3HCKA

Nmr ensemble of the uncomplexed human hck sh2 domain, 20 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
107
structure length
107
Chain Sequence
METEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVPCMSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HCK SH2
publication title Sequential assignment and secondary structure determination for the Src homology 2 domain of hematopoietic cellular kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 107
sequence length 107
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1997-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3hckA00
3OB1B 1AOUF 1O43A 1X27A 3VS7A 3MXYA 1O4EA 2L3TA 1AYCA 2Y1MA 2EYYA 1A81A 2EOBA 1OPLA 2IUHA 1LCKA 1GHUA 1D1ZA 1O4AA 4EY0A 2OQ1A 1LUNA 1O45A 2GE9A 4K11A 3OV1A 1Y57A 4F5BA 1FBVA 1KA7A 1P13A 2FO0A 4L1BB 1YVLA 2MC1A 3PSJA 2IUIA 2MQIA 2KK6A 3PS5A 1F2FA 2C0TA 2H8HA 5EELA 3N8MA 1AB2A 4EIHA 1GRIA 2CI8A 2DVJA 2HDVA 2VIFA 4FL2A 2MRJA 5D0JA 1K9AA 1BHFA 1Z3KA 2LNXA 3VS2A 1JYQA 2LNWA 2K79B 4NWGA 3TKZA 2RMXA 3CWGA 4K45A 3HHMB 1I3ZA 1AYBA 2CI9A 3VRQA 2RSYA 1NZLA 4XZ0A 2IUGA 1CSZA 3KFJA 1G83A 1O4FA 1R1PA 4FL3A 2EO3A 4OHDA 1O42A 2YU7A 2C0IA 1KC2A 1X0NA 1H9OA 3BUXB 1D4TA 2BBUA 5CDWA 2H5KA 3VGOA 1O4DA 3IMDA 1A09A 2CBLA 2PNAA 2EL8A 3VRZA 3WA4A 1QG1E 2K7AB 1A08A 1Y1UA 4NWFA 1O4RA 1O4JA 1SHDA 1O4MA 2HMHA 4F59A 5BO4A 4P9ZA 3S9KA 1B47A 2ECDA 1O4HA 3VS0A 5DC4A 2RORA 1A07A 1O4OA 5IBMA 1AYAA 3VS4A 1XA6A 3VS5A 1F1WA 1BHHB 1YVHA 5HKYA 2EO6A 1PICA 4H34A 3VRRA 3HIZB 3PLFB 5I6VA 2LQWA 1OPKA 2EU0A 1IJRA 1LUMA 1BG1A 2AOAA 1O4NA 1UURA 2HUWA 1KA6A 2KNOA 1CJ1A 3TL0A 1TZEE 2QMSA 4FBNA 3VS3A 4D8KA 2DLZA 4H1OA 4ROJA 1A1EA 4E68A 3QWXX 4U1PA 5EHPA 1LUKA 3N7YA 1MILA 1OO4A 3CD3A 2ABLA 3C7IA 3S8LA 2DM0A 3MXCA 2SHPA 1O49A 2PLDA 2EYZA 4TZIA 1X6CA 3UYOA 2ETZA 5DC9A 1M27A 1O47A 1UUSA 3HCKA 5IBSA 4GL9E 1O41A 4JEGA 5HKWA 1JYRA 1O46A 1O4PA 1FBZA 4E93A 2RVFA 3M7FA 3S8NA 3CXLA 3OP0A 3PQZA 2C0OA 4LUDA 1O4IA 3BUWB 3MAZA 4GWFA 3VROA 1FHSA 4OHIA 4K2RA 2C9WA 1SPRA 4GPLB 1O4GA 3CBLA 3IN7A 4A4CA 5AULA 4XZ1A 1A1CA 1IS0A 3VS6A 3GXXA 4A4BA 2AOBA 1BKMA 1O4KA 4QSYA 3IMJA 3EAZA 3PFVA 2LQNA 2B3OA 1AYDA 1JYUA 1BMBA 1FYRA 1RJAA 1WQUA 2Y3AB 1LUIA 2HCKA 3VRPA 4LUEA 3QWYA 1O4QA 1OO3A 1LCJA 4DGXA 5GJHA 3PJPA 1FU5A 1O4BA 3VS1A 2DCRA 5HKZA 1JWOA 2MRKA 3GXWA 1HCSB 1D4WA 1LKKA 1KSWA 1TCEA 1O48A 3OB2B 3UF4A 