2OZOA

Autoinhibited intact human zap-70
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
612
structure length
545
Chain Sequence
PDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPNMDTSVFESPFSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRNLAARNVLLVNRHYAKISDFGLSKALGPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGGSALEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Inhibition of Tyrosine Kinase Activity of ZAP-70.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tyrosine-protein kinase ZAP-70
total genus 150
structure length 545
sequence length 612
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ozoA05
1.10.930.10 Mainly Alpha Orthogonal Bundle Syk Kinase; Chain A, domain 2 Syk Kinase; Chain A, domain 2 2ozoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ozoA04
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2ozoA03
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2ozoA01
3R7YA 1FPUA 4FT3A 2O8YA 4I92A 5FM2A 1GZOA 3RNIA 2R3IA 3DTCA 3KL8A 1YOLA 3R02A 4PDYA 1OUKA 1Q41A 4NTSA 3C0GA 1JWOA 4QTBA 1YWRA 5LCKA 4L6QA 2JEDA 3ZZEA 1UU9A 3HRBA 4AX8A 4O0UA 4F59A 4X2GA 1DM2A 3VQUA 5CEPA 5J1VA 1F2FA 1BG1A 4XP2A 1R1QA 2J0MB 4OW8A 4DLIA 3P7CA 2C6TA 4YSMA 3RMFA 3TKZA 4YHFA 5BO4A 2QO2A 3V8SA 1IG1A 5CSPA 3ZDUA 1ZOHA 4DLJA 3TZ7A 3SW7A 2BDWA 4FYNA 2FA2A 3F6XA 1ND4A 4LMNA 1ZZLA 4GFMA 2IW6A 5AIKA 2UZEA 5IQDA 3U51A 2ITTA 3O96A 3E63A 3IO7A 3MBLA 3PLAE 5L2QA 4WG3A 4LI5A 4UYNA 5HE3A 3R9DA 3F9NA 4MCVA 1YWNA 3VJNA 5D41A 2VTJA 2R5TA 3DCVA 4PDSA 2F4JA 2YM4A 3ZEWA 4BZDA 2WTJA 3RJCA 3ZTXA 4F6WA 2CKQA 3ORMA 4K2RA 3PSDA 4IW0A 4AZEA 1O4BA 3LCOA 3UP2A 1B38A 1BYGA 3LXKA 4WT6A 2HWOA 4TZRA 1YWVA 4M67A 4X3JA 2WMWA 2W1IA 2BAQA 5DEWA 2QR8A 4JI9A 4EHEA 2H9VA 3AD4A 4P7EA 1Q4LA 3ZSIA 4MK0A 3FLYA 3QUPA 4U8ZA 4G34A 3AT2A 2QOOA 4MD7E 2YLEA 1FU6A 1MQ4A 2GNFA 2IZSA 3HEGA 4FTKA 1ZYJA 3QRUA 4BCMA 4HNIA 1FYRA 3EFKA 2ETZA 3ORNA 4XJ0A 5E91A 2VX3A 3UMWA 3OWLA 4RA4A 4EWHA 5C01A 3QGYA 5KO1A 3FI8A 2AUHA 4FV1A 3R9RA 3LQ5A 1JKLA 2W9FB 4RA5A 1GNGA 4EK6A 2WQOA 1WMKA 4RRVA 1A9UA 3NW5A 4N70A 4RSSA 2HZ0A 3AQVA 4U41A 4XG8A 4AFEA 3PE2A 4QO9A 4ANSA 2XNPA 3BZ3A 1IR3A 3ORLA 3PA3A 3EFJA 1R1SA 3FZSA 4O0WA 4F9AA 3PVUA 5E8YA 3SXRA 3UJGA 5H8EA 3P79A 2JKKA 2H5KA 2Q0NA 3L9NA 2K79B 1KV1A 4M12A 4QMMA 4RIWB 4F7SA 3Q96A 4GG7A 4DT8A 4IVDA 5L6WL 2OXYA 3QC4A 3FZ1A 4BCQA 3BLQA 4YZ9A 4CXAA 3JR1A 4QSYA 1PXKA 2VN9A 2B9IA 3A61A 4MD9E 4USFA 1WBNA 1YQJA 4QP9A 4U44A 4BIEA 3FXZA 3OEFX 3JS2A 5JRQA 3BBWA 5H3QA 1Y6AA 3NCZA 2BFYA 4ASZA 4CZUA 4EOKA 5JSMA 3JPVA 1FMKA 3Q52A 4GG5A 3N9XA 3FXWA 5LWMA 3MB7A 3IMJA 4ZSEA 3N7YA 3BYSA 4R3RA 1M27A 1WVXA 3G51A 3H30A 2JITA 5DPVA 5CENA 4YTCA 4DEIA 5EQPA 1U54A 1V0BA 5IDPA 2QOLA 3I0QA 4IX6A 3QRKA 3T04A 1U5RA 2NRUA 3AD5A 1ATPE 4KS8A 4BY9E 3NX8A 4YHJA 3UMXA 3DKGA 4C62A 4FKLA 4QYEA 4LL5A 2EO6A 1QPEA 3LFNA 2Y4PA 3GU6A 4HCVA 2XM8A 3PY1A 1KE7A 5EDQA 3PSCA 5AAEA 2YIYA 1UV5A 4LGHA 2EB3A 1UU8A 3Q4TA 1URCA 2WTCA 4BI0A 3BUXB 5IA0A 2VWBA 4USDA 3MFRA 3BYUA 3DK3A 4E8AA 4O0TA 5L8LA 4L42A 4DGOA 3R28A 5BVFA 3Q6UA 2WU7A 3CJGA 1VEBA 3F5GA 1FVTA 4AT3A 3D2KA 4FKQA 3MVHA 1PMVA 1JOWB 4O7VA 2VTTA 3VUGA 4RVMA 2C9WA 4C4FA 1ZWSA 5IQEA 1GY3A 1A1CA 3SRVA 5EQYA 2JYQA 5JGAA 2YAAA 5E9EA 3A7FA 3C50A 3AT4A 1XWSA 2R3RA 2OIQA 4RJ4A 4WHZA 4YTIA 1BLXA 4YJNA 5I9UA 4AOJA 5LMKC 4ZZMA 4WWQA 1W98A 4C02A 1ERKA 3IN7A 4HYUA 1Q8UA 4X0MA 4K6ZA 3F3TA 3GC9A 3QD4A 4ZSGA 3DKCA 2ITQA 3IW5A 5BYYA 1AB2A 1BL6A 3GXLA 3Q4CA 2ITVA 3KKVA 4APCA 2VV9A 1M14A 3PSBA 3BX5A 5JFVA 3ZS5A 3OBJA 2Y3AB 2IVVA 4I93A 3AC1A 4TPTA 1O4OA 4ZTRA 2ZOQA 2H6DA 3ANQA 4ZTNA 2IZUA 4RIXA 2J5EA 4G3EA 1QPDA 1OKWA 1Q8TA 2G2IA 2QNJA 2Z7SA 3MA3A 4KIOA 4KIQA 5FRIA 1PKGA 2DWBA 1IA9A 2J2IB 4C36A 3BHTA 4FUXA 3HLLA 3ID6C 4ORKA 2WIHA 3UZPA 4LV5A 5E8SA 3ORZA 4GRBA 4RLLA 3WZJA 5HQ0A 3PXRA 4FKJA 1YOJA 3R71A 5HHWA 4EZ7A 3EQCA 2X4FA 1QADA 2B3OA 5AULA 3QTQA 2WELA 3RP9A 4O1PA 1PICA 3QX2A 3EN7A 5JZNA 4WG5A 5K4IA 5AP0A 4G5PA 4FSYA 5HKZA 3IPHA 2CKEA 3RWPA 3BRBA 4OTPA 4FEXA 3D2IA 3HP2A 5EOLA 2VTIA 3VUIA 1ZFPE 1SVHA 1URWA 2WMTA 4PL5A 4YJVA 5HKWA 3R21A 3ORKA 3ZHPC 4FZDB 3UYTA 4D1SA 3IW7A 5AR7A 4UZDA 1WBSA 4DYMA 1VYZA 3NVKI 4DH3A 3FUPA 5HBHA 1OIUA 1UU3A 1B39A 2PMIA 3R8VA 3LFBA 3UQGA 3WF5A 1D4WA 1VZOA 2XK7A 1OKVA 2WTVA 2GQGA 3RM6A 4QP2A 3G0EA 1IEPA 4L3JA 4C3FA 3VGOA 2C3KA 3TZ9A 2ETKA 5I9WA 4HCUA 4RIWA 4J52A 3VS0A 3WF7A 4FV2A 5AADA 5BUEA 2LQWA 2XYUA 4YO6A 3RHXA 4QYHA 5HTBA 5IQHA 4W4YA 1AGWA 2RFEA 1O6LA 4Q2AA 5EH0A 4LRJA 3KRXA 5AP7A 1GIHA 1OITA 2GU8A 3WIKA 2IUHA 3VBTA 4D8KA 5FDPA 4DBXA 1H8FA 1KC2A 4GT5A 1BI7A 3MPTA 4FT7A 3WZDA 5JEBA 2UZDA 1JLUE 4FTRA 4X6SA 2FUMA 1RJBA 2GNHA 2I40A 1S9IA 5ANEA 4NKAA 3VRZA 4RVTA 5C8NA 3FMDA 5AP5A 1JKKA 1K9AA 2F2UA 4XBUA 2V7AA 4ZOGA 2KULA 5K5XA 5H8BA 4WKQA 4BL1A 2WQMA 3VBXA 3DQWA 3PA5A 3QKMA 4U79A 1OIYA 2YM7A 4E6QA 3QWKA 3FZPA 4QQ5A 5A4LA 3I4BA 4J98A 4ZZNA 1H1PA 2YHVA 5AJQA 4JX3A 2XNGA 4KUJA 2H46E 4CTBA 4EOLA 5KZ0A 2RKUA 