2PNBA

Structure of an sh2 domain of the p85 alpha subunit of phosphatidylinositol-3-oh kinase
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
104
structure length
104
Chain Sequence
b'LQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE P85-ALPHA SUBUNIT N-TERMINAL S
publication title Structure of an SH2 domain of the p85 alpha subunit of phosphatidylinositol-3-OH kinase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Signalling protein
total genus 7
structure length 104
sequence length 104
ec nomenclature ec 2.7.1.137: Phosphatidylinositol 3-kinase.
pdb deposition date 1992-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2pnbA00
4OHDA 1JU5A 3CXLA 2DM0A 2EL8A 4QSYA 1O4AA 2EO3A 2LNWA 2CI9A 1O4OA 3TKZA 2CBLA 4H34A 4NWGA 2H8HA 4GPLB 1XA6A 2MC1A 2LCTA 2MQIA 3T04A 3UYOA 1O43A 4FL3A 5BO4A 1IS0A 5DC9A 5EHRA 1O4GA 3PSJA 4FBNA 1HCTB 3N8MA 4FL2A 3VS1A 2LQNA 2K79B 2EYYA 2IZVA 3MXYA 1AYBA 1BMBA 2IUHA 3VRQA 1O4HA 4A4CA 2PNBA 1BKMA 3OV1A 2EU0A 1F2FA 1SPRA 1TCEA 2HMHA 1FMKA 2C0OA 2Y1NA 2PNAA 1HCSB 3GQIB 3CWGA 3S8LA 3VRYA 3NHNA 2LNXA 2JYQA 5KAZA 3S8NA 1NRVA 1R1QA 1X27A 1A1BA 1O4JA 5GJIA 1JWOA 5AULA 1GRIA 2MK2A 3WA4A 1JYRA 1A1CA 4GWFA 2CR4A 2RSYA 2K7AB 1O48A 3BUOB 3OP0A 2AOAA 2MRKA 3M7FA 4NWFA 5CDWA 1NZVA 1AD5A 2OZOA 2SHPA 1F1WA 1BHFA 2AOBA 3QWYA 2DCRA 1A07A 2PLEA 3IMJA 1CSYA 3OB1B 2L6KA 4JEGA 1BFJA 1LUKA 4XZ0A 1O4EA 2HUWA 4XZ1A 4F5AA 4LUDA 3US4A 4EY0A 1CJ1A 1LUNA 1FBZA 1Y57A 3PJPA 4A4BA 1OPKA 5DC4A 2YSXA 2DLYA 1R1SA 3CBLA 1SPSA 2C0IA 3S9KA 2DLZA 1SKJA 1Z3KA 1A09A 2DVJA 4K45A 1QCFA 4K11A 3VRZA 1O4MA 4H1OA 1M61A 3VROA 1O42A 2EOBA 5EELA 3GXWA 4F59A 5J3XA 2BBUA 2VIFA 1K9AA 2PTKA 2QMSA 1O49A 4JGHA 1FU6A 1UUSA 1P13A 3VS0A 2MRJA 1O4RA 3HHMB 2EYZA 3KFJA 1D4TA 3CD3A 2CI8A 1OO4A 4WWQA 3IMDA 3OVEA 2ECDA 3N7YA 2KK6A 2LQWA 4DGXA 1A81A 5EEQA 4E68A 1TZEE 1OPLA 1O44A 4L1BB 2KNOA 1LKKA 5HKZA 1RPYA 3BUXB 4F5BA 1LCKA 2C9WA 1O4BA 4ROJA 1O46A 1KSWA 5HKWA 2ABLA 3IN8A 1O4KA 2FO0A 1X0NA 1FHSA 3ZNIA 1BKLA 3QWXX 2H46E 2L4KA 1SHAA 1R1PA 3PLFB 4OHEA 3BUMB 1D1ZA 2C0TA 1A1EA 2CIAA 1BM2A 1KA7A 2Y3AB 3BKBA 2H5KA 2HCKA 4EIHA 2DX0A 1WQUA 3TL0A 3VS7A 1G83A 3S8OA 2GSBA 1UURA 1A1AA 3PQZA 1O4QA 1BHHA 4OHHA 1MW4A 1RJAA 4OHIA 5EHPA 1M27A 1AOTF 3VGOA 1AB2A 2ETZA 4K2RA 3EAZA 2EYVA 2IUGA 2CRHA 1O4LA 1OO3A 4X6SA 1H9OA 5DF6A 2SRCA 3VS6A 3C7IA 3VRRA 1O4IA 1FYRA 4D8KA 3UF4A 