8M A;  4JGH A;  2L4K A;  4JE4 A;  1O4I A;  3MXC A;  1BLK A;  1LUN A;  4K44 A;  4D8K A;  1IJR A;  5AUL A;  3CWG A;  1BMB A;  1RJA A;  1Y57 A;  5DF6 A;  2DVJ A;  1BM2 A;  1O42 A;  3UF4 A;  5KAZ A;  1O44 A;  1R1Q A;  2RVF A;  2CBL A;  4GPL B;  4H1O A;  3GXX A;  2ECD A;  1SHB A;  4NWG A;  3BKB A;  2GE9 A;  2C9W A;  1HCT B;  1NZV A;  3QWY A;  1O4B A;  3GQI B;  2LQN A;  5EEL A;  1O43 A;  2B3O A;  4LUD A;  3VS5 A;  1GHU A;  2ABL A;  2IZV A;  2MRK A;  1OO4 A;  1BFJ A;  4X6S A;  1AYA A;  4F59 A;  1MW4 A;  2ROR A;  1SPS A;  1AYD A;  1OPK A;  1O4P A;  2YSX A;  4H34 A;  1OO3 A;  1F2F A;  2RSY A;  4OHI A;  4LUE A;  1FU6 A;  2CRH A;  1O4H A;  1K9A A;  1JU5 A;  1KA6 A;  1LUI A;  3VS2 A;  4U17 A;  1FBV A;  4K2R A;  2H46 E;  4EIH A;  1D4W A;  2AOA A;  3S8N A;  4DGX A;  1O49 A;  1ZFP E;  5EG3 B;  1SHA A;  2MRJ A;  1R1P A;  1AYB A;  1O4A A;  1D1Z A;  1LCJ A;  2DX0 A;  3VS3 A;  4GWF A;  4A4C A;  1O41 A;  1O46 A;  1PIC A;  3VS4 A;  4F5B A;  3KFJ A;  3BUX B;  4FL2 A;  1M61 A;  4P9V A;  1IS0 A;  2EO6 A;  3PQZ A;  1LCK A;  5EEQ A;  1O4N A;  1CJ1 A;  1Y1U A;  1FU5 A;  5HKW A;  2PLE A;  4A4B A;  5CDW A;  2LNW A;  1QCF A;  5J3X A;  3VS7 A;  2KNO A;  1O4E A;  1G83 A;  2AOB A;  2EYY A;  4OHD A;  1KC2 A;  2OQ1 A;  1A07 A;  2EOB A;  3PFV A;  3MXY A;  2Y1M A;  2OZO A;  3UYO A;  3TKZ A;  2HDV A;  2H8H A;  4XZ0 A;  1A81 A;  3BUO B;  1LKL A;  1NZL A;  2RMX A;  4E68 A;  2YU7 A;  3BUW B;  4GL9 E;  5IBS A;  2HMH A;  2SRC A;  3BUM B;  4ROJ A;  4FL3 A;  1UUS A;  1I3Z A;  1O4F A;  1A1A A;  3VRQ A;  1BHF A;  1O48 A;  5EHR A;  3CBL A;  1X27 A;  2C0I A;  1XA6 A;  1JWO A;  2PNA A;  3US4 A;  3HHM B;  3S8O A;  1BF5 A;  3OB2 B;  1FHS A;  1O47 A;  1SKJ A;  3N84 A;  1A1C A;  4K45 A;  4TZI A;  1QG1 E;  1M27 A;  2Y3A B;  1BG1 A;  3OP0 A;  4NWF A;  3QWX X;  4WWQ A;  1AB2 A;  3CXL A;  5DC9 A;  3VRR A;  2PNB A;  1NRV A;  3VRZ A;  2C0T A;  2LQW A;  2EL8 A;  2DLZ A;  2IUG A;  4QSY A;  2KK6 A;  1O4R A;  2GSB A;  1X6C A;  3VS0 A;  2QMS A;  3PLF B;  2MQI A;  1MIL A;  1RQQ C;  1CSY A;  1A1E A;  1WQU A;  1Z3K A;  1CSZ A;  3HCK A;  1AOT F;  1JYQ A;  3MAZ A;  2LCT A;  2K79 B;  3VRP A;  1RPY A;  1X0N A;  4K11 A;  1FMK A;  2EYZ A;  3VS1 A;  3WA4 A;  3NHN A;  1BLJ A;  1O4J A;  1FBZ A;  2IUI A;  2SHP A;  1SPR A;  2H5K A;  4P9Z A;  2PLD A;  2CR4 A;  3OVE A;  3PS5 A;  4EY0 A;  3T04 A;  2VIF A;  4OHL A;  1O4L A;  4XZ1 A;  3C7I A; 
#chains in the Genus database with same CATH topology