2YSXA 4JGHA 3VRYA 3BUMB 1R1QA 5AXIA 4JE4A 2CR4A 3NHNA 1AOTF 1BFJA 3PSKA 1QCFA 5KAZA 5EG3B 1A1AA 1QADA 1FU6A 2PNBA 4WWQA 2MK2A 1O4LA 1CSYA 1FMKA 2LCTA 1BLJA 3BUOB 2EKXA 3BUNB 2CS0A 3EACA 4OHHA 1RPYA 4P9VA 3N84A 3VRNA 3US4A 3IN8A 1BHHA 1BFIA 2H46E 1CWEA 1SHAA 1A1BA 5DF6A 5EHRA 1M61A 2DX0A 1SKJA 2PLEA 3OVEA 1AD5A 2EYVA 2Y1NA 4OHLA 2FCIA 1HCTB 5EEQA 3K2MA 5J3XA 1JU5A 4K44A 4X6SA 1SHBA 2SRCA 5GJIA 2XP1A 2L6KA 1O44A 1NRVA 1O4CA 1BM2A 2L4KA 3S8OA 2GSBA 1BLKA 3GQIB 1LKLA 3ZNIA 2IZVA 2CRHA 2OZOA 2HDXA 1R1SA 4DGPA 2AUGA 4F5AA 2JYQA 1BF5A 1ZFPE 1BKLA 1CWDL 1MW4A 1SPSA 5DC0B 1RQQC 4U17A 4OHEA 1NZVA 2PTKA 4M4ZA 2DLYA 2CIAA 3T04A 3BKBA
chains in the Genus database with same CATH superfamily
3OB1B 1AOUF 1O43A 1X27A 3VS7A 3MXYA 1O4EA 2L3TA 1AYCA 2Y1MA 2EYYA 1A81A 2EOBA 1OPLA 2IUHA 1LCKA 1GHUA 1D1ZA 1O4AA 4EY0A 2OQ1A 1LUNA 1O45A 2GE9A 4K11A 3OV1A 1Y57A 4F5BA 1FBVA 1KA7A 1P13A 2FO0A 4L1BB 1YVLA 2MC1A 3PSJA 2IUIA 2MQIA 2KK6A 3PS5A 1F2FA 2C0TA 2KGYA 2H8HA 5EELA 3N8MA 1AB2A 4EIHA 1GRIA 2CI8A 2LRAA 2DVJA 2HDVA 2VIFA 4FL2A 2MRJA 5D0JA 1K9AA 1BHFA 1Z3KA 2LNXA 3VS2A 1JYQA 2LNWA 2K79B 4NWGA 3TKZA 2RMXA 3CWGA 4K45A 3HHMB 1I3ZA 1AYBA 2CI9A 3VRQA 2RSYA 1NZLA 4XZ0A 2IUGA 1CSZA 3KFJA 1G83A 1O4FA 1R1PA 4FL3A 2EO3A 4OHDA 1O42A 2YU7A 2C0IA 1KC2A 1X0NA 1H9OA 3BUXB 1D4TA 2BBUA 5CDWA 2H5KA 3VGOA 1O4DA 3IMDA 1A09A 2CBLA 2PNAA 2EL8A 3VRZA 3WA4A 1QG1E 2K7AB 1A08A 1Y1UA 4NWFA 1O4RA 1O4JA 1SHDA 1O4MA 2HMHA 4F59A 5BO4A 4P9ZA 3S9KA 1B47A 2ECDA 1O4HA 3VS0A 5DC4A 2RORA 1A07A 1O4OA 5IBMA 1AYAA 3VS4A 1XA6A 3VS5A 1F1WA 1BHHB 1YVHA 5HKYA 2EO6A 1PICA 4H34A 3VRRA 3HIZB 3PLFB 5I6VA 2LQWA 1OPKA 2EU0A 1IJRA 1LUMA 1BG1A 2AOAA 1O4NA 1UURA 2HUWA 1KA6A 2KNOA 1CJ1A 3TL0A 1TZEE 2QMSA 4FBNA 3VS3A 4D8KA 2DLZA 4H1OA 4ROJA 1A1EA 4E68A 3QWXX 4U1PA 5EHPA 1LUKA 3N7YA 1MILA 1OO4A 3CD3A 2ABLA 3C7IA 3S8LA 2DM0A 3MXCA 3LYVA 2SHPA 1O49A 2PLDA 2EYZA 4TZIA 1X6CA 3UYOA 2ETZA 5DC9A 1M27A 1O47A 1UUSA 3HCKA 5IBSA 4GL9E 1O41A 4JEGA 5HKWA 1JYRA 1O46A 1O4PA 1FBZA 4E93A 2RVFA 3M7FA 3S8NA 3CXLA 3OP0A 3PQZA 2C0OA 4LUDA 1O4IA 3BUWB 3MAZA 4GWFA 3VROA 1FHSA 4OHIA 4K2RA 2C9WA 1SPRA 4GPLB 1O4GA 3CBLA 3IN7A 4A4CA 5AULA 4XZ1A 1A1CA 1IS0A 3VS6A 3GXXA 4A4BA 2AOBA 1BKMA 1O4KA 4QSYA 3IMJA 3EAZA 3PFVA 2LQNA 2B3OA 1AYDA 1JYUA 1BMBA 1FYRA 1RJAA 1WQUA 2Y3AB 1LUIA 2HCKA 3VRPA 4LUEA 3QWYA 1O4QA 1OO3A 1LCJA 4DGXA 5GJHA 3PJPA 