5CSHA 1PMEA 2X7GA 1FVRA 4K33A 5AUZA 5GNKA 2QI8A 4JRNA 4QNAA 4OHHA 4BTMA 2WB8A 4U7ZA 4YU2A 2VTRA 1U5QA 1Z5MA 1F0QA 3Q9WA 5EI6A 2V62A 3TNWA 3F61A 1OUYA 2C6LA 3O8TA 3U8WA 4HNFA 2OSCA 3EQBA 4FIJA 3RZBA 3WE4A 4F09A 5CF6A 4A4CA 5JK3A 2PVRA 2YIWA 4D4RA 2C4GA 3RK5A 4XMOA 1U46A 3S8LA 1M2QA 3F82A 3QTXA 4UEUA 3OXZA 4FTCA 4ZJJA 5M08A 4L68A 4C4IA 2PZRA 3RNYA 3MTFA 5DRDA 4FOBA 3RAHA 5BMSA 4OGRA 2BZKB 3TNHA 3LPBA 4JVGA 3FMNA 2EXCX 4UB7A 2UVYA 4R5YA 3MIYA 5IA3A 4AXAA 1BKLA 1CJ1A 5HVJA 4IADA 3VRPA 1MRVA 3E8DA 2CCHA 3ZC5A 1E9HA 4RBLA 5F20A 1AOUF 4PP9A 4OBQA 1LR4A 4FR4A 4MH7A 3RKBA 1UVRA 3EOCA 2R0UA 5ANIA 5JZJA 2HENA 3DQXA 1FGKA 3FY2A 3ZRMA 2BDJA 4O86A 3V51A 1P14A 2WU6A 4LQMA 4FA2A 1O4NA 3OG7A 3ZONA 4AF3A 1W8CA 4GIIA 2JKMA 2VZ6A 3QZIA 1ZARA 4CRLA 3DFCB 4E4MA 2MC1A 3G6GA 4XLVA 2OZAA 2RIOA 2F7ZE 4TYGA 3TL8A 4CNHA 4I4EA 1T45A 3UOLA 4XS2A 4KINA 4W9WA 5C1QB 2XKDA 4BICA 1GIJA 5BVNA 3VBVA 5HIEA 2A19B 4M14A 4EUUA 4TZIA 1U4DA 1GOLA 2IN6A 4G6NA 4JQEA 2PZPA 4IH8A 2YM3A 4JR7A 3DA6A 4MXCA 5KHWA 3CTJA 4DTAA 2BALA 4ENYA 4GYIA 1WVYA 1CTPE 5EW9A 4AG8A 4FSRA 2UW5A 3O0GA 1HCTB 1YRPA 4ITHA 4A7CA 1W0XC 1JAMA 5DA3A 5FGKA 2PULA 2OO8X 4RIOA 4GL9E 2CN5A 4CG8A 5AV4A 2QURA 2WTDA 2GTMA 2R9SA 2YDKA 3DKFA 4G3GA 3C51A 5HBJA 3FMKA 2AC3A 4GH2A 3M42A 5AR5A 2RMXA 1YVLA 3ZEPA 3I1AA 4KSPA 1OO3A 4IB0A 2B9JA 3LCTA 2EL8A 4H3QA 4I20A 3L1SA 4YTFA 2W4OA 5IDNA 1W84A 5KMOA 1LP4A 2XMYA 4O7RA 2IVTA 5AEPA 4EH8A 5HGIA 4E20A 3CP9A 5CZHA 2ZVAA 1JVPP 4NU1A 3EJ1A 5F95A 5J3XA 4IFGA 2W1HA 5KUPA 3II5A 4O7ZA 3CR0A 3QWJA 3TM0A 2HW6A 2L6KA 2VIFA 1YOMA 3KB7A 5GJHA 2UUEA 4UMRA 4XHKB 2XJ2A 4F7LA 3PRIA 1R1PA 4AOIA 4KB8A 5FWKK 4AWIA 3KN6A 3QC9A 4EK3A 5DYJA 3F5UA 3C0HA 4APPA 4FV5A 4YHTA 4GIHA 5H9BA 2RORA 1SKJA 4JG6A 1B47A 2RFSA 4ALVA 2JFMA 2Y1MA 5HVYA 4RFMA 4D4YA 4EOQA 3SX9A 4C7TA 3O8UA 4KIKB 5A6OA 3OROA 2QOQA 5DFPA 4E5WA 2DCRA 1RJAA 2W9ZB 3IW8A 3MFSA 4MVFA 5F4NA 3R8MA 3W33A 5B2MA 5CXHA 1JYRA 1SPSA 4P5QA 4HGLA 5EHYA 1I44A 3V8WA 3BHUA 1O46A 2PTKA 1JSUA 3TACA 5M4FA 5IH6A 3QL8A 2JD5A 4UXLA 4JDIA 3IDCA 1XBCA 2B55A 4C4JA 4C3RA 4NSTA 2RL5A 4U97A 4DFXE 1O45A 2QG7A 3HRFA 3HDMA 2C0IA 3OOMA 4DGNA 3DV3A 3OD6X 2DLYA 3K5UA 4G9CA 4D0XA 2E9NA 3NWWA 4H3PA 3FE3A 4Y5HA 1BF5A 3R1NA 3MESA 4BBMA 5HCXA 3ENHA 3C4WA 2P55A 4CYJA 5AM6A 4QMQA 5HX8A 4I41A 3HUBA 4F9YA 3OW3A 4U17A 2KTYA 2ITPA 3UYOA 2FSTX 5K0KA 4MX9A 4MWIA 2QODA 4E5BA 1WFCA 4WRSA 3LFFA 3C1XA 4X2NA 4E73A 4IBMA 4F99A 2WPAA 1BM2A 4OTFA 4NM7A 4JX7A 4TNDA 5ANOA 3ZUTA 2OQ1A 1KOBA 5L6OA 3W2QA 4E1ZA 3H10A 4A9UA 4P2KA 4DGGA 3AGMA 2RGPA 1BKXA 4X2KA 3FLWA 4GUEA 4YURA 4FNZA 3EMGA 1O4RA 4BGGA 2XF0A 5CAPA 3UQCA 2WZJA 3FMHA 3IONA 3UTOA 3TG1A 4FIHA 2OZAB 3QCYA 4LGGA 5CXZA 1Q8YA 1LCKA 3OB2B 3QBNA 4IAAA 4C34A 5BX0A 4QMUA 5KKRB 1OZ1A 2EXEA 3WI6A 4FICA 4CEGA 3EYHA 4BDBA 2DUVA 2V0DA 4A4LA 4YNOA 1OKZA 5E8UA 4FTLA 3CY2A 2HMHA 2R3HA 1H4LA 3GB2A 2XS0A 4TKSA 5CNOA 3S3IA 4OTHA 3TJDA 1Y8YA 3R9HA 1YXTA 2GCDA 3U9CA 5JQ8A 2W1ZA 2OJIA 3Q2JA 3IQ7A 1A06A 3HX4A 3RAWA 4CFMA 1JU5A 1Z9XA 4EOJA 1Y1UA 4CKJA 4G31A 3F5XA 3D5WA 1E1XA 3U6HA 1CKPA 4I21A 5EW8A 2AC5A 5AUVA 3IDPA 3PE1A 3ZUVA 4F6SA 4NIFA 1K2PA 3AMYA 3MN3A 4C33A 1A1BA 1O4LA 2SHPA 1Q5KA 4KSQA 2Z60A 3GC7A 5E8XA 3PJ1A 5FTQA 4BN1A 5CEKA 4FSQA 5I3RA 4L1BB 4YLLA 1LPUA 4IAZA 1REKA 4EC9A 4IZ5A 2HXLA 4J1RA 4X7QA 3G15A 1OPJA 2V7OA 4NWGA 3MGYA 4O96A 5DVRA 3SDJA 3HAVA 4YBKA 3KREA 1R39A 4IXPA 4ACHA 5AFVA 2XIXA 4EL9A 4GVAA 4F7JA 4PPAA 3ZNIA 4LUDA 4U9AA 2GPHA 3DOGA 4RX7A 3VS5A 3LLTA 4KNBA 2QG5A 4AOTA 3ELJA 5A14A 2UZWE 5IA2A 3HP5A 3PP0A 4CZTA 2F2CB 4GEOA 3SGCA 4MEDA 1R3CA 1WBVA 2JAVA 1CSZA 5D9HA 5DMZA 2GFSA 4CZYB 5LXMA 2QLQA 3UPXA 2GFCA 1OIQA 2UW9A 2O5KA 4BDCA 3LW0A 3PQZA 4ARKA 3KFAA 4D58A 1H26A 3PXFA 4MBIA 5EM5A 1AD5A 2ETMA 1YW2A 5F1ZA 2P3GX 5I5ZA 4FSZA 2IUGA 3DAJA 4BKZA 2BCJA 3LFCA 1U54B 4FV0A 3ZLSA 3EKNA 3OXTA 4J53A 3KXGA 1IASA 4X6RA 3VJOA 4DG3E 2YJSA 3UC3A 2P2HA 1O48A 3BU6A 4OUCA 4BDEA 5AUTA 1B6CB 1AOTF 4C2VA 2J0JA 4OTIA 1JKSA 4NFMA 5M07A 3GFEA 4WO5A 5CSXA 4ZTQA 3VS6A 3TWJA 3EQIA 2O64A 3F2AA 4TYJA 1TVOA 3T9IA 3TV6A 3V01A 3DKOA 2UZNA 5I9XA 5IH5A 5EDPA 4QPSA 4OHLA 2EVAA 4E93A 2O2UA 2UZTA 1NVRA 2GSBA 3FV8A 5A4EA 1SVEA 3COMA 4JQ7A 2JKOA 5CI7A 3W18A 5GZAA 3DK7A 2R3JA 4Z3VA 2R0IA 3FWQA 2B0QA 3UO5A 4IAYA 4KBAA 4U0IA 3IK3A 3OUNB 3BWJA 4Y73A 2JKQA 2EWAA 2YCQA 2QU6A 3LM0A 2QO9A 4OBOA 4UV0A 5AP6A 3FPQA 5JQ5A 2HXQA 4FX3A 4E5AX 5BQ0A 5C4LA 3RBWA 3D9VA 1M52A 3RPOA 2PMLX 4Y95A 2UZOA 2VWYA 3CPBA 4ALWA 2GQRA 4IZYA 1CSNA 2X8IA 5JGDA 2EB2A 4W8EA 3FZTA 1OPLA 2UZBA 3UZRA 1O4EA 2VWZA 4BTFA 3QYZA 1PW2A 3B8QA 4Y72A 5CS6A 2VGPA 3C4XA 3LFQA 4EOPA 3U6JA 4LUEA 3V5WA 2ZV8A 3O23A 4YZBA 1XH4A 3PVGA 5EHPA 1V0PA 5IKWA 4ENXA 3TT0A 5IQIA 2GS7A 5CTPA 1ZYDA 4J95A 3EFWA 1WBWA 2C30A 2ITXA 4GK4A 1S9JA 3O7LD 3AMAA 4BDHA 4F6UA 2ZAZA 4O7WA 3VS3A 1I3ZA 1OB3A 4BCIA 1TQMA 4FSWA 3PWDA 3P7AA 1HCLA 5AP2A 2VTHA 3NUUA 5L6PA 3TUDA 4V0GB 4MQ2A 4FI1A 5A4TA 2EYVA 3E88A 3GBZA 4N6YA 3PPJA 3RHKA 4L43A 4BF2A 2PUIA 4R8QA 