1O4PA 3PSKA 1IJRA 1LUMA 1CWEA 4P9ZA 1CSZA 1O4CA 3VS2A 3N84A 1JYUA 1YVHA 1O47A 5I6VA 1QG1E 3VS4A 1Y1UA 3PS5A 1KC2A 1X6CA 2L3TA 3VS5A 3BUNB 4JE4A 1BLJA 2FCIA 2HDXA 4LUEA 3VS3A 2RVFA 1SHDA 1I3ZA 1FU5A 4DGPA 2EKXA 2B3OA 1LCJA 1BG1A 3MAZA 2EO6A 5IBMA 3VRNA 1KA6A 1QADA 1AYCA 5DC0B 3PFVA 4OHLA 4P9VA 3VRPA 4M4ZA 1MILA 1O4FA 1BFIA 1RQQC 1D4WA 4U1PA 1CWDL 2XP1A 1A08A 2GE9A 2Y1MA 3HCKA 3EACA 1O4DA 4K44A 5IBSA 2OQ1A 1SHBA 1FBVA 1O41A 2IUIA 1JYQA 5D0JA 4GL9E 4E93A 2PLDA 4TZIA 1AYAA 3MXCA 1GHUA 1B47A 3BUWB 3HIZB 3K2MA 1BHHB 1ZFPE 5HKYA 1O45A 1NZLA 3GXXA 1PICA 1AYDA 4U17A 1LUIA 3IN7A 2RORA 5AXIA 1BLKA 2YU7A 1O4NA 3OB2B 2HDVA 2RMXA 1LKLA 5EG3B 2AUGA 1AOUF 1BF5A 1YVLA 5GJHA 2CS0A
chains in the Genus database with same CATH superfamily
4OHDA 1JU5A 3CXLA 2DM0A 2EL8A 4QSYA 1O4AA 2EO3A 2LNWA 2CI9A 1O4OA 3TKZA 2CBLA 4H34A 4NWGA 2H8HA 4GPLB 1XA6A 2MC1A 2LCTA 2MQIA 3T04A 3UYOA 1O43A 4FL3A 5BO4A 1IS0A 5DC9A 5EHRA 1O4GA 3PSJA 4FBNA 1HCTB 3N8MA 4FL2A 3VS1A 2LQNA 2K79B 2EYYA 2IZVA 3MXYA 1AYBA 1BMBA 2IUHA 3VRQA 1O4HA 4A4CA 2PNBA 1BKMA 3OV1A 2EU0A 1F2FA 1SPRA 1TCEA 2HMHA 1FMKA 2C0OA 2Y1NA 2PNAA 1HCSB 3GQIB 3CWGA 3S8LA 3VRYA 3NHNA 2LNXA 2JYQA 2KGYA 5KAZA 3S8NA 1NRVA 1R1QA 1X27A 1A1BA 1O4JA 5GJIA 1JWOA 5AULA 1GRIA 2MK2A 3WA4A 1JYRA 1A1CA 4GWFA 2CR4A 2RSYA 2K7AB 1O48A 3BUOB 3OP0A 2AOAA 2MRKA 3M7FA 4NWFA 5CDWA 1NZVA 1AD5A 2OZOA 2SHPA 1F1WA 1BHFA 2AOBA 3QWYA 2DCRA 1A07A 2PLEA 3IMJA 1CSYA 3OB1B 2L6KA 4JEGA 1BFJA 1LUKA 4XZ0A 1O4EA 2HUWA 4XZ1A 4F5AA 4LUDA 3US4A 4EY0A 1CJ1A 1LUNA 1FBZA 1Y57A 3PJPA 4A4BA 1OPKA 5DC4A 2YSXA 2DLYA 1R1SA 3CBLA 1SPSA 2C0IA 3S9KA 2DLZA 1SKJA 1Z3KA 1A09A 2DVJA 4K45A 1QCFA 4K11A 3VRZA 1O4MA 4H1OA 1M61A 3VROA 1O42A 2EOBA 5EELA 3GXWA 4F59A 5J3XA 2BBUA 2VIFA 1K9AA 2PTKA 2QMSA 1O49A 4JGHA 1FU6A 1UUSA 1P13A 3VS0A 2MRJA 1O4RA 3HHMB 2EYZA 3KFJA 1D4TA 3CD3A 2CI8A 1OO4A 4WWQA 3IMDA 3OVEA 2ECDA 3N7YA 2KK6A 2LQWA 4DGXA 1A81A 5EEQA 4E68A 1TZEE 1OPLA 1O44A 4L1BB 2KNOA 1LKKA 5HKZA 1RPYA 3BUXB 4F5BA 1LCKA 2C9WA 1O4BA 4ROJA 1O46A 1KSWA 5HKWA 2ABLA 3IN8A 1O4KA 2FO0A 1X0NA 1FHSA 3ZNIA 1BKLA 3QWXX 2H46E 2L4KA 1SHAA 1R1PA 3PLFB 4OHEA 3BUMB 1D1ZA 3LYVA 2C0TA 1A1EA 2CIAA 1BM2A 1KA7A 2Y3AB 3BKBA 2H5KA 2HCKA 4EIHA 2DX0A 1WQUA 3TL0A 3VS7A 1G83A 3S8OA 2GSBA 1UURA 1A1AA 3PQZA 1O4QA 1BHHA 4OHHA 1MW4A 1RJAA 2LRAA 4OHIA 5EHPA 1M27A 1AOTF 3VGOA 1AB2A 2ETZA 4K2RA 3EAZA 2EYVA 2IUGA 