1FU5A 1O4BA 3VS1A 2DCRA 5HKZA 1JWOA 2MRKA 3GXWA 1HCSB 1D4WA 1LKKA 1KSWA 1TCEA 1O48A 3OB2B 3UF4A 2YSXA 4JGHA 3VRYA 3BUMB 1R1QA 5AXIA 4JE4A 2CR4A 3NHNA 1AOTF 3K2TA 1BFJA 3PSKA 1QCFA 5KAZA 5EG3B 1A1AA 1QADA 1FU6A 2PNBA 4WWQA 2MK2A 1O4LA 1CSYA 1FMKA 2LCTA 1BLJA 3BUOB 2EKXA 3BUNB 2CS0A 3EACA 4OHHA 1RPYA 4P9VA 3N84A 3VRNA 3US4A 3IN8A 1BHHA 1BFIA 2H46E 1CWEA 1SHAA 1A1BA 5DF6A 5EHRA 1M61A 2DX0A 1SKJA 2PLEA 3OVEA 1AD5A 2EYVA 2Y1NA 4OHLA 2FCIA 1HCTB 5EEQA 3K2MA 5J3XA 1JU5A 4K44A 4X6SA 1SHBA 2SRCA 5GJIA 2XP1A 2L6KA 1O44A 1NRVA 1O4CA 1BM2A 2L4KA 3S8OA 2GSBA 1BLKA 3GQIB 1LKLA 3ZNIA 2IZVA 2CRHA 2OZOA 2HDXA 1R1SA 4DGPA 2AUGA 4F5AA 2JYQA 1BF5A 1ZFPE 1BKLA 1CWDL 1MW4A 1SPSA 5DC0B 1RQQC 4U17A 4OHEA 1NZVA 2PTKA 4M4ZA 2DLYA 2CIAA 3T04A 3BKBA
chains in the Genus database with same CATH topology
3OB1B 1AOUF 1O43A 1X27A 3VS7A 3MXYA 1O4EA 2L3TA 1AYCA 2Y1MA 2EYYA 1A81A 2EOBA 1OPLA 2IUHA 1LCKA 1GHUA 1D1ZA 1O4AA 4EY0A 2OQ1A 1LUNA 1O45A 2GE9A 4K11A 3OV1A 1Y57A 4F5BA 1FBVA 1KA7A 1P13A 2FO0A 4L1BB 1YVLA 2MC1A 3PSJA 2IUIA 2MQIA 2KK6A 3PS5A 1F2FA 2C0TA 2H8HA 5EELA 3N8MA 1AB2A 4EIHA 1GRIA 2CI8A 2DVJA 2HDVA 2VIFA 4FL2A 2MRJA 5D0JA 1K9AA 1BHFA 1Z3KA 2LNXA 3VS2A 1JYQA 2LNWA 2K79B 4NWGA 3TKZA 2RMXA 3CWGA 4K45A 3HHMB 1I3ZA 1AYBA 2CI9A 3VRQA 2RSYA 1NZLA 4XZ0A 2IUGA 1CSZA 3KFJA 1G83A 1O4FA 1R1PA 4FL3A 2EO3A 4OHDA 1O42A 2YU7A 2C0IA 1KC2A 1X0NA 1H9OA 3BUXB 1D4TA 2BBUA 5CDWA 2H5KA 3VGOA 1O4DA 3IMDA 1A09A 2CBLA 2PNAA 2EL8A 3VRZA 3WA4A 1QG1E 2K7AB 1A08A 1Y1UA 4NWFA 1O4RA 1O4JA 1SHDA 1O4MA 2HMHA 4F59A 5BO4A 4P9ZA 3S9KA 1B47A 2ECDA 1O4HA 3VS0A 5DC4A 2RORA 1A07A 1O4OA 5IBMA 1AYAA 3VS4A 1XA6A 3VS5A 1F1WA 1BHHB 1YVHA 5HKYA 2EO6A 1PICA 4H34A 3VRRA 3HIZB 3PLFB 5I6VA 2LQWA 1OPKA 2EU0A 1IJRA 1LUMA 1BG1A 2AOAA 1O4NA 1UURA 2HUWA 1KA6A 2KNOA 1CJ1A 3TL0A 1TZEE 2QMSA 4FBNA 3VS3A 4D8KA 2DLZA 4H1OA 4ROJA 1A1EA 4E68A 3QWXX 4U1PA 5EHPA 1LUKA 3N7YA 1MILA 1OO4A 3CD3A 2ABLA 3C7IA 3S8LA 2DM0A 3MXCA 2SHPA 1O49A 2PLDA 2EYZA 4TZIA 1X6CA 3UYOA 2ETZA 5DC9A 1M27A 1O47A 1UUSA 3HCKA 5IBSA 4GL9E 1O41A 4JEGA 5HKWA 1JYRA 1O46A 1O4PA 1FBZA 4E93A 2RVFA 3M7FA 3S8NA 3CXLA 3OP0A 3PQZA 2C0OA 4LUDA 1O4IA 3BUWB 3MAZA 4GWFA 3VROA 1FHSA 4OHIA 4K2RA 2C9WA 1SPRA 4GPLB 1O4GA 3CBLA 3IN7A 4A4CA 5AULA 4XZ1A 1A1CA 1IS0A 3VS6A 3GXXA 4A4BA 2AOBA 1BKMA 1O4KA 4QSYA 3IMJA 3EAZA 3PFVA 2LQNA 2B3OA 1AYDA 1JYUA 1BMBA 1FYRA 1RJAA 