4O2ZA 3LJ0A 2XB7A 5G1XA 4TTHB 4UX9A 1R78A 3N51A 4IIRA 4EK5A 4K8AA 2F7XE 3RCDA 4BTJA 3QGWA 3IW6A 3T3VA 3KXMA 4EH3A 4QMOA 3VUMA 4YSJA 1MRUA 1YHWA 2OFUA 3BQRA 1BL7A 4RJ6A 3CCNA 4FZ6A 5HKMA 2PUPA 3BWFA 4XCUA 4C4GA 3ULIA 4RWIA 1ZMWA 4BZNA 2UW7A 1J91A 4ZS0A 3PPKA 2GHMA 5FXQA 4NW6A 5HNBA 2F7EE 1ZOEA 4JG8A 2V55A 4TY1A 3C0IA 3E62A 3GCPA 4DFNA 2IVSA 5JN2A 3K2LA 2VNWA 3FYJX 4AW2A 3NCGA 4EOIA 2W4JA 4C38A 4QD6A 4OTDA 1UURA 4PMSA 2W1FA 2Y0AA 3CSVA 4PTCA 3UDBA 1AYDA 3VUTA 5AV0A 3S0OA 4ZSAA 4PDOA 5A3XA 1FOTA 1ZYLA 2L3TA 1UWJA 5IBMA 3HMMA 1UNHA 3KRRA 4IWOA 2VWIA 3BELA 3EWHA 4YP8A 3S1HA 2G9XA 1V0OA 5CQWA 4C35A 2C5VA 3R22A 4IWQA 4FKOA 5DN3A 3WIGA 3PY0A 4L7SA 4ZXTA 4HPTE 3MYGA 2VTNA 3OP5A 1CKIA 5CI6A 5TR6A 2QOCA 2QOHA 3WBLA 2PNAA 3OC1A 4ASDA 4O0YA 5HESA 3ALNA 3MPMA 3CEKA 4OTGA 4HPUE 4ZJIA 1LUMA 4ZS4A 5B0XA 2Y9QA 4NYEA 4F0FA 2J0LA 4AUAA 5AP1A 2WEVA 3R7OA 4CFWA 1PMNA 4EJNA 4PDPA 4C58A 3R1YA 2W05A 1BLJA 3OTUA 4HVSA 4QQJA 2CJMA 3D7TB 3GP0A 3OXIA 4B9DA 3KULA 3KXZA 4F63A 4QT1A 2BAJA 2UW6A 3DBEA 5ACKA 3FXXA 5TF9A 2W5AA 3L8SA 5HE0A 2HW7A 3QALE 3R2BA 3BIZA 2WMRA 3FKNA 4DEGA 4AAAA 1KOAA 3H9RA 2GHGA 4OBPA 4FEWA 1SPRA 5K9IA 2VX0A 3NW6A 3DGKA 3GUBA 2A4LA 3R73A 3EHAA 4IHPA 3A99A 3TN8A 4ANQA 1PYEA 2ECDA 4PPBA 3VS7A 2VO0A 4HVDA 2YU7A 1PHKA 2JIUA 4HYHA 5DI1A 1ZMVA 2ITWA 4B8MA 2YN8A 4JDKA 4OT5A 3V8TA 2IJMA 2YEXA 4FKSA 3ZFMA 3ZOSA 4OHEA 3CPCA 4DC2A 4LRKA 1Q97A 4ZSLA 1RE8A 3W2OA 2OG8A 4NM3A 2R64A 1LUIA 4WUNA 2WMXA 1YHVA 3W10A 1TQIA 2CSNA 4DEHA 3QKKA 5CY3A 2PVYA 4G3DA 1Q8WA 3W2CA 1XA6A 5ETFA 4O81A 4ASXA 2LAVA 2ZDTA 5HX6A 5FTOA 2R3QA 2O65A 3OHTA 3MJ1A 4FV3A 5KZIA 4D1ZA 3MWUA 5J9ZA 5JGBA 3ZFXA 2UVZA 5D11A 3VVHA 3UO6A 4M13A 5EFQA 4AA4A 4AN2A 4BBEA 3ZRKA 2IUIA 3A7JA 4NFNA 1G3NA 3EN9A 5A4QA 3K2MA 1P2AA 2WMBA 4O6LA 4R78A 3NUXA 2XNMA 4CLJA 1W83A 5BUIA 3FLNC 3HA6A 3OY1A 4BGHA 2X9FA 4E26A 3G0FA 1FBVA 1SHAA 2CLXA 5IZFA 5CVHA 3PVBA 3NAYA 3L8VA 4PNIA 3Q53A 2OXDA 4IQ6A 4L46A 3TJCA 4XYFA 5B2LA 2IZRA 2XH5A 5DR6A 5HCYA 1BHHA 4BYIA 3PG3A 2OJJA 4MNFA 4EZ3A 2H8HA 3H3CA 4V04A 5CDWA 4X2FA 2VWWA 2J51A 4B7TA 2FSLX 3BYMA 3ORXA 5CAQA 1APME 5JFSA 4V0GA 3BKBA 3UF4A 3R9NA 3MH3A 4IX3A 3KXXA 1ZY4A 4M68A 3OVEA 4ANBA 5DHJA 1PXPA 4BWXA 4I6FA 4N4SA 4PL3A 2QVSE 3OEZA 4FK3A 3L9MA 5KMLA 2ESMA 2WGJA 1Z57A 3G90X 3V5QA 3CBLA 1H27A 2OU7A 4UWYA 4FVRA 3ODZX 2GMXA 4FNXA 4MXZA 3D94A 4ZTHA 1WZYA 4GT3A 3RZFA 3BPRA 4EH9A 3KN5A 3TNQB 4AZSA 5IMEA 4OR5A 3ZUUA 1R1WA 2ONLA 3EL7A 4QP4A 1BX6A 4QOXA 3MPAA 4Y83A 5J5TA 3QQGA 3QTSA 4H58A 3PLSA 4N57A 4L3PA 1ZAOA 4XRLA 3NYOA 4JL9A 2YZAA 4JOAA 5EQEA 5D1JA 2YCRA 4HGSA 4JBVA 3I6WA 2VD5A 4HGTA 1YXXA 2UZUE 3AMBA 3LZBA 4HZRA 3AC5A 3LAUA 5DR2A 5GJGA 3MH1A 1O4QA 4M0YA 4CFUA 3DXPA 4JS8A 3NVMB 4O7YA 2JDSA 3P1AA 4JT3A 5DWRA 5HE1A 3RVGA 4FBNA 4ID7A 3BHVA 3N4VA 1O4KA 3WZUA 5C26A 3VO3A 3COKA 1Q62A 3D5XA 3KCKA 2UV2A 4M84A 4DH7A 4Z16A 1KA7A 3KRLA 4Y46A 3HAMA 1H9OA 4EH2A 3ZBXA 4DFBA 4ERWA 4FV6A 3OY3A 5DT4A 2PY3A 3QCQA 4O0RA 4CRSA 5KMJA 4AA5A 4A4XA 4RVKA 2FYSA 3RM7A 3S8OA 5CWZA 3L8XA 1U59A 5FP5A 1J7UA 4FL3A 1M2RA 4D0WA 3R8LA 4MXYA 3QAME 4DAWA 1Y8GA 5EHRA 4W4WA 5DBXA 5FLFA 2UW0A 3O17A 2VUWA 4FIFA 1DAWA 3PFQA 5IEVA 1REJA 3VS2A 3ZCLA 4Y5QA 4J8MA 4QMPA 3AC8A 4GMYA 2PVMA 2NP8A 4XV1A 2ZV2A 3LCKA 4BI1A 1Q24A 3ZO1A 5GINE 2OBJA 1O4DA 4BCGA 1RPYA 4JQ8A 1NXKA 2SRCA 3W16A 3REPA 3BGZA 2HY0A 3DJ5A 2BRNA 2ZDUA 3BUWB 3C4CA 4ZSJA 2YCFA 5DE2A 2B52A 5GHVA 3DNDA 2EO3A 3U6IA 4DG0E 2BRGA 5ANKA 2GS2A 5EW3A 3RPRA 5EEQA 1PXLA 4RPVA 5CEQA 2CHLA 3KMMA 2PLEA 3QTUA 4EZ5A 2UW8A 4RLKA 3BI6A 3E8EA 4M8TA 4YJRA 3R7VA 4ANLA 3CWGA 3R7EA 5FEEA 5A46A 3ULZA 5EG3B 2B4SB 4ONAA 4RC2A 3BU3A 3CQWA 3NLBA 2UZVA 2PVFA 3PDTA 1O4FA 2C5XA 2DX0A 2FVDA 2A1AB 3F3WA 3QU0A 3TCPA 4A4OA 2XK6A 3DB8A 4ASEA 1KV2A 5IA4A 5FUTA 1Y57A 2WTIA 5LVMA 3MI9A 4YBJA 5E4HA 5FM3A 2WTWA 4FG9A 2CRHA 2VRXA 3GCVA 3V6RA 5CZIA 4AGWA 2XNBA 2CKOA 4P9ZA 3DK6A 2JBOA 3W32A 2BHHA 2Z8CA 2NNWB 3HHMB 3PVWA 2XUUA 3TIZA 3UG2A 5FBNC 1WBTA 4Q9ZA 3D14A 4R3PA 3EAZA 1H0WA 5AA9A 5BNJA 5EELA 5EK7A 1A09A 1AYBA 5ITAA 4HGEA 4XG7A 3NNVA 3LFDA 1BKMA 4BZOA 3H0YA 2F57A 2E9VA 3OCBA 2VX1A 4L45A 4J99A 3T3UA 5F94A 3LFEA 4I6BA 1GZKA 1EH4A 2GDOA 5JT2A 4BTKA 2J9MA 2R3PA 3SVVA 3UYSA 3VS4A 1OGUA 2PZ5A 5L2TA 3S00A 2AUGA 3KCFA 4QMNA 4ITJA 1NA7A 5ICPA 5GZ9A 1UU7A 2VTQA 2W06A 4O1OA 1QCFA 2QD9A 2P4IA 5HTIA 5B7VA 4AGUA 3ROCA 3VN9A 5EM6A 1UNGA 1SHDA 5E8TA 4P90A 4QP6A 1H1WA 5CASA 3NPCA 2VTMA 4R3CA 4YC6A 2YACA 3BBTB 3R30A 5AX9A 3BU5A 4QMVA 5HIDA 4G6LA 2XKEA 3FSFA 4MNEA 3H9FA 4BC6A 2DQ7X 4L8MA 2ITNA 4CMOA 5AR2A 4F65A 5C03A 2XVDA 2EUFB 3MS9A 4FTNA 4I5HA 3QWXX 3FL5A 3FPMA 2J0IA 3Q32A 5IQCA 1O4IA 4R5SA 5KE0A 4NEUA 4FG7A 4PTEA 3GOKA 3GU4A 3R7IA 5CEOA 3BE2A 5CX9A 4ZTSA 4FT0A 3PSJA 3SKCA 2WOTA 2Z7QA 3GGFA 3I0OA 2W4KA 3UIXA 5BVOA 2QLUA 4Q5EA 1AYAA 3BLHA 5IMXA 4IACA 3SG8A 3ERKA 4WNKA 3ET7A 3Q9YA 3PZEA 4C8BA 1FBNA 3LJ1A 4D2WA 4Q5HA 2EKXA 4GJ2A 4LRMA 4TN6A 4RG0A 4HYSA 3WF8A 4CQEA 4PNKA 2PMNX 2C68A 2PE1A 2XK8A 2NRYA 5CT0A 