2CRHA 1O4LA 1OO3A 4X6SA 1H9OA 5DF6A 2SRCA 3VS6A 3C7IA 3VRRA 1O4IA 1FYRA 4D8KA 3UF4A 1O4PA 3PSKA 1IJRA 1LUMA 1CWEA 4P9ZA 1CSZA 1O4CA 3VS2A 3N84A 1JYUA 1YVHA 1O47A 5I6VA 3K2TA 1QG1E 3VS4A 1Y1UA 3PS5A 1KC2A 1X6CA 2L3TA 3VS5A 3BUNB 4JE4A 1BLJA 2FCIA 2HDXA 4LUEA 3VS3A 2RVFA 1SHDA 1I3ZA 1FU5A 4DGPA 2EKXA 2B3OA 1LCJA 1BG1A 3MAZA 2EO6A 5IBMA 3VRNA 1KA6A 1QADA 1AYCA 5DC0B 3PFVA 4OHLA 4P9VA 3VRPA 4M4ZA 1MILA 1O4FA 1BFIA 1RQQC 1D4WA 4U1PA 1CWDL 2XP1A 1A08A 2GE9A 2Y1MA 3HCKA 3EACA 1O4DA 4K44A 5IBSA 2OQ1A 1SHBA 1FBVA 1O41A 2IUIA 1JYQA 5D0JA 4GL9E 4E93A 2PLDA 4TZIA 1AYAA 3MXCA 1GHUA 1B47A 3BUWB 3HIZB 3K2MA 1BHHB 1ZFPE 5HKYA 1O45A 1NZLA 3GXXA 1PICA 1AYDA 4U17A 1LUIA 3IN7A 2RORA 5AXIA 1BLKA 2YU7A 1O4NA 3OB2B 2HDVA 2RMXA 1LKLA 5EG3B 2AUGA 1AOUF 1BF5A 1YVLA 5GJHA 2CS0A
chains in the Genus database with same CATH topology
4OHDA 1JU5A 3CXLA 2DM0A 2EL8A 4QSYA 1O4AA 2EO3A 2LNWA 2CI9A 1O4OA 3TKZA 2CBLA 4H34A 4NWGA 2H8HA 4GPLB 1XA6A 2MC1A 2LCTA 2MQIA 3T04A 3UYOA 1O43A 4FL3A 5BO4A 1IS0A 5DC9A 5EHRA 1O4GA 3PSJA 4FBNA 1HCTB 3N8MA 4FL2A 3VS1A 2LQNA 2K79B 2EYYA 2IZVA 3MXYA 1AYBA 1BMBA 2IUHA 3VRQA 1O4HA 4A4CA 2PNBA 1BKMA 3OV1A 2EU0A 1F2FA 1SPRA 1TCEA 2HMHA 1FMKA 2C0OA 2Y1NA 2PNAA 1HCSB 3GQIB 3CWGA 3S8LA 3VRYA 3NHNA 2LNXA 2JYQA 5KAZA 3S8NA 1NRVA 1R1QA 1X27A 1A1BA 1O4JA 5GJIA 1JWOA 5AULA 1GRIA 2MK2A 3WA4A 1JYRA 1A1CA 4GWFA 2CR4A 2RSYA 2K7AB 1O48A 3BUOB 3OP0A 2AOAA 2MRKA 3M7FA 4NWFA 5CDWA 1NZVA 1AD5A 2OZOA 2SHPA 1F1WA 1BHFA 2AOBA 3QWYA 2DCRA 1A07A 2PLEA 3IMJA 1CSYA 3OB1B 2L6KA 4JEGA 1BFJA 1LUKA 4XZ0A 1O4EA 2HUWA 4XZ1A 4F5AA 4LUDA 3US4A 4EY0A 1CJ1A 1LUNA 1FBZA 1Y57A 3PJPA 4A4BA 1OPKA 5DC4A 2YSXA 2DLYA 1R1SA 3CBLA 1SPSA 2C0IA 3S9KA 2DLZA 1SKJA 1Z3KA 1A09A 2DVJA 4K45A 1QCFA 4K11A 3VRZA 1O4MA 4H1OA 1M61A 3VROA 1O42A 2EOBA 5EELA 3GXWA 4F59A 5J3XA 2BBUA 2VIFA 1K9AA 2PTKA 2QMSA 1O49A 4JGHA 1FU6A 1UUSA 1P13A 3VS0A 2MRJA 1O4RA 3HHMB 2EYZA 3KFJA 1D4TA 3CD3A 2CI8A 1OO4A 4WWQA 3IMDA 3OVEA 2ECDA 3N7YA 2KK6A 2LQWA 4DGXA 1A81A 5EEQA 4E68A 1TZEE 1OPLA 1O44A 4L1BB 2KNOA 1LKKA 5HKZA 1RPYA 3BUXB 4F5BA 1LCKA 2C9WA 1O4BA 4ROJA 1O46A 1KSWA 5HKWA 2ABLA 3IN8A 1O4KA 2FO0A 1X0NA 1FHSA 3ZNIA 1BKLA 3QWXX 2H46E 2L4KA 1SHAA 1R1PA 3PLFB 4OHEA 3BUMB 1D1ZA 2C0TA 1A1EA 2CIAA 1BM2A 1KA7A 2Y3AB 3BKBA 2H5KA 2HCKA 4EIHA 2DX0A 1WQUA 3TL0A 3VS7A 1G83A 3S8OA 2GSBA 1UURA 1A1AA 3PQZA 1O4QA 1BHHA 4OHHA 