1WQUA 2Y3AB 1LUIA 2HCKA 3VRPA 4LUEA 3QWYA 1O4QA 1OO3A 1LCJA 4DGXA 5GJHA 3PJPA 1FU5A 1O4BA 3VS1A 2DCRA 5HKZA 1JWOA 2MRKA 3GXWA 1HCSB 1D4WA 1LKKA 1KSWA 1TCEA 1O48A 3OB2B 3UF4A 2YSXA 4JGHA 3VRYA 3BUMB 1R1QA 5AXIA 4JE4A 2CR4A 3NHNA 1AOTF 1BFJA 3PSKA 1QCFA 5KAZA 5EG3B 1A1AA 1QADA 1FU6A 2PNBA 4WWQA 2MK2A 1O4LA 1CSYA 1FMKA 2LCTA 1BLJA 3BUOB 2EKXA 3BUNB 2CS0A 3EACA 4OHHA 1RPYA 4P9VA 3N84A 3VRNA 3US4A 3IN8A 1BHHA 1BFIA 2H46E 1CWEA 1SHAA 1A1BA 5DF6A 5EHRA 1M61A 2DX0A 1SKJA 2PLEA 3OVEA 1AD5A 2EYVA 2Y1NA 4OHLA 2FCIA 1HCTB 5EEQA 3K2MA 5J3XA 1JU5A 4K44A 4X6SA 1SHBA 2SRCA 5GJIA 2XP1A 2L6KA 1O44A 1NRVA 1O4CA 1BM2A 2L4KA 3S8OA 2GSBA 1BLKA 3GQIB 1LKLA 3ZNIA 2IZVA 2CRHA 2OZOA 2HDXA 1R1SA 4DGPA 2AUGA 4F5AA 2JYQA 1BF5A 1ZFPE 1BKLA 1CWDL 1MW4A 1SPSA 5DC0B 1RQQC 4U17A 4OHEA 1NZVA 2PTKA 4M4ZA 2DLYA 2CIAA 3T04A 3BKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OB1 B;  1AOU F;  1O43 A;  1X27 A;  3VS7 A;  3MXY A;  1O4E A;  2L3T A;  1AYC A;  2Y1M A;  2EYY A;  1A81 A;  2EOB A;  1OPL A;  2IUH A;  1LCK A;  1GHU A;  1D1Z A;  1O4A A;  4EY0 A;  2OQ1 A;  1LUN A;  1O45 A;  2GE9 A;  4K11 A;  3OV1 A;  1Y57 A;  4F5B A;  1FBV A;  1KA7 A;  1P13 A;  2FO0 A;  4L1B B;  1YVL A;  2MC1 A;  3PSJ A;  2IUI A;  2MQI A;  2KK6 A;  3PS5 A;  1F2F A;  2C0T A;  2H8H A;  5EEL A;  3N8M A;  1AB2 A;  4EIH A;  1GRI A;  2CI8 A;  2DVJ A;  2HDV A;  2VIF A;  4FL2 A;  2MRJ A;  5D0J A;  1K9A A;  1BHF A;  1Z3K A;  2LNX A;  3VS2 A;  1JYQ A;  2LNW A;  2K79 B;  4NWG A;  3TKZ A;  2RMX A;  3CWG A;  4K45 A;  3HHM B;  1I3Z A;  1AYB A;  2CI9 A;  3VRQ A;  2RSY A;  1NZL A;  4XZ0 A;  2IUG A;  1CSZ A;  3KFJ A;  1G83 A;  1O4F A;  1R1P A;  4FL3 A;  2EO3 A;  4OHD A;  1O42 A;  2YU7 A;  2C0I A;  1KC2 A;  1X0N A;  1H9O A;  3BUX B;  1D4T A;  2BBU A;  5CDW A;  2H5K A;  3VGO A;  1O4D A;  3IMD A;  1A09 A;  2CBL A;  2PNA A;  2EL8 A;  3VRZ A;  3WA4 A;  1QG1 E;  2K7A B;  1A08 A;  1Y1U A;  4NWF A;  1O4R A;  1O4J A;  1SHD A;  1O4M A;  2HMH A;  4F59 A;  5BO4 A;  4P9Z A;  3S9K A;  1B47 A;  2ECD A;  1O4H A;  3VS0 A;  5DC4 A;  2ROR A;  1A07 A;  1O4O A;  5IBM A;  1AYA A;  3VS4 A;  1XA6 A;  3VS5 A;  1F1W A;  1BHH B;  1YVH A;  5HKY A;  2EO6 A;  1PIC A;  4H34 A;  3VRR A;  3HIZ B;  3PLF B;  5I6V A;  2LQW A;  1OPK A;  2EU0 A;  1IJR A;  1LUM A;  1BG1 A;  2AOA A;  1O4N A;  1UUR A;  2HUW A;  1KA6 A;  2KNO A;  1CJ1 A;  3TL0 A;  