4RC3A 4GKHA 3HMNA 3O8PA 2RF9A 3QCXA 4S2ZA 3ZLXA 3O50A 4O6EA 2PL0A 4UY9A 2Z7RA 2UZLA 3GXWA 4LGDA 4TYIA 3UVQA 5M4IA 4PPCA 3WARA 1UUSA 4MBJA 3CGOA 4C0TA 3EQRA 2BTRA 3K5VA 4E3CA 3KQ7A 4NT4A 5AUYA 3OV1A 4IDTA 1F1WA 3OW4A 5HKYA 5AMNA 3PJ8A 1O4JA 5FBOA 2XBJA 2C5OA 2PPQA 4KBKA 5EHOA 3OS3A 3LCSA 3TZMA 4CT2A 4HVGA 4EHVA 5I9ZA 2HCKA 5J7HA 5EYKA 2BDFA 3KC3A 3BYVA 5M56A 5CAVA 3KK9A 5L2IA 4IVBA 5JMSA 3U54A 2V5QA 3CXWA 4X2JA 2R3LA 5DNRA 5DGZA 3F2RA 4FKIA 3WF9A 2XK3A 3R00A 4ZMEA 1I09A 2J50A 2QKWB 3KRWA 4V05A 2VO6A 2W17A 2XRWA 1PXMA 4ZLZA 5M06A 4GL9A 2XIRA 4O22A 3NDMA 5ETIA 1UKHA 3GNIB 4U45A 5TT7A 4KKHA 3V5TA 2I0EA 2ZV9A 2OZOA 2WHBA 1OECA 3MDYA 3Q4UA 1Y6BA 4M69B 2PUNA 2HK5A 3ZM9A 4L3LA 1O6YA 2XNEA 2R2PA 5G6VA 4CV8A 4DFLA 4W8DA 3F3VA 3C5UA 4KRDA 5EG3A 3RAIA 3HA8A 3QZHA 4BIBA 3FLQA 3QHRA 4O0SA 2C6KA 2JGZA 3AXWA 4MHAA 4I4FA 4EC8A 4KKGA 3ODYX 4MBLA 5DLSA 4MXOA 4BCFA 5KBRA 4C57A 2PU8A 3OT8A 2XYNA 3ZXZA 3TV4A 2YIXA 3BGPA 3ANRA 3SLSA 3FKLA 4L9IA 3SOCA 4GV1A 5EI2A 3Q5ZA 2XIZA 4OTWA 4UMTA 4YZNA 4FTMA 5FD2A 3MH2A 4DBNA 5FG8A 4XG2A 3S95A 1RQQC 4H34A 3V5PA 4JIKA 2WMUA 1KSWA 4QPAA 3NGAA 5IQGA 2QQ7A 3UOJA 2C0OA 5BYLA 5E1SA 3DDPA 4RC4A 5BVWA 3UNJA 1H00A 3I5NA 5EI8A 5AUXA 1WQUA 2YDJA 4RQKA 3SAYA 3QKLA 5KHXA 2G01A 1OI9A 2DLZA 4BKYA 5KMNA 4DGLC 2P33A 5BMMA 4PY1A 2QOIA 3LLAA 3NS9A 1KWPA 3OCTA 2QONA 5FDXA 5IBSA 4KWPA 3OZ6A 3TXOA 5A6NA 4FSUA 1G83A 2ETRA 4A4BA 5A54A 2C3LA 4E4XA 5D7AA 5CU0A 4BDFA 4EIHA 3QTWA 3P78A 1XQZA 4ZIMA 2RVFA 4AACA 3BUNB 2BROA 2ITUA 4IEBA 4Q9SA 4BCNA 3E87A 3AG9A 4NW5A 4RJ5A 4BWKA 2CPKE 3KVWA 1KA6A 3WZKA 3ZSHA 5A4CA 4ANMA 2UW3A 4A9SA 1GJOA 3VRRA 4YJOA 1Q99A 4M7IA 2OLCA 3GI3A 2RFNA 4LOOA 2YITA 3FAAA 4AN3A 3EN4A 5KMIA 2NPQA 1DI8A 3D0EA 3N4TA 5CEMA 4GW8A 2CNUA 4C59A 3Q6WA 3MY5A 3IDBA 4R1YA 3VF9A 4U80A 3DXQA 4O21A 2QHMA 3GQIA 1NVSA 3SC1A 3VIDA 1UKIA 4IE9A 2OF4A 3MV5A 3R63A 4YMJA 5HZNA 3QQKA 1H0VA 4QQCA 4DEAA 2CNQA 1O41A 3FHRA 4FKVA 3TTIA 5HEZA 3UP7A 3LXPA 3OMVA 3CD8A 4ZLYA 3TNIA 3CIKA 1NW1A 4O7LA 3LJ2A 1PF8A 3F3ZA 2OXXA 3FLZA 1NY3A 5I3OA 4EKKA 4F1OA 2C3IB 2WAJA 3MY1A 4PQNA 4L01A 4PUZA 5D12A 2Q83A 1ZLTA 4DGXA 4BCPA 3QD2B 4A06A 2XKFA 2E9UA 1E1VA 4KKEA 4PP7A 1BMKA 3D83A 2BRHA 3EQFA 3HV5A 3BCEA 3P4KA 3BYOA 3BQCA 4GYGA 2W1GA 1LUFA 3CTQA 4ROJA 1YHSA 3F2NA 1JNKA 2CLQA 1NRVA 2X81A 4UN0C 4RVLA 5CU2A 3T8OA 2VO3A 5ETCA 3VBQA 1GHUA 3WA4A 3PJCA 4QTDA 1GZNA 3NIEA 4J96A 5J9YA 2WO6A 2IG7A 4NL0A 1X0NA 3K3JA 4F0GA 2X7OA 5EYMA 3BUMB 4W9XA 5ANJA 3WZEA 4P5ZA 4CT1A 1UWHA 3QXPA 3LVPA 4CFFA 4FKUA 3JVSA 1JBPE 4MYGA 4XH6A 2VWUA 3QUEA 3ZRLA 4OLIA 1BFJA 2WFYA 4QMTA 3EN6A 3F69A 1PXIA 4IZ7A 4QPMA 2YZLA 4MKCA 4WNMA 1H07A 2WQBA 1TCEA 2YM6A 4DFYA 4EH4A 5ANDA 4R7BA 3SXSA 3C7IA 3R8UA 1YXUA 4NUSA 4JG7A 1O4AA 3K54A 3EQGA 4WD5A 3R2YA 4FF8A 2IW9A 5J95A 4G17A 2K7AB 3HV7A 5KNJA 2BKZA 3Q4ZA 3QRJA 4KS7A 4GT4A 4MF1A 3MH0A 4UXQA 3WYXA 4QTEA 4UMPA 4GKIA 3ZH8A 3A7GA 4DGMA 5EKNA 2O0UA 3PPZA 4E4LA 5HVKA 5I9VA 1D1ZA 3QZFA 3VUHA 4W4VA 5KMMA 4JGHA 4FK6A 4CFNA 2JAMA 3NUPA 4KAOA 5LWNA 1DS5A 4L53A 2OIDA 4BFMA 5IUHA 4O7SA 2IZVA 2XKCA 4QMWA 2BBUA 5IU2A 2BHEA 4AFJA 3NSZA 4YC3A 2X6DA 3E7OA 1O49A 1SHBA 4EH5A 4LOPA 3GU8A 2CI9A 4UZHA 1FVVA 4O91A 4NCTA 4CLIA 4O84A 3RK7A 2ERZE 4H1JA 4NM5A 3FC2A 3VBYA 2OJGA 3F5PA 3JVRA 4DT9A 3KA0A 4MQ1A 2R3NA 4YUQA 2WOUA 3V5LA 4H1OA 1CSYA 3KGAA 3OBGA 2XA4A 2R7IA 5HO8A 3SRVB 4UWCA 1QMZA 2R7BA 5L8KA 3P86A 5CSVA 3Q5IA 3P23A 2F9GA 4IFCA 3O7LB 3MB6A 4WBOA 4A9RA 1O44A 3NR9A 2DVJA 2LNWA 2OJ9A 1O43A 5J79A 4U40A 4BDKA 2H96A 5HOAA 1XHAA 1J1CA 1YDTE 2QCSA 1KE6A 4EOSA 4LL0A 1SZMA 1M17A 3RTPA 2X2MA 5AM7A 4Z7GA 3GQIB 4RJ7A 4F9BA 3OWKA 5HCZA 2XP1A 4AZFA 4O0XA 2BRBA 3QQFA 4MF0A 4DTBA 3P5KA 3R04A 4K0YA 4AZVA 1HCSB 4FUYA 5CVGA 5IH4A 2WMVA 3LFSA 4CG9A 4IAFA 2ZV7A 1Q3WA 3OTVA 4X21A 3FYKX 3FY0A 5HG8A 4MD8E 3DBDA 5FXRA 2ZJWA 3PXYA 1TKIA 1JKTA 2OI4X 3QLFA 4UMUA 4RT7A 3VNTA 4TWCA 1XH9A 4G5JA 4IX4A 2HELA 2DS1A 4FT5A 4C4HA 3V6SA 3FZOA 2OICA 2XJ1A 3KMWA 2XJ0A 2OGVA 3ROYA 1UNLA 3IOPA 3A8XA 4ZP5A 2GQSA 3FI2A 5CU6A 1M61A 3QXOA 4IJPA 3U4WA 4DE4A 1BUHA 5HORA 5LOHA 1XJDA 1PYXA 4XBRA 5LARA 4G3FA 4IAKA 3ACJA 4BCOA 5AAGA 3U55A 4Z7HA 3HV3A 2AYPA 4OTQA 4GVJA 5L8JA 5KKRC 3OP0A 2PVKA 2YABA 1V1KA 3HGKA 3W1FA 3TNPC 2IWIA 1KE8A 1OM1A 3W55A 3PTGA 1OO4A 3QQJA 4QRCA 3W8LA 4C2WA 2JDTA 4IWDA 5BVKA 3U4UA 5T6KA 2ZB1A 3TIYA 5J7BA 4U6RA 2GSFA 4FVQA 2HDVA 1SNUA 5M53A 2PVLA 2JLDA 3MVMA 3C4ZA 4NWMA 4BHNA 4PRJA 2Z02A 4LYNA 1NVQA 4R77A 4TWPA 1CMKE 2QKRA 3E8CA 4G2FA 3BLRA 1GAGA 3KY2A 3KMUA 3PJ3A 3F7ZA 5EM8A 4JBOA 4D4SA 4QMSA 5K4JA 2W5BA 2WKMA 3POZA 4B99A 4JEGA 4IDVA 3TEIA 3UVRA 4GUBA 4BCHA 3NMUF 1PRYA 4ZEGA 1XBBA 2BFXA 3PA4A 3V04A 1X27A 4DH5A 1O4CA 3LQ8A 4FYOA 4LOQA 4M3QA 1FQ1B 3QF9A 2CKPA 3QRTA 3ATTA 4MNEB 5E1EA 2B9HA 4D2PA 3OUKA 4CGAA 1WVWA 5CT7A 3EACA 3Q2MA 4XX9A 3UO4A 3UPZA 5IQFA 5F9EA 4YNEA 4B4LA 3HL7A 4PMPA 3VRYA 2WD1A 3PIZA 2WMAA 5DG5A 4MTAA 3R7GA 5DF6A 4QNYA 3TZ8A 3WE8A 4EQMA 4Z55A 3A4OX 1CM8A 4PF4A 2IPXA 4BKJA 2YIRA 2CGVA 