1MW4A 1RJAA 4OHIA 5EHPA 1M27A 1AOTF 3VGOA 1AB2A 2ETZA 4K2RA 3EAZA 2EYVA 2IUGA 2CRHA 1O4LA 1OO3A 4X6SA 1H9OA 5DF6A 2SRCA 3VS6A 3C7IA 3VRRA 1O4IA 1FYRA 4D8KA 3UF4A 1O4PA 3PSKA 1IJRA 1LUMA 1CWEA 4P9ZA 1CSZA 1O4CA 3VS2A 3N84A 1JYUA 1YVHA 1O47A 5I6VA 1QG1E 3VS4A 1Y1UA 3PS5A 1KC2A 1X6CA 2L3TA 3VS5A 3BUNB 4JE4A 1BLJA 2FCIA 2HDXA 4LUEA 3VS3A 2RVFA 1SHDA 1I3ZA 1FU5A 4DGPA 2EKXA 2B3OA 1LCJA 1BG1A 3MAZA 2EO6A 5IBMA 3VRNA 1KA6A 1QADA 1AYCA 5DC0B 3PFVA 4OHLA 4P9VA 3VRPA 4M4ZA 1MILA 1O4FA 1BFIA 1RQQC 1D4WA 4U1PA 1CWDL 2XP1A 1A08A 2GE9A 2Y1MA 3HCKA 3EACA 1O4DA 4K44A 5IBSA 2OQ1A 1SHBA 1FBVA 1O41A 2IUIA 1JYQA 5D0JA 4GL9E 4E93A 2PLDA 4TZIA 1AYAA 3MXCA 1GHUA 1B47A 3BUWB 3HIZB 3K2MA 1BHHB 1ZFPE 5HKYA 1O45A 1NZLA 3GXXA 1PICA 1AYDA 4U17A 1LUIA 3IN7A 2RORA 5AXIA 1BLKA 2YU7A 1O4NA 3OB2B 2HDVA 2RMXA 1LKLA 5EG3B 2AUGA 1AOUF 1BF5A 1YVLA 5GJHA 2CS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OHD A;  1JU5 A;  3CXL A;  2DM0 A;  2EL8 A;  4QSY A;  1O4A A;  2EO3 A;  2LNW A;  2CI9 A;  1O4O A;  3TKZ A;  2CBL A;  4H34 A;  4NWG A;  2H8H A;  4GPL B;  1XA6 A;  2MC1 A;  2LCT A;  2MQI A;  3T04 A;  3UYO A;  1O43 A;  4FL3 A;  5BO4 A;  1IS0 A;  5DC9 A;  5EHR A;  1O4G A;  3PSJ A;  4FBN A;  1HCT B;  3N8M A;  4FL2 A;  3VS1 A;  2LQN A;  2K79 B;  2EYY A;  2IZV A;  3MXY A;  1AYB A;  1BMB A;  2IUH A;  3VRQ A;  1O4H A;  4A4C A;  2PNB A;  1BKM A;  3OV1 A;  2EU0 A;  1F2F A;  1SPR A;  1TCE A;  2HMH A;  1FMK A;  2C0O A;  2Y1N A;  2PNA A;  1HCS B;  3GQI B;  3CWG A;  3S8L A;  3VRY A;  3NHN A;  2LNX A;  2JYQ A;  5KAZ A;  3S8N A;  1NRV A;  1R1Q A;  1X27 A;  1A1B A;  1O4J A;  5GJI A;  1JWO A;  5AUL A;  1GRI A;  2MK2 A;  3WA4 A;  1JYR A;  1A1C A;  4GWF A;  2CR4 A;  2RSY A;  2K7A B;  1O48 A;  3BUO B;  3OP0 A;  2AOA A;  2MRK A;  3M7F A;  4NWF A;  5CDW A;  1NZV A;  1AD5 A;  2OZO A;  2SHP A;  1F1W A;  1BHF A;  2AOB A;  3QWY A;  2DCR A;  1A07 A;  2PLE A;  3IMJ A;  1CSY A;  3OB1 B;  2L6K A;  4JEG A;  1BFJ A;  1LUK A;  4XZ0 A;  1O4E A;  2HUW A;  4XZ1 A;  4F5A A;  4LUD A;  3US4 A;  4EY0 A;  1CJ1 A;  1LUN A;  1FBZ A;  1Y57 A;  3PJP A;  4A4B A;  1OPK A;  5DC4 A;  2YSX A;  2DLY A;  1R1S A;  3CBL A;  1SPS A;  2C0I A;  3S9K A;  2DLZ A;  1SKJ A;  1Z3K A;  1A09 A;  2DVJ A;  4K45 A;  1QCF A;  4K11 A;  3VRZ A;  1O4M A;  4H1O A;  1M61 A;  3VRO A;  1O42 A;  2EOB A;  5EEL A;  3GXW A;  4F59 A;  5J3X A;  2BBU