1TZE E;  2QMS A;  4FBN A;  3VS3 A;  4D8K A;  2DLZ A;  4H1O A;  4ROJ A;  1A1E A;  4E68 A;  3QWX X;  4U1P A;  5EHP A;  1LUK A;  3N7Y A;  1MIL A;  1OO4 A;  3CD3 A;  2ABL A;  3C7I A;  3S8L A;  2DM0 A;  3MXC A;  2SHP A;  1O49 A;  2PLD A;  2EYZ A;  4TZI A;  1X6C A;  3UYO A;  2ETZ A;  5DC9 A;  1M27 A;  1O47 A;  1UUS A;  3HCK A;  5IBS A;  4GL9 E;  1O41 A;  4JEG A;  5HKW A;  1JYR A;  1O46 A;  1O4P A;  1FBZ A;  4E93 A;  2RVF A;  3M7F A;  3S8N A;  3CXL A;  3OP0 A;  3PQZ A;  2C0O A;  4LUD A;  1O4I A;  3BUW B;  3MAZ A;  4GWF A;  3VRO A;  1FHS A;  4OHI A;  4K2R A;  2C9W A;  1SPR A;  4GPL B;  1O4G A;  3CBL A;  3IN7 A;  4A4C A;  5AUL A;  4XZ1 A;  1A1C A;  1IS0 A;  3VS6 A;  3GXX A;  4A4B A;  2AOB A;  1BKM A;  1O4K A;  4QSY A;  3IMJ A;  3EAZ A;  3PFV A;  2LQN A;  2B3O A;  1AYD A;  1JYU A;  1BMB A;  1FYR A;  1RJA A;  1WQU A;  2Y3A B;  1LUI A;  2HCK A;  3VRP A;  4LUE A;  3QWY A;  1O4Q A;  1OO3 A;  1LCJ A;  4DGX A;  5GJH A;  3PJP A;  1FU5 A;  1O4B A;  3VS1 A;  2DCR A;  5HKZ A;  1JWO A;  2MRK A;  3GXW A;  1HCS B;  1D4W A;  1LKK A;  1KSW A;  1TCE A;  1O48 A;  3OB2 B;  3UF4 A;  2YSX A;  4JGH A;  3VRY A;  3BUM B;  1R1Q A;  5AXI A;  4JE4 A;  2CR4 A;  3NHN A;  1AOT F;  1BFJ A;  3PSK A;  1QCF A;  5KAZ A;  5EG3 B;  1A1A A;  1QAD A;  1FU6 A;  2PNB A;  4WWQ A;  2MK2 A;  1O4L A;  1CSY A;  1FMK A;  2LCT A;  1BLJ A;  3BUO B;  2EKX A;  3BUN B;  2CS0 A;  3EAC A;  4OHH A;  1RPY A;  4P9V A;  3N84 A;  3VRN A;  3US4 A;  3IN8 A;  1BHH A;  1BFI A;  2H46 E;  1CWE A;  1SHA A;  1A1B A;  5DF6 A;  5EHR A;  1M61 A;  2DX0 A;  1SKJ A;  2PLE A;  3OVE A;  1AD5 A;  2EYV A;  2Y1N A;  4OHL A;  2FCI A;  1HCT B;  5EEQ A;  3K2M A;  5J3X A;  1JU5 A;  4K44 A;  4X6S A;  1SHB A;  2SRC A;  5GJI A;  2XP1 A;  2L6K A;  1O44 A;  1NRV A;  1O4C A;  1BM2 A;  2L4K A;  3S8O A;  2GSB A;  1BLK A;  3GQI B;  1LKL A;  3ZNI A;  2IZV A;  2CRH A;  2OZO A;  2HDX A;  1R1S A;  4DGP A;  2AUG A;  4F5A A;  2JYQ A;  1BF5 A;  1ZFP E;  1BKL A;  1CWD L;  1MW4 A;  1SPS A;  5DC0 B;  1RQQ C;  4U17 A;  4OHE A;  1NZV A;  2PTK A;  4M4Z A;  2DLY A;  2CIA A;  3T04 A;  3BKB A; 
#chains in the Genus database with same CATH topology