5E90A 4ZTLA 1CWEA 1T46A 1O4HA 3SOAA 3P7BA 3BEAA 5HNGA 3TUBA 3OOGA 3ORTA 3PY3A 4FTOA 2XEZA 4DH1A 3MVJA 2IZTA 3HECA 2O3PA 4RWJA 3ZC6A 5GZ8A 4FZ7A 3R7UA 3NNXA 5A9UA 1Q3DA 4ZY5A 2R3GA 3A7IA 2C1BA 2Z7LA 3FJQE 4FSTA 5FEQA 3IOKA 2PVJA 4GK3A 1SYKA 2REIA 1TZEE 4I5PA 3LQ3A 2BR1A 2YDIA 3F3UA 2YIQA 3CKXA 5J1WA 2CBLA 3UIUA 5GIOE 3I5ZA 2YSXA 1OIRA 1TQPA 2Y4IB 5HTCA 2OW3A 5GJDA 1H1RA 2QHNA 4XRJA 4M97A 2PZIA 2IVUA 4FNWA 5ACBC 1GRIA 3AGLA 1JPAA 2OIBA 1YVHA 1PJKA 4YGAA 4RIYB 2QOFA 1PXOA 3AC3A 2AOAA 3FMJA 1O4MA 3KFJA 4OHDA 2YERA 4R1VA 3I60A 2XCKA 4FBXA 3RPYA 2A27A 3I79A 4S33A 3FQSA 4HVIA 5AXIA 5LVNA 3QD0A 2Y6OA 2CGUA 1MW4A 3ZBFA 4B8LA 4ANNA 3D4QA 5CF8A 4IC7A 4QTAA 3D5UA 4IM0A 4CQGA 5HD7A 3H0ZA 4HCTA 1MRYA 3SXFA 1ZYCA 4BDDA 1JWHA 1X6CA 3UE4A 4MXXA 4XP0A 2YAKA 3B8RA 3PRFA 3R0TA 4L44A 2PYWA 2CIAA 4GS6A 5HO6A 4WIHA 4KA3A 1BFIA 3MSSA 3QQLA 2I0VA 4WSYA 5CF4A 4BDAA 4BGQA 5J9LA 1ZRZA 1QPJA 2PWLA 4QMYA 3U87A 3IGGA 4RQVA 4U3ZA 3SHEA 5K0XA 4U1PA 2B53A 3VF8A 2Q0BA 2W99B 5DT0A 3KXNA 2BUJA 1ZOGA 4CKIA 3GENA 3LIJA 2L4KA 5AR3A 4D4VA 4DFZE 4NZWB 4WBBB 5HLWA 4N0SA 1A81A 5IEXA 4GPLB 5FP6A 4JXFA 2XK4A 4R7IA 3VULA 3C13A 4I3ZA 3ZO2A 2VAGA 3QHWA 5HE2A 4ZTMA 4TNBA 5BUJA 4O7NA 3PXKA 3CTHA 3HZTA 4KABA 1AQ1A 2B7AA 5LMAA 3GEQA 5EDRA 5KX8A 3FL4A 4WSQA 2I1MA 1KE5A 3D15A 2YWPA 3C4EA 4YJTA 3HCKA 4TYEA 3MVLA 3I81A 3JYAA 3LHJA 3R1SA 4QYGA 5CNNA 3W2PA 4JLCA 3BUOB 3PIYA 4DEDA 3DBCA 5CQUA 3E92A 4I5MA 3RWQA 3ZO4A 4D9TA 1XH5A 1AYCA 3G5DA 4QP8A 3EFLA 3QA0A 2VTSA 3FBVA 2E9PA 4J8NA 2LQNA 4CD0A 4FV7A 1LKKA 4KRCA 4JNWA 3FHIA 3VROA 2VTPA 4FGBA 4M66A 5DOSA 2IO6A 3G6HA 3QZGA 4LG4A 4XEYA 2YM5A 1Q8ZA 4MAOA 1MQBA 2X9EA 4X3FC 3JY0A 4YJUA 4K77A 3IECA 3ZFYA 3HKOA 3MJ2A 4I24A 3PJ2A 2GS6A 4AGDA 3R6XA 2B54A 2YM8A 1LKLA 2KK6A 3NIZA 2G2HA 4P9VA 3E7VA 4EONA 3CJFA 3FMLA 4TWOA 5E8ZA 4F9CA 3D5VA 4IJ9A 4EORA 4EHZA 4NIFB 3Q9XA 4RGJA 3U9NA 3VAPA 4ZJVA 3UG1A 3UNKA 5JH6A 5DC9A 2J4ZA 4NTTA 1F5QA 4WUAA 5AV1A 3VWAA 2BRMA 4ACGA 4BCKA 3AOXA 2Y4IC 4FEQA 4EYJA 5M44A 5DRBA 3VQHA 1XO2B 3RINA 3KF7A 2FSMX 5JRSA 2C1AA 2XNOA 4IMYA 2ABLA 1IA8A 4RZVA 5DEYA 4FTUA 2CR4A 4AP7A 4WG4A 4L7FA 4J7BA 4IB5A 3RCJA 3RPSA 4H1MA 2R4BA 5FQDC 2OWBA 3M1SA 3F66A 1YI6A 3TKHA 5HU3A 5L2SA 1IAHA 2LNXA 5HD4A 2GHLA 2ERKA 4FV4A 1H01A 4FE2A 4NJ3A 2Y1NA 3QUDA 3DJ6A 1F3MC 2JIVA 5AIRA 5C8KA 1WAKA 4YC8A 5IUIA 3OB1B 1L8TA 5L2WA 2X7FA 4YLJA 4XZ0A 3VBWA 2GNLA 5KCVA 4UBAA 3DT1A 2MK2A 2JDOA 3QTRA 5LVPA 4J71A 4BR3A 4IM3A 1H28A 4A9YA 3DTWA 4CYIA 5J87A 3DJ7A 1LEZA 4P4CA 5H2UA 4GU6A 3GFWA 3DLSA 2QOBA 4GSBA 1XH8A 4M0ZA 4DEBA 5LQFA 2A2AA 3BHYA 2XIYA 3FC1X 4L67A 2VTAA 1WBOA 2XK9A 4GCJA 4I23A 5IF1A 4HOKA 2GNIA 2BPMA 3HYHA 4YLKA 5M09A 2OFVA 2VWXA 3CC6A 5EHLA 4JAIA 4CFXA 4R6VA 2W96B 1PKDA 1ZMUA 4QP7A 4EI4A 3A8WA 5AV2A 3QQUA 4NJDA 2LGCA 4I5CA 4F5AA 5LJJA 4FVPA 4ERKA 4EH6A 4FNYA 4Y85A 3B2WA 2MRJA 3DY7A 3EQPA 3LFAA 3QYWA 4KD1A 4S31A 1SM2A 4U5JA 4EJ7A 1OL2A 1YDRE 4J97A 4AW0A 4YO4A 1FBZA 2GE9A 2CMWA 2R3KA 1IRKA 5AV3A 4HJOA 4TYHA 5D7VA 4AQCA 3QFVA 1BLKA 4WRGA 4E7WA 5C9CA 3DNEA 5J5SA 3UQFA 1JSVA 2W1DA 3DBFA 2A0CX 3FDNA 5IUGA 3R8PA 2UVXA 4II5A 4RJ8A 2G15A 2OK1A 1SMHA 2W7XA 1K3AA 4YZMA 2BVAA 3LCDA 4GFGA 4EQCA 3E3BX 5L4QA 1IS0A 3DBQA 4IAIA 4RWLA 4DCEA 2MQIA 3LMGA 4LMUA 4CFVA 3O71A 4OTRA 4USEA 4ITIA 3LE6A 3NRMA 3N84A 3FI4A 4RFZA 2WEIA 3EQHA 4PMTA 4UWBA 4JJRA 3MXCA 4I22A 4CMUA 4FTAA 4F7NA 4WOVA 3JXWA 4FIEA 3R8ZA 1G5SA 1D4TA 3ORIA 2DM0A 2W1CA 5LMBA 4YPDA 2BZHB 3UODA 3EQDA 4E6DA 1KE9A 1XH6A 3K3IA 2CNVA 4ZY4A 3QCSA 3PFVA 4LV8A 4FZAB 1IAJA 4RX8A 2P0CA 5HU9A 3ETAA 3S8NA 1J7LA 5DC4A 2JDRA 1J3HA 3EH9A 3FQHA 3PXQA 4IB1A 5CVFA 4FIGA 3VHEA 1CWDL 4AGCA 2I0YA 3E64A 3VC4A 4NCTC 5M4CA 2HDXA 3TDWA 4TYHB 3B2TA 4PL4A 4V01A 3P9JA 4EHGA 4BIDA 3IN8A 3HRCA 2X8EA 4FIIA 3IKAA 4G3CA 4L52A 3LMIA 2UW4A 5M4UA 4I94A 5CU4A 5BPYA 3E93A 5I9YA 4M4ZA 5CU3A 2FCIA 3JUHA 3OCSA 3NYXA 1NZLA 3PLFB 3GQLA 4JDHA 1XKKA 4GK2A 1R0PA 2BAKA 4FC0A 2FGIA 4ZAUA 3UIMA 2C6EA 5HBEA 4HW7A 4WNPA 1LUNA 5E8WA 2X2KA 2FH9A 4IVAA 3NUSA 4KBCA 4XOZA 4DGPA 3JY9A 4HZSA 2ZMDA 4PX6A 4EUTA 3AC4A 4HYIA 4HVHA 4O2PA 4K11A 2XIKA 4F0IA 4UYAA 4E68A 4QP1A 5HLPA 3Q60A 4RFYA 1RQQA 4FODA 3ALOA 2PLDA 3VW6A 4F08A 3F7WA 5AUUA 2JC6A 3G9LX 1MP8A 1X8BA 4LM5A 1O6KA 3NUYA 3ZDIA 2QMSA 2X2LA 3KVXA 4D5KA 2WMSA 3G9NA 4G6OA 4GJ3A 3ZXTA 3PSKA 4FTIA 1M2PA 3KULB 3C4FA 4NKSA 4AU8A 4EY0A 4XOYA 1W7HA 3ZLWA 4EBWA 3DDQA 5CF5A 2XEYA 3DZOA 5LMKA 3QA8A 3FEGA 3NZ0A 1XH7A 3W2RA 4FT9A 4QP3A 2EYYA 2YA9A 5AR8A 4EK4A 5HO7A 3GCQA 3EL8A 3PYYA 1A1AA 1Q61A 3MW1A 2W5HA 2ITZA 4H39A 1BHFA 3E8NA 5FEDA 5BVEA 4KIPA 1WBPA 2EU0A 3QQHA 4U3YA 2PE2A 2ZYBA 4BB4A 4ACCA 4BI2A 3DXNA 1VJYA 4YZDA 2WIPA 4C37A 3M11A 4D55A 3CS9A 3NUNA 5IA5A 3COIA 3LM5A 5LCJA 3M2WA 4RX9A 1M7QA 4DH8A 4FKPA 2JBPA 1MUOA 1ZXEA 3Q04A 2VWVA 4XG6A 2PZYA 3A60A 1YVJA 5CLPA 5JFWA 1LUKA 2C6OA 3EB0A 5DT3A 3E3PA 5H8GA 3PS5A 3KF4A 4JE4A 2GNGA 4EOMA 1RDQE 3BEGA 3COHA 4EYMA 4IM2A 2X1NA 1ZYSA 2BZIB 5DC0B 4E4NA 4GU9A 3US4A 4AN9A 3DS6A 4AW5A 