A;  2VIF A;  1K9A A;  2PTK A;  2QMS A;  1O49 A;  4JGH A;  1FU6 A;  1UUS A;  1P13 A;  3VS0 A;  2MRJ A;  1O4R A;  3HHM B;  2EYZ A;  3KFJ A;  1D4T A;  3CD3 A;  2CI8 A;  1OO4 A;  4WWQ A;  3IMD A;  3OVE A;  2ECD A;  3N7Y A;  2KK6 A;  2LQW A;  4DGX A;  1A81 A;  5EEQ A;  4E68 A;  1TZE E;  1OPL A;  1O44 A;  4L1B B;  2KNO A;  1LKK A;  5HKZ A;  1RPY A;  3BUX B;  4F5B A;  1LCK A;  2C9W A;  1O4B A;  4ROJ A;  1O46 A;  1KSW A;  5HKW A;  2ABL A;  3IN8 A;  1O4K A;  2FO0 A;  1X0N A;  1FHS A;  3ZNI A;  1BKL A;  3QWX X;  2H46 E;  2L4K A;  1SHA A;  1R1P A;  3PLF B;  4OHE A;  3BUM B;  1D1Z A;  2C0T A;  1A1E A;  2CIA A;  1BM2 A;  1KA7 A;  2Y3A B;  3BKB A;  2H5K A;  2HCK A;  4EIH A;  2DX0 A;  1WQU A;  3TL0 A;  3VS7 A;  1G83 A;  3S8O A;  2GSB A;  1UUR A;  1A1A A;  3PQZ A;  1O4Q A;  1BHH A;  4OHH A;  1MW4 A;  1RJA A;  4OHI A;  5EHP A;  1M27 A;  1AOT F;  3VGO A;  1AB2 A;  2ETZ A;  4K2R A;  3EAZ A;  2EYV A;  2IUG A;  2CRH A;  1O4L A;  1OO3 A;  4X6S A;  1H9O A;  5DF6 A;  2SRC A;  3VS6 A;  3C7I A;  3VRR A;  1O4I A;  1FYR A;  4D8K A;  3UF4 A;  1O4P A;  3PSK A;  1IJR A;  1LUM A;  1CWE A;  4P9Z A;  1CSZ A;  1O4C A;  3VS2 A;  3N84 A;  1JYU A;  1YVH A;  1O47 A;  5I6V A;  1QG1 E;  3VS4 A;  1Y1U A;  3PS5 A;  1KC2 A;  1X6C A;  2L3T A;  3VS5 A;  3BUN B;  4JE4 A;  1BLJ A;  2FCI A;  2HDX A;  4LUE A;  3VS3 A;  2RVF A;  1SHD A;  1I3Z A;  1FU5 A;  4DGP A;  2EKX A;  2B3O A;  1LCJ A;  1BG1 A;  3MAZ A;  2EO6 A;  5IBM A;  3VRN A;  1KA6 A;  1QAD A;  1AYC A;  5DC0 B;  3PFV A;  4OHL A;  4P9V A;  3VRP A;  4M4Z A;  1MIL A;  1O4F A;  1BFI A;  1RQQ C;  1D4W A;  4U1P A;  1CWD L;  2XP1 A;  1A08 A;  2GE9 A;  2Y1M A;  3HCK A;  3EAC A;  1O4D A;  4K44 A;  5IBS A;  2OQ1 A;  1SHB A;  1FBV A;  1O41 A;  2IUI A;  1JYQ A;  5D0J A;  4GL9 E;  4E93 A;  2PLD A;  4TZI A;  1AYA A;  3MXC A;  1GHU A;  1B47 A;  3BUW B;  3HIZ B;  3K2M A;  1BHH B;  1ZFP E;  5HKY A;  1O45 A;  1NZL A;  3GXX A;  1PIC A;  1AYD A;  4U17 A;  1LUI A;  3IN7 A;  2ROR A;  5AXI A;  1BLK A;  2YU7 A;  1O4N A;  3OB2 B;  2HDV A;  2RMX A;  1LKL A;  5EG3 B;  2AUG A;  1AOU F;  1BF5 A;  1YVL A;  5GJH A;  2CS0 A; 
#chains in the Genus database with same CATH topology