 3OB1 B;  1AOU F;  1O43 A;  1X27 A;  3VS7 A;  3MXY A;  1O4E A;  2L3T A;  1AYC A;  2Y1M A;  2EYY A;  1A81 A;  2EOB A;  1OPL A;  2IUH A;  1LCK A;  1GHU A;  1D1Z A;  1O4A A;  4EY0 A;  2OQ1 A;  1LUN A;  1O45 A;  2GE9 A;  4K11 A;  3OV1 A;  1Y57 A;  4F5B A;  1FBV A;  1KA7 A;  1P13 A;  2FO0 A;  4L1B B;  1YVL A;  2MC1 A;  3PSJ A;  2IUI A;  2MQI A;  2KK6 A;  3PS5 A;  1F2F A;  2C0T A;  2KGY A;  2H8H A;  5EEL A;  3N8M A;  1AB2 A;  4EIH A;  1GRI A;  2CI8 A;  2LRA A;  2DVJ A;  2HDV A;  2VIF A;  4FL2 A;  2MRJ A;  5D0J A;  1K9A A;  1BHF A;  1Z3K A;  2LNX A;  3VS2 A;  1JYQ A;  2LNW A;  2K79 B;  4NWG A;  3TKZ A;  2RMX A;  3CWG A;  4K45 A;  3HHM B;  1I3Z A;  1AYB A;  2CI9 A;  3VRQ A;  2RSY A;  1NZL A;  4XZ0 A;  2IUG A;  1CSZ A;  3KFJ A;  1G83 A;  1O4F A;  1R1P A;  4FL3 A;  2EO3 A;  4OHD A;  1O42 A;  2YU7 A;  2C0I A;  1KC2 A;  1X0N A;  1H9O A;  3BUX B;  1D4T A;  2BBU A;  5CDW A;  2H5K A;  3VGO A;  1O4D A;  3IMD A;  1A09 A;  2CBL A;  2PNA A;  2EL8 A;  3VRZ A;  3WA4 A;  1QG1 E;  2K7A B;  1A08 A;  1Y1U A;  4NWF A;  1O4R A;  1O4J A;  1SHD A;  1O4M A;  2HMH A;  4F59 A;  5BO4 A;  4P9Z A;  3S9K A;  1B47 A;  2ECD A;  1O4H A;  3VS0 A;  5DC4 A;  2ROR A;  1A07 A;  1O4O A;  5IBM A;  1AYA A;  3VS4 A;  1XA6 A;  3VS5 A;  1F1W A;  1BHH B;  1YVH A;  5HKY A;  2EO6 A;  1PIC A;  4H34 A;  3VRR A;  3HIZ B;  3PLF B;  5I6V A;  2LQW A;  1OPK A;  2EU0 A;  1IJR A;  1LUM A;  1BG1 A;  2AOA A;  1O4N A;  1UUR A;  2HUW A;  1KA6 A;  2KNO A;  1CJ1 A;  3TL0 A;  1TZE E;  2QMS A;  4FBN A;  3VS3 A;  4D8K A;  2DLZ A;  4H1O A;  4ROJ A;  1A1E A;  4E68 A;  3QWX X;  4U1P A;  5EHP A;  1LUK A;  3N7Y A;  1MIL A;  1OO4 A;  3CD3 A;  2ABL A;  3C7I A;  3S8L A;  2DM0 A;  3MXC A;  3LYV A;  2SHP A;  1O49 A;  2PLD A;  2EYZ A;  4TZI A;  1X6C A;  3UYO A;  2ETZ A;  5DC9 A;  1M27 A;  1O47 A;  1UUS A;  3HCK A;  5IBS A;  4GL9 E;  1O41 A;  4JEG A;  5HKW A;  1JYR A;  1O46 A;  1O4P A;  1FBZ A;  4E93 A;  2RVF A;  3M7F A;  3S8N A;  3CXL A;  3OP0 A;  3PQZ A;  2C0O A;  4LUD A;  1O4I A;  3BUW B;  3MAZ A;  4GWF A;  3VRO A;  1FHS A;  4OHI A;  4K2R A;  2C9W A;  1SPR A;  4GPL B;  1O4G A;  3CBL A;  3IN7 A;  4A4C A;  5AUL A;  4XZ1 A;  1A1C A;  1IS0 A;  3VS6 A;  3GXX A;  4A4B A;  2AOB A;  1BKM A;  1O4K A;  4QSY A;  3IMJ A;  3EAZ A;  3PFV A;  2LQN A;  2B3O A;  1AYD A;  1JYU A;  1BMB A;  1FYR A;  1RJA A;  1WQU A;  2Y3A B;  1LUI A;  2HCK A;  3VRP A;  4LUE A;  3QWY A;  1O4Q A;  1OO3 A;  1LCJ A;  4DGX A;  5GJH A;  3PJP A;  1FU5 A;  1O4B A;  3VS1 A;  2DCR A;  5HKZ A;  1JWO A;  2MRK A;  3GXW A;  1HCS B;  1D4W A;  1LKK A;  