5CALA 3PWYA 4D2SA 4JBQA 3UOHA 4DG2E 4JBPA 2X4ZA 3NUAA 5KAZA 3EIDA 3NNWA 4D9UA 3A62A 2GNJA 2QR7A 3BGQA 3GVUA 3HDNA 4FOCA 4M69A 4EBVA 5IQAA 1A07A 4K45A 2C5NA 2CN8A 4U42A 1LCJA 2XZSA 4NWFA 1WCCA 3DAKA 4FMQA 2C3JA 3VUKA 4XV3A 1GZ8A 4PWNA 3OFMA 4RJ3A 5M55A 2Y6MA 3PIXA 1LEWA 5CANA 5IPJA 3ZLYA 2RSVA 4ANOA 3I7BA 4GFOA 3R9OA 3ORPA 3OT3A 3QX4A 4O38A 4D1XA 3IG7A 4I0SA 5IEYA 1BHHB 4ACDA 4CKRA 4U81A 4JR3A 4DTKA 2YLFA 3MFTA 3OF0A 4OT6A 4AT5A 3OWJA 4NH1A 4QYYA 1NZVA 5KBQA 3THBA 4A9TA 2BILB 2BTSA 5TE0A 3DFAA 1ZZ2A 4F70A 1O47A 5AP3A 5I6VA 4WA9A 3MTLA 5AX3A 5D0JA 4LFIA 4CMTA 4EH7A 1YI3A 2JDVA 1R0EA 1QPCA 2XBAA 4DN5A 4F1TA 3MXYA 1O4PA 1FGIA 4DCAA 2VU3A 2PE0A 4RMZA 3FMEA 4K18A 5TO8A 3T9TA 4FL1A 4I6HA 2ITOA 3S2PA 3TUCA 3NW7A 3SA0A 2HZIA 3EKKA 3HMOA 1HCKA 4BDGA 1H08A 5BVDA 1O4GA 3CE3A 5D10A 3AT3A 3CY3A 5DH3A 3RAKA 4RIXB 3GU5A 4JAJA 2ZMCA 1YXSA 3R01A 2W0JA 2AOBA 3OWPA 5AP4A 4Z9LA 3PP1A 3POOA 5K5NA 4K9YA 3VHKA 3HV6A 5LVOA 4S30A 3S4QA 3FQEA 1QG1E 1FHSA 3VRQA 1BMBA 1OPKA 4QMXA 2YCSA 2CI8A 1FINA 4OAVB 4XV9A 5ETAA 2OH0E 4OHIA 1Z3KA 3ZZWA 2OJFE 1OBGA 2HY81 5LVLA 4XG4A 5DIAA 1IJRA 3UC4A 3HV4A 3Q9ZA 4EWQA 1YDSE 4XZ1A 1PMUA 2RFDA 2CCIA 4YJSA 3PZHA 4IZAA 4S34A 4D5HA 4O0VA 4EOOA 3EYGA 5GIPE 3CD3A 3NYVA 1OMWA 4FSMA 2R3MA 3CLYA 2X0GA 2VTOA 3R1QA 4TWNA 5EYCA 3RI1A 3TL0A 4FV8A 4QMLA 4YJQA 3DLZA 4B0GA 5TOZA 3WOWA 4O82A 5HICA 4D2VA 5I0BA 1QL6A 3IW4A 5AAFA 2J90A 3D7TA 3FZRA 3BV2A 4AS0A 3O51A 3UVPA 3UIBA 1O9UA 2X6EA 2B9FA 3KEXA 3MIAA 3ZM4A 4DHFA 3NYNA 3KRJA 4XUFA 2ITYA 3SG9A 5CYIA 3N4UA 2ZM4A 5HG9A 2PVNA 4FKTA 3CGFA 1DI9A 2H34A 2BZJA 2ACXA 3G2FA 5T68A 2Y7JA 3IMDA 3GT8A 2BKKA 3BE9A 4ZY6A 3UNZA 5DR9A 4K44A 1YI4A 2MRKA 4S32A 4OAUC 4BHZA 4Y8DA 3MA6A 4JRVA 4AE6A 4FKGA 2HZNA 3HIZB 4QYFA 3DB6A 5KMKA 3H9OA 2X8DA 5C8MA 4ZK5A 3N8MA 3SQQA 3FKOA 4UMQA 1P5EA 4G16A 3FLSA 3L8PA 3TI1A 3WYYA 4NK9A 4E6AA 2BMCA 3ATSA 4EEVA 2LCTA 1OL7A 4JIAA 3R83A 2XCHA 4QQTA 3ENMA 3SV0A 4F9WA 3PXZA 3VUDA 1JQHA 4TRLA 3LXNA 4BYJA 2PMOX 4RWKA 5BYZA 4RIYA 1YXVA 1O42A 3TKUA 3AC2A 4R7HA 4EQUA 4BBFA 3NHNA 4BRXA 4CV9A 3D7ZA 3QWYA 1JSTA 4CTCA 4XP3A 2O63A 4H36A 4CCBA 2QU5A 3NEWA 2I0HA 1PY5A 4EKLA 3WILA 4O83A 3PG1A 3A7HA 1MILA 3ZSGA 1OL5A 4FEUA 4BCJA 4O27B 4IANA 3LMHA 3HMIA 5HI2A 3GC8A 1ZY5A 2WQNA 1W82A 3QRIA 3UBDA 3OVVA 3KK8A 4FGRA 2QC6A 3EN5A 3VRNA 2J5FA 2W1EA 3QTZA 2ZM1A 3UOKA 4UALA 1G8AA 2HUWA 2EYZA 1J1BA 2CDZA 3NNUA 3HNGA 2R3OA 2GTNA 2XP2A 4AZTA 1CDKA 3S9KA 4G9RA 3ZO3A 4FKRA 2E9OA 2JFLA 4I0RA 1H1QA 4FTJA 4AW1A 4EK8A 4CVAA 2KNOA 4F4PA 2QO7A 4FG8A 4FKWA 4TXCA 3V3VA 1DAYA 4GWFA 4IWPA 3NAXA 4PV0A 5ANGA 2C6IA 2OH4A 3O2MA 1P4FA 2DYLA 5K3YA 3ZU7A 2WQEA 3AD6A 4ALUA 2QOKA 1OL6A 1HOWA 2JIIA 3BV3A 4XNEA 4AE9A 4JDJA 3CXLA 2PK9A 1VR2A 3ITZA 4ZLOA 5CAUA 3GOPA 4C61A 3C7QA 4BDJA 1P4OA 4DA5A 4DINA 5E7RA 2B1PA 1OBDA 2CS0A 5EYDA 4D2TA 4IB3A 3RGFA 5C4KA 2Z2WA 4FZFB 5J8IA 4AT4A 5HG5A 5FTGA 2VGOA 2VTLA 3FSKA 4PMMA 3EZVA 2C6DA 3CKWA 5L3AA 2Y8OA 5AUWA 5TKDA 1FU5A 3GXXA 2C69A 3IGOA 2C6MA 3IS5A 5IA1A 4FEVA 3CQUA 2PHKA 2NO3A 2PSQA 2YJRA 4YTHA 4RX5A 2HYYA 2RSYA 3EZRA 1H24A 5CEIA 1RW8A 2VNYA 1GIIA 3HMPA 3MY0A 5CSWA 3HVCA 3FI3A 5AR4A 4O7TA 4H05A 2HAKA 4BDIA 3ZYAA 2VO7A 2X39A 2OF2A 4I1ZA 2BIYA 2R3FA 4IVCA 2I7QA 4CCUA 5M51A 2G2FA 3UZTA 2WXVA 2IW8A 3RALA 1NT2A 2C47A 4WNOA 1JYQA 3PJPA 5GJFA 3WF6A 3CQEA 3C5IA 5E92A 2RG6A 1OL1A 3I7CA 4PTGA 1BI8A 4YZCA 3A2CA 5IQBA 2EXMA 3GCUA 3LOKA 3LKMA 1PXJA 3TKIA 4XG9A 1FMOE 2XRUA 4IX5A 3TV7A 2ONLC 3L9LA 5IG1A 1OVEA 3PUPA 1OKYA 4X3FB 5E8VA 3KU2A 3KXHA 4TL0A 2P2IA 4W4XA 4AA0A 2PNBA 2V22A 2ZM3A 4F64A 1H1SA 3TDVA 1Y91A 2ZB0A 3RK9A 1L3RE 4QMZA 1PXNA 1KUTA 2C5YA 2FO0A 3F88A 5JFXA 4FL2A 4H3BA 1CKJA 2WMQA 4C4EA 3GU7A 1XR1A 4U43A 3W8QA 2F49A 2PVHA 2FSOX 3H4JA 4ACMA 4G1WA 2E2BA 2WTKC 5FXSA 4QTCA 5B2KA 4XV2A 4E6CA 1J7IA 2HZ4A 1H25A 1VYWA 2BIKB 3DAEA 4X6QC 1A1EA 4RZWA 3VS1A 4YR8A 4FV9A 2G1TA 2XM9A 4XG3A 4D28A 1YKRA 3M7FA 3Q3BA 2WNTA 2J6MA 2CGXA 3QLGA 3P08A 3C9WA 4YJPA 2XNNA 5HG7A 3SD0A 4DFUA 1JYUA 3ACKA 4MXAA 4TW9A 2RG5A 4A07A 2OKRA 3QD3A 5GJIA 2J0KA 2YFXA 2I6LA 5I4NA 4K1BA 1SVGA 4F5BA 4M15A 3VW8A 4BVUA 3FMMA 3DPKA 4KIKA 5EKOA 1STCE 2PUUA 4B6LA 5IISA 4FSNA 3DU8A 4N6ZA 4BWPA 4X3FA 2EOBA 1A08A 1M7NA 4C3PA 2FB8A 4MWHA 5AA8A 4TT7A 5EOBA 2EU9A 2WTKB 3L9PA 4DF3A 3W2SA 4DEEA 3E5AA 3BHHA 3GC0A 2HWPA 4NM0A 3DZQA 5C27A 2C0TA 4AZWA 4FTTA 1G8SA 3OCGA 3RPVA 4D2RA 5M57A 3MAZA 3A4PA 4YPSA 1UA2A 2YWVA 1SNXA 3P0MA 4F1MA 4CSVA 5HNIX 4I6QA 4IC8A 4L00A 5AWMA 5HIBA 3I6UA 4ZZOA 5JKGA 1P13A 3GCSA 4FTQA 3UGCA 5HLNA 1A48A 3TTJA 3MFUA 1XBAA 2HIWA 3HUCA 3LXLA 3V5JA 3ZMMA 4ZMFA 2J7TA 5CAOA 2CGWA 3SW4A 4XLIA 4DITA 2HOGA 3G33A 2YISA 3QTIA 5T3QA 5EM7A 4I0TA
chains in the Genus database with same CATH superfamily