 3TL0 A;  5EHP A;  3VGO A;  1KSW A;  3VRO A;  1O4M A;  1O4C A;  2MC1 A;  1P13 A;  2EYV A;  2CI8 A;  5HKZ A;  3N7Y A;  1GRI A;  3M7F A;  4U1P A;  1HCS B;  5IBM A;  1AOU F;  2FO0 A;  4JEG A;  1TZE E;  3HIZ B;  1O4D A;  2K7A B;  3CD3 A;  1YVL A;  2HDX A;  1BKM A;  2DM0 A;  2AUG A;  1JYR A;  1FYR A;  3S9K A;  1JYU A;  3ZNI A;  1YVH A;  3BUN B;  1LUM A;  2CS0 A;  2CIA A;  1SHD A;  2PTK A;  3EAC A;  5DC4 A;  3IMD A;  4OHE A;  2DCR A;  3VS6 A;  1TCE A;  5GJI A;  1UUR A;  1A1B A;  1O4O A;  1OPL A;  4FBN A;  1AD5 A;  5DC0 B;  1AYC A;  1A09 A;  2FCI A;  3K2M A;  2MK2 A;  4M4Z A;  1O45 A;  2EU0 A;  1A08 A;  1O4Q A;  3PSJ A;  1BHH B;  2Y1N A;  1CWE A;  1B47 A;  1LUK A;  3IMJ A;  3PJP A;  2EO3 A;  2C0O A;  5D0J A;  3IN7 A;  2CI9 A;  5AXI A;  2ETZ A;  1QAD A;  2XP1 A;  1LKK A;  1O4G A;  2LNX A;  2HUW A;  1O4K A;  2JYQ A;  3VRN A;  1BHH A;  3LYV A;  5GJH A;  1R1S A;  3OB1 B;  2IUH A;  1D4T A;  3EAZ A;  2DLY A;  5BO4 A;  2BBU A;  4L1B B;  2EKX A;  3VRY A;  1F1W A;  1H9O A;  1CWD L;  3IN8 A;  2HCK A;  3PSK A;  3OV1 A;  4OHH A;  4DGP A;  1BKL A;  4F5A A;  4E93 A;  3GXW A;  1KA7 A;  3S8L A;  2L6K A;  5I6V A;  1BFI A;  5HKY A;  2L3T A;  3N8M A;  4JGH A;  2L4K A;  4JE4 A;  1O4I A;  3MXC A;  1BLK A;  1LUN A;  4K44 A;  4D8K A;  1IJR A;  5AUL A;  3CWG A;  1BMB A;  1RJA A;  1Y57 A;  5DF6 A;  2DVJ A;  1BM2 A;  1O42 A;  3UF4 A;  5KAZ A;  1O44 A;  1R1Q A;  2RVF A;  2CBL A;  4GPL B;  4H1O A;  3GXX A;  2ECD A;  1SHB A;  4NWG A;  3BKB A;  2GE9 A;  2C9W A;  1HCT B;  1NZV A;  3QWY A;  1O4B A;  3GQI B;  2LQN A;  5EEL A;  1O43 A;  2B3O A;  4LUD A;  3VS5 A;  2KGY A;  1GHU A;  2ABL A;  2IZV A;  2MRK A;  1OO4 A;  1BFJ A;  4X6S A;  1AYA A;  4F59 A;  1MW4 A;  2ROR A;  1SPS A;  1AYD A;  1OPK A;  1O4P A;  2YSX A;  3K2T A;  4H34 A;  1OO3 A;  1F2F A;  2RSY A;  4OHI A;  4LUE A;  1FU6 A;  2CRH A;  1O4H A;  1K9A A;  1JU5 A;  1KA6 A;  1LUI A;  3VS2 A;  4U17 A;  1FBV A;  4K2R A;  2H46 E;  4EIH A;  1D4W A;  2AOA A;  3S8N A;  4DGX A;  1O49 A;  1ZFP E;  5EG3 B;  1SHA A;  2MRJ A;  1R1P A;  1AYB A;  1O4A A;  1D1Z A;  1LCJ A;  2DX0 A;  3VS3 A;  4GWF A;  4A4C A;  1O41 A;  1O46 A;  1PIC A;  3VS4 A;  4F5B A;  3KFJ A;  3BUX B;  4FL2 A;  1M61 A;  4P9V A;  1IS0 A;  2EO6 A;  3PQZ A;  1LCK A;  5EEQ A;  1O4N A;  1CJ1 A;  1Y1U A;  1FU5 A;  5HKW A;  2PLE A;  4A4B A;  5CDW A;  2LNW A;  1QCF A;  5J3X A;  3VS7 A;  2KNO A;  1O4E A;  1G83 A;  2AOB A;  