1KSW A;  1TCE A;  1O48 A;  3OB2 B;  3UF4 A;  2YSX A;  4JGH A;  3VRY A;  3BUM B;  1R1Q A;  5AXI A;  4JE4 A;  2CR4 A;  3NHN A;  1AOT F;  3K2T A;  1BFJ A;  3PSK A;  1QCF A;  5KAZ A;  5EG3 B;  1A1A A;  1QAD A;  1FU6 A;  2PNB A;  4WWQ A;  2MK2 A;  1O4L A;  1CSY A;  1FMK A;  2LCT A;  1BLJ A;  3BUO B;  2EKX A;  3BUN B;  2CS0 A;  3EAC A;  4OHH A;  1RPY A;  4P9V A;  3N84 A;  3VRN A;  3US4 A;  3IN8 A;  1BHH A;  1BFI A;  2H46 E;  1CWE A;  1SHA A;  1A1B A;  5DF6 A;  5EHR A;  1M61 A;  2DX0 A;  1SKJ A;  2PLE A;  3OVE A;  1AD5 A;  2EYV A;  2Y1N A;  4OHL A;  2FCI A;  1HCT B;  5EEQ A;  3K2M A;  5J3X A;  1JU5 A;  4K44 A;  4X6S A;  1SHB A;  2SRC A;  5GJI A;  2XP1 A;  2L6K A;  1O44 A;  1NRV A;  1O4C A;  1BM2 A;  2L4K A;  3S8O A;  2GSB A;  1BLK A;  3GQI B;  1LKL A;  3ZNI A;  2IZV A;  2CRH A;  2OZO A;  2HDX A;  1R1S A;  4DGP A;  2AUG A;  4F5A A;  2JYQ A;  1BF5 A;  1ZFP E;  1BKL A;  1CWD L;  1MW4 A;  1SPS A;  5DC0 B;  1RQQ C;  4U17 A;  4OHE A;  1NZV A;  2PTK A;  4M4Z A;  2DLY A;  2CIA A;  3T04 A;  3BKB A; 
#chains in the Genus database with same CATH homology
 3OB1 B;  1AOU F;  1O43 A;  1X27 A;  3VS7 A;  3MXY A;  1O4E A;  2L3T A;  1AYC A;  2Y1M A;  2EYY A;  1A81 A;  2EOB A;  1OPL A;  2IUH A;  1LCK A;  1GHU A;  1D1Z A;  1O4A A;  4EY0 A;  2OQ1 A;  1LUN A;  1O45 A;  2GE9 A;  4K11 A;  3OV1 A;  1Y57 A;  4F5B A;  1FBV A;  1KA7 A;  1P13 A;  2FO0 A;  4L1B B;  1YVL A;  2MC1 A;  3PSJ A;  2IUI A;  2MQI A;  2KK6 A;  3PS5 A;  1F2F A;  2C0T A;  2H8H A;  5EEL A;  3N8M A;  1AB2 A;  4EIH A;  1GRI A;  2CI8 A;  2DVJ A;  2HDV A;  2VIF A;  4FL2 A;  2MRJ A;  5D0J A;  1K9A A;  1BHF A;  1Z3K A;  2LNX A;  3VS2 A;  1JYQ A;  2LNW A;  2K79 B;  4NWG A;  3TKZ A;  2RMX A;  3CWG A;  4K45 A;  3HHM B;  1I3Z A;  1AYB A;  2CI9 A;  3VRQ A;  2RSY A;  1NZL A;  4XZ0 A;  2IUG A;  1CSZ A;  3KFJ A;  1G83 A;  1O4F A;  1R1P A;  4FL3 A;  2EO3 A;  4OHD A;  1O42 A;  2YU7 A;  2C0I A;  1KC2 A;  1X0N A;  1H9O A;  3BUX B;  1D4T A;  2BBU A;  5CDW A;  2H5K A;  3VGO A;  1O4D A;  3IMD A;  1A09 A;  2CBL A;  2PNA A;  2EL8 A;  3VRZ A;  3WA4 A;  1QG1 E;  2K7A B;  1A08 A;  1Y1U A;  4NWF A;  1O4R A;  1O4J A;  1SHD A;  1O4M A;  2HMH A;  4F59 A;  5BO4 A;  4P9Z A;  3S9K A;  1B47 A;  2ECD A;  1O4H A;  3VS0 A;  5DC4 A;  2ROR A;  1A07 A;  1O4O A;  5IBM A;  1AYA A;  3VS4 A;  1XA6 A;  3VS5 A;  1F1W A;  1BHH B;  1YVH