3R7YA 1FPUA 4FT3A 2O8YA 4I92A 5FM2A 1GZOA 3RNIA 2R3IA 3DTCA 3KL8A 1YOLA 3R02A 4PDYA 1OUKA 1Q41A 4NTSA 3C0GA 1JWOA 4QTBA 1YWRA 5LCKA 4L6QA 2JEDA 3ZZEA 1UU9A 3HRBA 4AX8A 4O0UA 4F59A 4X2GA 1DM2A 3VQUA 5CEPA 5J1VA 1F2FA 1BG1A 4XP2A 1R1QA 2J0MB 4OW8A 4DLIA 3P7CA 2C6TA 4YSMA 3RMFA 3TKZA 4YHFA 5BO4A 2QO2A 3V8SA 1IG1A 5CSPA 3ZDUA 1ZOHA 4DLJA 3TZ7A 3SW7A 2BDWA 4FYNA 2FA2A 3F6XA 1ND4A 4LMNA 1ZZLA 4GFMA 2IW6A 5AIKA 2UZEA 5IQDA 3U51A 2ITTA 3O96A 3E63A 3IO7A 3MBLA 3PLAE 5L2QA 4WG3A 4LI5A 4UYNA 5HE3A 3R9DA 3F9NA 4MCVA 1YWNA 3VJNA 5D41A 2VTJA 2R5TA 3DCVA 4PDSA 2F4JA 2YM4A 3ZEWA 4BZDA 2WTJA 3RJCA 3ZTXA 4F6WA 2CKQA 3ORMA 4K2RA 3PSDA 4IW0A 4AZEA 1O4BA 3LCOA 3UP2A 4DDIA 1B38A 1BYGA 3LXKA 4WT6A 2HWOA 4TZRA 1YWVA 4M67A 4X3JA 2WMWA 2W1IA 2BAQA 5DEWA 2QR8A 4JI9A 4EHEA 2H9VA 3AD4A 4P7EA 1Q4LA 3ZSIA 4MK0A 3FLYA 3QUPA 4U8ZA 4G34A 3AT2A 2QOOA 4MD7E 2YLEA 4O4DA 1MQ4A 2GNFA 2IZSA 3HEGA 4FTKA 1ZYJA 3QRUA 4BCMA 4HNIA 1FYRA 3EFKA 2ETZA 3ORNA 4XJ0A 5E91A 2VX3A 3UMWA 3OWLA 4RA4A 4EWHA 5C01A 3QGYA 5KO1A 3FI8A 2AUHA 4FV1A 3R9RA 3LQ5A 1JKLA 2W9FB 4RA5A 1GNGA 4EK6A 2WQOA 1WMKA 4RRVA 1A9UA 3NW5A 4N70A 4RSSA 2HZ0A 3AQVA 4U41A 4XG8A 4AFEA 3PE2A 4QO9A 4ANSA 2XNPA 3BZ3A 1IR3A 3ORLA 3PA3A 3EFJA 1R1SA 3FZSA 4O0WA 4F9AA 3PVUA 5E8YA 3SXRA 3UJGA 5H8EA 3P79A 2JKKA 4DHIB 2H5KA 2Q0NA 3L9NA 2K79B 1KV1A 4M12A 4QMMA 4RIWB 4F7SA 3Q96A 4GG7A 4AQKA 4DT8A 4IVDA 5L6WL 2OXYA 3QC4A 3FZ1A 4BCQA 3BLQA 4YZ9A 4CXAA 3JR1A 4QSYA 1PXKA 2VN9A 2B9IA 3A61A 4MD9E 4USFA 1WBNA 1YQJA 4QP9A 4U44A 4BIEA 3FXZA 3OEFX 3JS2A 5JRQA 3BBWA 5H3QA 1Y6AA 3NCZA 2BFYA 4ASZA 4CZUA 4EOKA 5JSMA 3JPVA 1FMKA 3Q52A 4GG5A 3N9XA 3FXWA 5LWMA 3MB7A 3IMJA 4ZSEA 3N7YA 3BYSA 4R3RA 1M27A 1WVXA 3G51A 3H30A 2JITA 5DPVA 5CENA 4YTCA 4DEIA 5EQPA 1U54A 1V0BA 5IDPA 2QOLA 3I0QA 4IX6A 3QRKA 3T04A 1U5RA 2NRUA 3AD5A 1ATPE 4KS8A 4BY9E 3NX8A 4YHJA 3UMXA 3DKGA 4C62A 4FKLA 4QYEA 4LL5A 2EO6A 1QPEA 3LFNA 2Y4PA 3GU6A 4HCVA 2XM8A 3PY1A 1KE7A 5EDQA 4LDTA 3PSCA 5AAEA 2YIYA 1UV5A 4LGHA 2EB3A 1UU8A 3Q4TA 1URCA 2WTCA 4BI0A 3BUXB 5IA0A 2VWBA 4USDA 3MFRA 3BYUA 3DK3A 4E8AA 4O0TA 5L8LA 4L42A 4DGOA 3R28A 5BVFA 3Q6UA 2WU7A 3CJGA 1VEBA 3F5GA 1FVTA 4AT3A 3D2KA 4FKQA 3MVHA 1PMVA 1JOWB 4O7VA 2VTTA 2XAMA 3VUGA 4RVMA 2C9WA 4C4FA 1ZWSA 5IQEA 1GY3A 1A1CA 3SRVA 5EQYA 2JYQA 5JGAA 2YAAA 5E9EA 3A7FA 3C50A 3AT4A 1XWSA 2R3RA 2OIQA 4RJ4A 4WHZA 4YTIA 1BLXA 4YJNA 5I9UA 4AOJA 5LMKC 4BJJA 4ZZMA 4WWQA 1W98A 4C02A 1ERKA 3IN7A 4HYUA 1Q8UA 4X0MA 4K6ZA 3F3TA 3GC9A 3QD4A 4ZSGA 3DKCA 2ITQA 3IW5A 5BYYA 1AB2A 1BL6A 3GXLA 3Q4CA 2ITVA 3KKVA 4APCA 2VV9A 1M14A 3PSBA 3BX5A 5JFVA 3ZS5A 3OBJA 2Y3AB 2IVVA 4I93A 3AC1A 4TPTA 1O4OA 4ZTRA 2ZOQA 2H6DA 3ANQA 4ZTNA 2IZUA 4RIXA 2J5EA 4G3EA 1QPDA 1OKWA 1Q8TA 2G2IA 2QNJA 2Z7SA 3MA3A 4KIOA 4KIQA 5FRIA 1PKGA 3AKJA 2DWBA 1IA9A 2J2IB 4C36A 3BHTA 4FUXA 3HLLA 3ID6C 4ORKA 2WIHA 3UZPA 4LV5A 5E8SA 3ORZA 4GRBA 4RLLA 3WZJA 5HQ0A 3PXRA 4FKJA 1YOJA 3R71A 5HHWA 4EZ7A 3EQCA 2X4FA 1QADA 2B3OA 5AULA 3QTQA 2WELA 3RP9A 4O1PA 4QEBA 3QX2A 1PICA 3EN7A 5JZNA 4WG5A 5K4IA 5AP0A 4G5PA 4FSYA 5HKZA 3IPHA 2CKEA 3RWPA 3BRBA 4OTPA 4FEXA 3D2IA 3HP2A 5EOLA 2VTIA 3VUIA 1ZFPE 1SVHA 1URWA 2WMTA 4PL5A 4YJVA 5HKWA 3R21A 3ORKA 3ZHPC 4FZDB 3UYTA 4D1SA 1ST4A 3IW7A 5AR7A 4UZDA 1WBSA 4DYMA 1VYZA 3NVKI 4DH3A 3FUPA 5HBHA 1OIUA 1UU3A 1B39A 2PMIA 3R8VA 3LFBA 3UQGA 3WF5A 1D4WA 1VZOA 2XK7A 1OKVA 2WTVA 2GQGA 3RM6A 4QP2A 3G0EA 1IEPA 4L3JA 4C3FA 3VGOA 2C3KA 3TZ9A 2ETKA 5I9WA 4HCUA 4RIWA 4J52A 3VS0A 3WF7A 4FV2A 5AADA 5BUEA 2LQWA 2XYUA 4YO6A 3RHXA 4QYHA 5HTBA 3BL7A 5IQHA 4W4YA 1AGWA 2RFEA 1O6LA 4Q2AA 5EH0A 4LRJA 3KRXA 5AP7A 1GIHA 1OITA 2GU8A 3WIKA 2IUHA 3VBTA 4D8KA 5FDPA 4DBXA 1H8FA 1KC2A 4GT5A 1BI7A 3MPTA 4FT7A 3WZDA 5JEBA 2UZDA 1JLUE 4FTRA 4X6SA 2FUMA 1RJBA 2GNHA 2I40A 1S9IA 5ANEA 4NKAA 3VRZA 4RVTA 5C8NA 3FMDA 5AP5A 1JKKA 1K9AA 2F2UA 4XBUA 2V7AA 4ZOGA 2KULA 5K5XA 5H8BA 4WKQA 4BL1A 2WQMA 3VBXA 3DQWA 3PA5A 3QKMA 4U79A 1OIYA 2YM7A 4E6QA 3QWKA 3FZPA 4QQ5A 5A4LA 3I4BA 4J98A 4ZZNA 1H1PA 2YHVA 5AJQA 4JX3A 2XNGA 4KUJA 2H46E 4CTBA 4EOLA 5KZ0A 2RKUA 5CSHA 1PMEA 2X7GA 1FVRA 4K33A 5AUZA 5GNKA 3BL9A 2QI8A 4JRNA 4QNAA 4OHHA 4BTMA 2WB8A 4U7ZA 4YU2A 2VTRA 1U5QA 1Z5MA 1F0QA 3Q9WA 5EI6A 2V62A 3TNWA 3F61A 1OUYA 2C6LA 3O8TA 3U8WA 4HNFA 2OSCA 3EQBA 4FIJA 3RZBA 3WE4A 4F09A 5CF6A 4A4CA 5JK3A 2PVRA 2YIWA 4D4RA 2C4GA 3RK5A 4XMOA 1U46A 3S8LA 1M2QA 3F82A 3QTXA 4UEUA 3OXZA 4FTCA 4ZJJA 2NYAA 5M08A 4L68A 4C4IA 2PZRA 3RNYA 3MTFA 5DRDA 4FOBA 3RAHA 5BMSA 4OGRA 2BZKB 3TNHA 3LPBA 4JVGA 3FMNA 2EXCX 4UB7A 2UVYA 4R5YA 3MIYA 5IA3A 4AXAA 1BKLA 1CJ1A 5HVJA 4IADA 3VRPA 1MRVA 3E8DA 2CCHA 3ZC5A 1E9HA 4RBLA 5F20A 1AOUF 4PP9A 4OBQA 1LR4A 4FR4A 4MH7A 3RKBA 1UVRA 3EOCA 2R0UA 5ANIA 5JZJA 2HENA 3DQXA 1FGKA 3FY2A 3ZRMA 2BDJA 4O86A 3V51A 1P14A 2WU6A 4LQMA 4FA2A 1O4NA 3OG7A 3ZONA 4AF3A 1W8CA 4GIIA 2JKMA 2VZ6A 3QZIA 1ZARA 4CRLA 3DFCB 4E4MA 2MC1A 3G6GA 4XLVA 2OZAA 2RIOA 2F7ZE 4TYGA 3TL8A 4CNHA 4I4EA 3VONA 1T45A 3UOLA 4XS2A 4KINA 4W9WA 5C1QB 2XKDA 4BICA 1GIJA 5BVNA 3VBVA 5HIEA 2A19B 4M14A 4EUUA 4LV7A 1U4DA 4TZIA 3NFGB 1GOLA 2IN6A 4G6NA 4JQEA 2PZPA 4IH8A 2YM3A 4JR7A 3DA6A 4MXCA 5KHWA 3CTJA 4DTAA 2BALA 4ENYA 4GYIA 1WVYA 1CTPE 5EW9A 4AG8A 4FSRA 2UW5A 3O0GA 1HCTB 1YRPA 4ITHA 4A7CA 1W0XC 1JAMA 