2EYY A;  4OHD A;  1KC2 A;  2OQ1 A;  1A07 A;  2EOB A;  3PFV A;  3MXY A;  2Y1M A;  2OZO A;  3UYO A;  3TKZ A;  2HDV A;  2H8H A;  4XZ0 A;  1A81 A;  3BUO B;  1LKL A;  1NZL A;  2RMX A;  4E68 A;  2YU7 A;  3BUW B;  4GL9 E;  5IBS A;  2HMH A;  2SRC A;  3BUM B;  4ROJ A;  4FL3 A;  1UUS A;  1I3Z A;  1O4F A;  1A1A A;  3VRQ A;  1BHF A;  1O48 A;  5EHR A;  3CBL A;  1X27 A;  2C0I A;  1XA6 A;  1JWO A;  2PNA A;  3US4 A;  3HHM B;  3S8O A;  1BF5 A;  3OB2 B;  1FHS A;  1O47 A;  1SKJ A;  3N84 A;  1A1C A;  4K45 A;  4TZI A;  1QG1 E;  1M27 A;  2Y3A B;  1BG1 A;  3OP0 A;  4NWF A;  3QWX X;  4WWQ A;  1AB2 A;  3CXL A;  5DC9 A;  3VRR A;  2PNB A;  1NRV A;  3VRZ A;  2C0T A;  2LQW A;  2EL8 A;  2DLZ A;  2IUG A;  4QSY A;  2KK6 A;  1O4R A;  2GSB A;  1X6C A;  3VS0 A;  2QMS A;  3PLF B;  2MQI A;  1MIL A;  1RQQ C;  1CSY A;  1A1E A;  1WQU A;  1Z3K A;  1CSZ A;  3HCK A;  1AOT F;  1JYQ A;  3MAZ A;  2LCT A;  2K79 B;  3VRP A;  1RPY A;  1X0N A;  4K11 A;  1FMK A;  2EYZ A;  3VS1 A;  3WA4 A;  3NHN A;  1BLJ A;  1O4J A;  1FBZ A;  2LRA A;  2IUI A;  2SHP A;  1SPR A;  2H5K A;  4P9Z A;  2PLD A;  2CR4 A;  3OVE A;  3PS5 A;  4EY0 A;  3T04 A;  2VIF A;  4OHL A;  1O4L A;  4XZ1 A;  3C7I A; 
#chains in the Genus database with same CATH homology
 3TL0 A;  5EHP A;  3VGO A;  1KSW A;  3VRO A;  1O4M A;  1O4C A;  2MC1 A;  1P13 A;  2EYV A;  2CI8 A;  5HKZ A;  3N7Y A;  1GRI A;  3M7F A;  4U1P A;  1HCS B;  5IBM A;  1AOU F;  2FO0 A;  4JEG A;  1TZE E;  3HIZ B;  1O4D A;  2K7A B;  3CD3 A;  1YVL A;  2HDX A;  1BKM A;  2DM0 A;  2AUG A;  1JYR A;  1FYR A;  3S9K A;  1JYU A;  3ZNI A;  1YVH A;  3BUN B;  1LUM A;  2CS0 A;  2CIA A;  1SHD A;  2PTK A;  3EAC A;  5DC4 A;  3IMD A;  4OHE A;  2DCR A;  3VS6 A;  1TCE A;  5GJI A;  1UUR A;  1A1B A;  1O4O A;  1OPL A;  4FBN A;  1AD5 A;  5DC0 B;  1AYC A;  1A09 A;  2FCI A;  3K2M A;  2MK2 A;  4M4Z A;  1O45 A;  2EU0 A;  1A08 A;  1O4Q A;  3PSJ A;  1BHH B;  2Y1N A;  1CWE A;  1B47 A;  1LUK A;  3IMJ A;  3PJP A;  2EO3 A;  2C0O A;  5D0J A;  3IN7 A;  2CI9 A;  5AXI A;  2ETZ A;  1QAD A;  2XP1 A;  1LKK A;  1O4G A;  2LNX A;  2HUW A;  1O4K A;  2JYQ A;  3VRN A;  1BHH A;  5GJH A;  1R1S A;  3OB1 B;  2IUH A;  1D4T A;  3EAZ A;  2DLY A;  5BO4 A;  2BBU A;  4L1B B;  2EKX A;  3VRY A;  1F1W A;  1H9O A;  1CWD L;  3IN8 A;  2HCK A;  3PSK A;  3OV1 A;  4OHH A;  4DGP A;  1BKL A;  4F5A A;  4E93 A;  3GXW A;  1KA7 A;  3S8L A;  2L6K A;  5I6V A;  1BFI A;  5HKY A;  2L3T A;  3N8M A;  4JGH