 4OHD A;  1JU5 A;  3CXL A;  2DM0 A;  2EL8 A;  4QSY A;  1O4A A;  2EO3 A;  2LNW A;  2CI9 A;  1O4O A;  3TKZ A;  2CBL A;  4H34 A;  4NWG A;  2H8H A;  4GPL B;  1XA6 A;  2MC1 A;  2LCT A;  2MQI A;  3T04 A;  3UYO A;  1O43 A;  4FL3 A;  5BO4 A;  1IS0 A;  5DC9 A;  5EHR A;  1O4G A;  3PSJ A;  4FBN A;  1HCT B;  3N8M A;  4FL2 A;  3VS1 A;  2LQN A;  2K79 B;  2EYY A;  2IZV A;  3MXY A;  1AYB A;  1BMB A;  2IUH A;  3VRQ A;  1O4H A;  4A4C A;  2PNB A;  1BKM A;  3OV1 A;  2EU0 A;  1F2F A;  1SPR A;  1TCE A;  2HMH A;  1FMK A;  2C0O A;  2Y1N A;  2PNA A;  1HCS B;  3GQI B;  3CWG A;  3S8L A;  3VRY A;  3NHN A;  2LNX A;  2JYQ A;  2KGY A;  5KAZ A;  3S8N A;  1NRV A;  1R1Q A;  1X27 A;  1A1B A;  1O4J A;  5GJI A;  1JWO A;  5AUL A;  1GRI A;  2MK2 A;  3WA4 A;  1JYR A;  1A1C A;  4GWF A;  2CR4 A;  2RSY A;  2K7A B;  1O48 A;  3BUO B;  3OP0 A;  2AOA A;  2MRK A;  3M7F A;  4NWF A;  5CDW A;  1NZV A;  1AD5 A;  2OZO A;  2SHP A;  1F1W A;  1BHF A;  2AOB A;  3QWY A;  2DCR A;  1A07 A;  2PLE A;  3IMJ A;  1CSY A;  3OB1 B;  2L6K A;  4JEG A;  1BFJ A;  1LUK A;  4XZ0 A;  1O4E A;  2HUW A;  4XZ1 A;  4F5A A;  4LUD A;  3US4 A;  4EY0 A;  1CJ1 A;  1LUN A;  1FBZ A;  1Y57 A;  3PJP A;  4A4B A;  1OPK A;  5DC4 A;  2YSX A;  2DLY A;  1R1S A;  3CBL A;  1SPS A;  2C0I A;  3S9K A;  2DLZ A;  1SKJ A;  1Z3K A;  1A09 A;  2DVJ A;  4K45 A;  1QCF A;  4K11 A;  3VRZ A;  1O4M A;  4H1O A;  1M61 A;  3VRO A;  1O42 A;  2EOB A;  5EEL A;  3GXW A;  4F59 A;  5J3X A;  2BBU A;  2VIF A;  1K9A A;  2PTK A;  2QMS A;  1O49 A;  4JGH A;  1FU6 A;  1UUS A;  1P13 A;  3VS0 A;  2MRJ A;  1O4R A;  3HHM B;  2EYZ A;  3KFJ A;  1D4T A;  3CD3 A;  2CI8 A;  1OO4 A;  4WWQ A;  3IMD A;  3OVE A;  2ECD A;  3N7Y A;  2KK6 A;  2LQW A;  4DGX A;  1A81 A;  5EEQ A;  4E68 A;  1TZE E;  1OPL A;  1O44 A;  4L1B B;  2KNO A;  1LKK A;  5HKZ A;  1RPY A;  3BUX B;  4F5B A;  1LCK A;  2C9W A;  1O4B A;  4ROJ A;  1O46 A;  1KSW A;  5HKW A;  2ABL A;  3IN8 A;  1O4K A;  2FO0 A;  1X0N A;  1FHS A;  3ZNI A;  1BKL A;  3QWX X;  2H46 E;  2L4K A;  1SHA A;  1R1P A;  3PLF B;  4OHE A;  3BUM B;  1D1Z A;  3LYV A;  2C0T A;  1A1E A;  2CIA A;  1BM2 A;  1KA7 A;  2Y3A B;  3BKB A;  2H5K A;  2HCK A;  4EIH A;  2DX0 A;  1WQU A;  3TL0 A;  3VS7 A;  1G83 A;  3S8O A;  2GSB A;  1UUR A;  1A1A A;  3PQZ A;  1O4Q A;  1BHH A;  4OHH A;  1MW4 A;  1RJA A;  2LRA A;  4OHI A;  5EHP A;  1M27 A;  1AOT F;  3VGO A;  1AB2 A;  2ETZ A;  4K2R A;  3EAZ A;  2EYV A;  2IUG A;  2CRH A;  1O4L A;  1OO3 A;  4X6S A;  1H9O A;  5DF6 A;  2SRC A;  3VS6 A;  3C7I A;  3VRR A;  1O4I A;  1FYR A;  4D8K A;  3UF4 A;  1O4P