A;  5HKY A;  2EO6 A;  1PIC A;  4H34 A;  3VRR A;  3HIZ B;  3PLF B;  5I6V A;  2LQW A;  1OPK A;  2EU0 A;  1IJR A;  1LUM A;  1BG1 A;  2AOA A;  1O4N A;  1UUR A;  2HUW A;  1KA6 A;  2KNO A;  1CJ1 A;  3TL0 A;  1TZE E;  2QMS A;  4FBN A;  3VS3 A;  4D8K A;  2DLZ A;  4H1O A;  4ROJ A;  1A1E A;  4E68 A;  3QWX X;  4U1P A;  5EHP A;  1LUK A;  3N7Y A;  1MIL A;  1OO4 A;  3CD3 A;  2ABL A;  3C7I A;  3S8L A;  2DM0 A;  3MXC A;  2SHP A;  1O49 A;  2PLD A;  2EYZ A;  4TZI A;  1X6C A;  3UYO A;  2ETZ A;  5DC9 A;  1M27 A;  1O47 A;  1UUS A;  3HCK A;  5IBS A;  4GL9 E;  1O41 A;  4JEG A;  5HKW A;  1JYR A;  1O46 A;  1O4P A;  1FBZ A;  4E93 A;  2RVF A;  3M7F A;  3S8N A;  3CXL A;  3OP0 A;  3PQZ A;  2C0O A;  4LUD A;  1O4I A;  3BUW B;  3MAZ A;  4GWF A;  3VRO A;  1FHS A;  4OHI A;  4K2R A;  2C9W A;  1SPR A;  4GPL B;  1O4G A;  3CBL A;  3IN7 A;  4A4C A;  5AUL A;  4XZ1 A;  1A1C A;  1IS0 A;  3VS6 A;  3GXX A;  4A4B A;  2AOB A;  1BKM A;  1O4K A;  4QSY A;  3IMJ A;  3EAZ A;  3PFV A;  2LQN A;  2B3O A;  1AYD A;  1JYU A;  1BMB A;  1FYR A;  1RJA A;  1WQU A;  2Y3A B;  1LUI A;  2HCK A;  3VRP A;  4LUE A;  3QWY A;  1O4Q A;  1OO3 A;  1LCJ A;  4DGX A;  5GJH A;  3PJP A;  1FU5 A;  1O4B A;  3VS1 A;  2DCR A;  5HKZ A;  1JWO A;  2MRK A;  3GXW A;  1HCS B;  1D4W A;  1LKK A;  1KSW A;  1TCE A;  1O48 A;  3OB2 B;  3UF4 A;  2YSX A;  4JGH A;  3VRY A;  3BUM B;  1R1Q A;  5AXI A;  4JE4 A;  2CR4 A;  3NHN A;  1AOT F;  1BFJ A;  3PSK A;  1QCF A;  5KAZ A;  5EG3 B;  1A1A A;  1QAD A;  1FU6 A;  2PNB A;  4WWQ A;  2MK2 A;  1O4L A;  1CSY A;  1FMK A;  2LCT A;  1BLJ A;  3BUO B;  2EKX A;  3BUN B;  2CS0 A;  3EAC A;  4OHH A;  1RPY A;  4P9V A;  3N84 A;  3VRN A;  3US4 A;  3IN8 A;  1BHH A;  1BFI A;  2H46 E;  1CWE A;  1SHA A;  1A1B A;  5DF6 A;  5EHR A;  1M61 A;  2DX0 A;  1SKJ A;  2PLE A;  3OVE A;  1AD5 A;  2EYV A;  2Y1N A;  4OHL A;  2FCI A;  1HCT B;  5EEQ A;  3K2M A;  5J3X A;  1JU5 A;  4K44 A;  4X6S A;  1SHB A;  2SRC A;  5GJI A;  2XP1 A;  2L6K A;  1O44 A;  1NRV A;  1O4C A;  1BM2 A;  2L4K A;  3S8O A;  2GSB A;  1BLK A;  3GQI B;  1LKL A;  3ZNI A;  2IZV A;  2CRH A;  2OZO A;  2HDX A;  1R1S A;  4DGP A;  2AUG A;  4F5A A;  2JYQ A;  1BF5 A;  1ZFP E;  1BKL A;  1CWD L;  1MW4 A;  1SPS A;  5DC0 B;  1RQQ C;  4U17 A;  4OHE A;  1NZV A;  2PTK A;  4M4Z A;  2DLY A;  2CIA A;  3T04 A;  3BKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...