A;  2L4K A;  4JE4 A;  1O4I A;  3MXC A;  1BLK A;  1LUN A;  4K44 A;  4D8K A;  1IJR A;  5AUL A;  3CWG A;  1BMB A;  1RJA A;  1Y57 A;  5DF6 A;  2DVJ A;  1BM2 A;  1O42 A;  3UF4 A;  5KAZ A;  1O44 A;  1R1Q A;  2RVF A;  2CBL A;  4GPL B;  4H1O A;  3GXX A;  2ECD A;  1SHB A;  4NWG A;  3BKB A;  2GE9 A;  2C9W A;  1HCT B;  1NZV A;  3QWY A;  1O4B A;  3GQI B;  2LQN A;  5EEL A;  1O43 A;  2B3O A;  4LUD A;  3VS5 A;  1GHU A;  2ABL A;  2IZV A;  2MRK A;  1OO4 A;  1BFJ A;  4X6S A;  1AYA A;  4F59 A;  1MW4 A;  2ROR A;  1SPS A;  1AYD A;  1OPK A;  1O4P A;  2YSX A;  4H34 A;  1OO3 A;  1F2F A;  2RSY A;  4OHI A;  4LUE A;  1FU6 A;  2CRH A;  1O4H A;  1K9A A;  1JU5 A;  1KA6 A;  1LUI A;  3VS2 A;  4U17 A;  1FBV A;  4K2R A;  2H46 E;  4EIH A;  1D4W A;  2AOA A;  3S8N A;  4DGX A;  1O49 A;  1ZFP E;  5EG3 B;  1SHA A;  2MRJ A;  1R1P A;  1AYB A;  1O4A A;  1D1Z A;  1LCJ A;  2DX0 A;  3VS3 A;  4GWF A;  4A4C A;  1O41 A;  1O46 A;  1PIC A;  3VS4 A;  4F5B A;  3KFJ A;  3BUX B;  4FL2 A;  1M61 A;  4P9V A;  1IS0 A;  2EO6 A;  3PQZ A;  1LCK A;  5EEQ A;  1O4N A;  1CJ1 A;  1Y1U A;  1FU5 A;  5HKW A;  2PLE A;  4A4B A;  5CDW A;  2LNW A;  1QCF A;  5J3X A;  3VS7 A;  2KNO A;  1O4E A;  1G83 A;  2AOB A;  2EYY A;  4OHD A;  1KC2 A;  2OQ1 A;  1A07 A;  2EOB A;  3PFV A;  3MXY A;  2Y1M A;  2OZO A;  3UYO A;  3TKZ A;  2HDV A;  2H8H A;  4XZ0 A;  1A81 A;  3BUO B;  1LKL A;  1NZL A;  2RMX A;  4E68 A;  2YU7 A;  3BUW B;  4GL9 E;  5IBS A;  2HMH A;  2SRC A;  3BUM B;  4ROJ A;  4FL3 A;  1UUS A;  1I3Z A;  1O4F A;  1A1A A;  3VRQ A;  1BHF A;  1O48 A;  5EHR A;  3CBL A;  1X27 A;  2C0I A;  1XA6 A;  1JWO A;  2PNA A;  3US4 A;  3HHM B;  3S8O A;  1BF5 A;  3OB2 B;  1FHS A;  1O47 A;  1SKJ A;  3N84 A;  1A1C A;  4K45 A;  4TZI A;  1QG1 E;  1M27 A;  2Y3A B;  1BG1 A;  3OP0 A;  4NWF A;  3QWX X;  4WWQ A;  1AB2 A;  3CXL A;  5DC9 A;  3VRR A;  2PNB A;  1NRV A;  3VRZ A;  2C0T A;  2LQW A;  2EL8 A;  2DLZ A;  2IUG A;  4QSY A;  2KK6 A;  1O4R A;  2GSB A;  1X6C A;  3VS0 A;  2QMS A;  3PLF B;  2MQI A;  1MIL A;  1RQQ C;  1CSY A;  1A1E A;  1WQU A;  1Z3K A;  1CSZ A;  3HCK A;  1AOT F;  1JYQ A;  3MAZ A;  2LCT A;  2K79 B;  3VRP A;  1RPY A;  1X0N A;  4K11 A;  1FMK A;  2EYZ A;  3VS1 A;  3WA4 A;  3NHN A;  1BLJ A;  1O4J A;  1FBZ A;  2IUI A;  2SHP A;  1SPR A;  2H5K A;  4P9Z A;  2PLD A;  2CR4 A;  3OVE A;  3PS5 A;  4EY0 A;  3T04 A;  2VIF A;  4OHL A;  1O4L A;  4XZ1 A;  3C7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...