A;  3PSK A;  1IJR A;  1LUM A;  1CWE A;  4P9Z A;  1CSZ A;  1O4C A;  3VS2 A;  3N84 A;  1JYU A;  1YVH A;  1O47 A;  5I6V A;  3K2T A;  1QG1 E;  3VS4 A;  1Y1U A;  3PS5 A;  1KC2 A;  1X6C A;  2L3T A;  3VS5 A;  3BUN B;  4JE4 A;  1BLJ A;  2FCI A;  2HDX A;  4LUE A;  3VS3 A;  2RVF A;  1SHD A;  1I3Z A;  1FU5 A;  4DGP A;  2EKX A;  2B3O A;  1LCJ A;  1BG1 A;  3MAZ A;  2EO6 A;  5IBM A;  3VRN A;  1KA6 A;  1QAD A;  1AYC A;  5DC0 B;  3PFV A;  4OHL A;  4P9V A;  3VRP A;  4M4Z A;  1MIL A;  1O4F A;  1BFI A;  1RQQ C;  1D4W A;  4U1P A;  1CWD L;  2XP1 A;  1A08 A;  2GE9 A;  2Y1M A;  3HCK A;  3EAC A;  1O4D A;  4K44 A;  5IBS A;  2OQ1 A;  1SHB A;  1FBV A;  1O41 A;  2IUI A;  1JYQ A;  5D0J A;  4GL9 E;  4E93 A;  2PLD A;  4TZI A;  1AYA A;  3MXC A;  1GHU A;  1B47 A;  3BUW B;  3HIZ B;  3K2M A;  1BHH B;  1ZFP E;  5HKY A;  1O45 A;  1NZL A;  3GXX A;  1PIC A;  1AYD A;  4U17 A;  1LUI A;  3IN7 A;  2ROR A;  5AXI A;  1BLK A;  2YU7 A;  1O4N A;  3OB2 B;  2HDV A;  2RMX A;  1LKL A;  5EG3 B;  2AUG A;  1AOU F;  1BF5 A;  1YVL A;  5GJH A;  2CS0 A; 
#chains in the Genus database with same CATH homology
 4OHD A;  1JU5 A;  3CXL A;  2DM0 A;  2EL8 A;  4QSY A;  1O4A A;  2EO3 A;  2LNW A;  2CI9 A;  1O4O A;  3TKZ A;  2CBL A;  4H34 A;  4NWG A;  2H8H A;  4GPL B;  1XA6 A;  2MC1 A;  2LCT A;  2MQI A;  3T04 A;  3UYO A;  1O43 A;  4FL3 A;  5BO4 A;  1IS0 A;  5DC9 A;  5EHR A;  1O4G A;  3PSJ A;  4FBN A;  1HCT B;  3N8M A;  4FL2 A;  3VS1 A;  2LQN A;  2K79 B;  2EYY A;  2IZV A;  3MXY A;  1AYB A;  1BMB A;  2IUH A;  3VRQ A;  1O4H A;  4A4C A;  2PNB A;  1BKM A;  3OV1 A;  2EU0 A;  1F2F A;  1SPR A;  1TCE A;  2HMH A;  1FMK A;  2C0O A;  2Y1N A;  2PNA A;  1HCS B;  3GQI B;  3CWG A;  3S8L A;  3VRY A;  3NHN A;  2LNX A;  2JYQ A;  5KAZ A;  3S8N A;  1NRV A;  1R1Q A;  1X27 A;  1A1B A;  1O4J A;  5GJI A;  1JWO A;  5AUL A;  1GRI A;  2MK2 A;  3WA4 A;  1JYR A;  1A1C A;  4GWF A;  2CR4 A;  2RSY A;  2K7A B;  1O48 A;  3BUO B;  3OP0 A;  2AOA A;  2MRK A;  3M7F A;  4NWF A;  5CDW A;  1NZV A;  1AD5 A;  2OZO A;  2SHP A;  1F1W A;  1BHF A;  2AOB A;  3QWY A;  2DCR A;  1A07 A;  2PLE A;  3IMJ A;  1CSY A;  3OB1 B;  2L6K A;  4JEG A;  1BFJ A;  1LUK A;  4XZ0 A;  1O4E A;  2HUW A;  4XZ1 A;  4F5A A;  4LUD A;  3US4 A;  4EY0 A;  1CJ1 A;  1LUN A;  1FBZ A;  1Y57 A;  3PJP A;  4A4B A;  1OPK A;  5DC4 A;  2YSX A;  2DLY A;  1R1S A;  3CBL A;  1SPS A;  2C0I A;  3S9K A;  2DLZ A;  1SKJ A;  1Z3K A;  1A09 A;  2DVJ A;  4K45 A;  1QCF A;  4K11 A;  3VRZ A;  1O4M A;  4H1O A;  1M61 A;  3VRO A;  1O42 A;  2EOB A;  5EEL A;  3GXW A;  4F59 A;  5J3X A;  2BBU A;  2VIF A;  1K9A A;  2PTK A;  2QMS A;  1O49 A;  4JGH A;  1FU6 A;  1UUS A;  1P13 A;  3VS0 A;  2MRJ A;  1O4R A;  3HHM B;  2EYZ A;  3KFJ A;  1D4T A;  3CD3 A;  2CI8 A;  1OO4 A;  4WWQ A;  3IMD A;  3OVE A;  2ECD A;  3N7Y A;  2KK6 A;  2LQW A;  4DGX A;  1A81 A;  5EEQ A;  4E68 A;  1TZE E;  1OPL A;  1O44 A;  4L1B B;  2KNO A;  1LKK A;  5HKZ A;  1RPY A;  3BUX B;  4F5B A;  1LCK A;  2C9W A;  1O4B A;  4ROJ A;  1O46 A;  1KSW A;  5HKW A;  2ABL A;  3IN8 A;  1O4K A;  2FO0 A;  1X0N A;  1FHS A;  3ZNI A;  1BKL A;  3QWX X;  2H46 E;  2L4K A;  1SHA A;  1R1P A;  3PLF B;  4OHE A;  3BUM B;  1D1Z A;  2C0T A;  1A1E A;  2CIA A;  1BM2 A;  1KA7 A;  2Y3A B;  3BKB A;  2H5K A;  2HCK A;  4EIH A;  2DX0 A;  1WQU A;  3TL0 A;  3VS7 A;  1G83 A;  3S8O A;  2GSB A;  1UUR A;  1A1A A;  3PQZ A;  1O4Q A;  1BHH A;  4OHH A;  1MW4 A;  1RJA A;  4OHI A;  5EHP A;  1M27 A;  1AOT F;  3VGO A;  1AB2 A;  2ETZ A;  4K2R A;  3EAZ A;  2EYV A;  2IUG A;  2CRH A;  1O4L A;  1OO3 A;  4X6S A;  1H9O A;  5DF6 A;  2SRC A;  3VS6 A;  3C7I A;  3VRR A;  1O4I A;  1FYR A;  4D8K A;  3UF4 A;  1O4P A;  3PSK A;  1IJR A;  1LUM A;  1CWE A;  4P9Z A;  1CSZ A;  1O4C A;  3VS2 A;  3N84 A;  1JYU A;  1YVH A;  1O47 A;  5I6V A;  1QG1 E;  3VS4 A;  1Y1U A;  3PS5 A;  1KC2 A;  1X6C A;  2L3T A;  3VS5 A;  3BUN B;  4JE4 A;  1BLJ A;  2FCI A;  2HDX A;  4LUE A;  3VS3 A;  2RVF A;  1SHD A;  1I3Z A;  1FU5 A;  4DGP A;  2EKX A;  2B3O A;  1LCJ A;  1BG1 A;  3MAZ A;  2EO6 A;  5IBM A;  3VRN A;  1KA6 A;  1QAD A;  1AYC A;  5DC0 B;  3PFV A;  4OHL A;  4P9V A;  3VRP A;  4M4Z A;  1MIL A;  1O4F A;  1BFI A;  1RQQ C;  1D4W A;  4U1P A;  1CWD L;  2XP1 A;  1A08 A;  2GE9 A;  2Y1M A;  3HCK A;  3EAC A;  1O4D A;  4K44 A;  5IBS A;  2OQ1 A;  1SHB A;  1FBV A;  1O41 A;  2IUI A;  1JYQ A;  5D0J A;  4GL9 E;  4E93 A;  2PLD A;  4TZI A;  1AYA A;  3MXC A;  1GHU A;  1B47 A;  3BUW B;  3HIZ B;  3K2M A;  1BHH B;  1ZFP E;  5HKY A;  1O45 A;  1NZL A;  3GXX A;  1PIC A;  1AYD A;  4U17 A;  1LUI A;  3IN7 A;  2ROR A;  5AXI A;  1BLK A;  2YU7 A;  1O4N A;  3OB2 B;  2HDV A;  2RMX A;  1LKL A;  5EG3 B;  2AUG A;  1AOU F;  1BF5 A;  1YVL A;  5GJH A;  2CS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...