5DA3A 5FGKA 2PULA 2OO8X 4RIOA 4GL9E 2CN5A 4CG8A 5AV4A 2QURA 2WTDA 2GTMA 2R9SA 2YDKA 3DKFA 4FRFA 3C51A 4G3GA 3FMKA 2AC3A 4GH2A 3M42A 5AR5A 2RMXA 1YVLA 3ZEPA 2AQXA 3I1AA 4KSPA 1OO3A 4IB0A 2B9JA 3LCTA 2EL8A 4H3QA 4I20A 3L1SA 4YTFA 2W4OA 5IDNA 1W84A 5KMOA 1LP4A 2XMYA 4O7RA 2IVTA 5AEPA 4EH8A 5HGIA 2IF8A 3CP9A 5CZHA 2ZVAA 4E20A 1JVPP 4NU1A 3EJ1A 5F95A 5J3XA 4IFGA 2W1HA 5KUPA 3II5A 4O7ZA 3CR0A 3QWJA 3TM0A 2HW6A 2L6KA 2VIFA 1YOMA 3KB7A 5GJHA 2UUEA 4UMRA 4XHKB 2XJ2A 4F7LA 3PRIA 1R1PA 4AOIA 4KB8A 5FWKK 4AWIA 3KN6A 3QC9A 4EK3A 5DYJA 3F5UA 3C0HA 4APPA 4FV5A 4YHTA 4GIHA 5H9BA 2RORA 1SKJA 4JG6A 1B47A 2RFSA 4ALVA 2JFMA 2Y1MA 5HVYA 4RFMA 3UDSA 4D4YA 4EOQA 3SX9A 4C7TA 3O8UA 4KIKB 5A6OA 3OROA 2QOQA 5DFPA 4E5WA 2DCRA 1RJAA 2W9ZB 3IW8A 3MFSA 4MVFA 5F4NA 3R8MA 3W33A 5B2MA 5CXHA 1JYRA 1SPSA 4P5QA 4HGLA 5EHYA 1I44A 3V8WA 3BHUA 1O46A 2PTKA 1JSUA 3TACA 5M4FA 5IH6A 3QL8A 2JD5A 4UXLA 4JDIA 3IDCA 1XBCA 2B55A 4C4JA 4C3RA 4NSTA 2RL5A 4U97A 4DFXE 1O45A 2QG7A 3HRFA 3HDMA 2C0IA 3OOMA 4DGNA 3DV3A 3OD6X 2DLYA 3K5UA 4G9CA 4D0XA 2E9NA 3NWWA 4H3PA 3FE3A 4Y5HA 1BF5A 2XANA 3R1NA 3MESA 4BBMA 5HCXA 3ENHA 3C4WA 2P55A 4CYJA 5BV3A 5AM6A 4QMQA 5HX8A 4I41A 3HUBA 4F9YA 3OW3A 4U17A 2KTYA 2ITPA 3UYOA 2FSTX 5K0KA 4MX9A 4MWIA 2QODA 4E5BA 3PUFC 1WFCA 4WRSA 3LFFA 3C1XA 4X2NA 4E73A 4IBMA 4F99A 2WPAA 1BM2A 4OTFA 4NM7A 4JX7A 4TNDA 5ANOA 3ZUTA 2OQ1A 1KOBA 5L6OA 3W2QA 4E1ZA 3H10A 4A9UA 4P2KA 4DGGA 3AGMA 2RGPA 1BKXA 4X2KA 3FLWA 4GUEA 4YURA 4FNZA 3EMGA 1O4RA 4BGGA 2XF0A 5CAPA 3UQCA 2WZJA 3FMHA 3IONA 3UTOA 3TG1A 4FIHA 2OZAB 3QCYA 4LGGA 5CXZA 1Q8YA 1LCKA 3OB2B 3QBNA 4IAAA 4C34A 5BX0A 4QMUA 5KKRB 1OZ1A 2EXEA 3WI6A 4FICA 4CEGA 3EYHA 4BDBA 2DUVA 2V0DA 4A4LA 4YNOA 1OKZA 5E8UA 4FTLA 3CY2A 2HMHA 2R3HA 1H4LA 3GB2A 2XS0A 4TKSA 5CNOA 3S3IA 4OTHA 3TJDA 1Y8YA 3R9HA 1YXTA 2GCDA 3U9CA 5JQ8A 2W1ZA 2OJIA 3Q2JA 3IQ7A 1A06A 3HX4A 3RAWA 4CFMA 1JU5A 1Z9XA 4EOJA 1Y1UA 4CKJA 4G31A 3F5XA 3D5WA 1E1XA 3U6HA 1CKPA 4F78A 4I21A 5EW8A 2AC5A 5AUVA 3IDPA 3PE1A 3ZUVA 4F6SA 4NIFA 1K2PA 3AMYA 3MN3A 4C33A 1A1BA 1O4LA 2SHPA 1Q5KA 4KSQA 2Z60A 3GC7A 5E8XA 3PJ1A 5FTQA 4BN1A 5CEKA 4FSQA 5I3RA 4L1BB 4YLLA 1XMLA 1LPUA 4IAZA 1REKA 4EC9A 4IZ5A 2HXLA 4J1RA 4X7QA 3G15A 1OPJA 2V7OA 4NWGA 3MGYA 4O96A 5DVRA 3SDJA 3HAVA 4YBKA 3KREA 1R39A 4IXPA 4ACHA 5AFVA 2XIXA 4EL9A 4GVAA 4F7JA 4PPAA 3ZNIA 4LUDA 4U9AA 2GPHA 3DOGA 4RX7A 3VS5A 3LLTA 4KNBA 2QG5A 4AOTA 3ELJA 5A14A 2UZWE 5IA2A 3HP5A 3PP0A 4CZTA 2F2CB 4GEOA 3SGCA 4MEDA 1R3CA 1WBVA 2JAVA 1CSZA 3W0SA 5D9HA 5DMZA 2GFSA 4CZYB 5LXMA 2QLQA 3UPXA 2GFCA 1OIQA 2UW9A 2O5KA 4BDCA 3LW0A 3PQZA 4ARKA 3KFAA 4D58A 1H26A 3PXFA 4MBIA 5EM5A 1AD5A 2ETMA 1YW2A 5F1ZA 2P3GX 5I5ZA 4FSZA 2IUGA 3DAJA 4BKZA 2BCJA 3LFCA 1U54B 4FV0A 3ZLSA 3EKNA 3OXTA 4J53A 3KXGA 1IASA 4X6RA 3VJOA 4DG3E 2YJSA 3UC3A 2XARA 2P2HA 1O48A 3BU6A 4OUCA 4BDEA 5AUTA 1B6CB 1AOTF 4C2VA 2J0JA 4OTIA 1JKSA 4NFMA 5M07A 3GFEA 4WO5A 5CSXA 4ZTQA 3VS6A 3TWJA 3EQIA 2O64A 3F2AA 4O4FA 1TVOA 4TYJA 3T9IA 3TV6A 3DKOA 2UZNA 3V01A 5IH5A 5EDPA 4QPSA 4OHLA 2EVAA 4E93A 3K2TA 2O2UA 2UZTA 1NVRA 2GSBA 3FV8A 5A4EA 1SVEA 3COMA 4JQ7A 2JKOA 5CI7A 3W18A 5GZAA 3DK7A 2R3JA 4Z3VA 2R0IA 3FWQA 2B0QA 3UO5A 4IAYA 4KBAA 4U0IA 3IK3A 3OUNB 3BWJA 4Y73A 2JKQA 2EWAA 2YCQA 2QU6A 3LM0A 2QO9A 4OBOA 4UV0A 5AP6A 3FPQA 5JQ5A 2HXQA 4FX3A 4E5AX 5BQ0A 5C4LA 3RBWA 3D9VA 1M52A 3RPOA 2PMLX 4Y95A 2UZOA 2VWYA 3CPBA 4ALWA 2GQRA 4IZYA 1CSNA 2X8IA 5JGDA 2EB2A 4W8EA 3FZTA 1OPLA 2UZBA 3UZRA 1O4EA 2VWZA 4BTFA 3QYZA 1PW2A 3B8QA 4Y72A 5CS6A 2VGPA 3C4XA 3LFQA 4EOPA 3U6JA 4LUEA 3V5WA 2ZV8A 3O23A 4YZBA 1XH4A 3PVGA 5EHPA 1V0PA 5IKWA 4ENXA 3TT0A 5IQIA 2GS7A 5CTPA 1ZYDA 4J95A 3EFWA 1WBWA 2C30A 2ITXA 4GK4A 1S9JA 3O7LD 3AMAA 4BDHA 4F6UA 2ZAZA 4O7WA 3VS3A 1I3ZA 1OB3A 4BCIA 1TQMA 4FSWA 3PWDA 3P7AA 1HCLA 5AP2A 2VTHA 3NUUA 5L6PA 3TUDA 4V0GB 4MQ2A 4FI1A 5A4TA 2EYVA 3E88A 3GBZA 4N6YA 3PPJA 3RHKA 4L43A 4BF2A 2PUIA 4BJJB 4R8QA 4O2ZA 3LJ0A 2XB7A 5G1XA 4TTHB 4UX9A 1R78A 3N51A 4IIRA 4EK5A 4K8AA 2F7XE 4AXEA 3RCDA 4BTJA 3QGWA 3IW6A 3T3VA 3KXMA 4EH3A 4QMOA 3VUMA 4YSJA 1MRUA 1YHWA 2OFUA 3BQRA 1BL7A 4RJ6A 3CCNA 1OGYA 4FZ6A 5HKMA 2PUPA 3BWFA 4XCUA 4C4GA 3ULIA 4RWIA 1ZMWA 4BZNA 2UW7A 1J91A 4ZS0A 3PPKA 2GHMA 5FXQA 4NW6A 5HNBA 2F7EE 1ZOEA 4JG8A 2V55A 4TY1A 3C0IA 3E62A 3GCPA 4DFNA 2IVSA 5JN2A 3K2LA 2VNWA 3FYJX 4AW2A 3NCGA 4EOIA 2W4JA 4C38A 4QD6A 4OTDA 1UURA 4PMSA 2W1FA 2Y0AA 3CSVA 4PTCA 3UDBA 1AYDA 3VUTA 5AV0A 3S0OA 4ZSAA 4PDOA 5A3XA 1FOTA 1ZYLA 2L3TA 1UWJA 5IBMA 3HMMA 1UNHA 3KRRA 4IWOA 2VWIA 3BELA 3EWHA 4YP8A 3S1HA 2G9XA 1V0OA 5CQWA 4C35A 2C5VA 3R22A 4IWQA 4FKOA 5DN3A 3WIGA 3PY0A 4L7SA 4ZXTA 4HPTE 3MYGA 2VTNA 3OP5A 1CKIA 5CI6A 5TR6A 2QOCA 2QOHA 3WBLA 2PNAA 3OC1A 4ASDA 4O0YA 5HESA 3ALNA 3MPMA 3CEKA 4OTGA 4HPUE 4ZJIA 1LUMA 4ZS4A 5B0XA 3ML1A 2Y9QA 4NYEA 4F0FA 2J0LA 4AUAA 5AP1A 2WEVA 3R7OA 4CFWA 1PMNA 4EJNA 4PDPA 4C58A 3R1YA 2W05A 1BLJA 3OTUA 4HVSA 4QQJA 2CJMA 3D7TB 3GP0A 3OXIA 4B9DA 3KULA 3KXZA 4F63A 4QT1A 2BAJA 2UW6A 3DBEA 5ACKA 3FXXA 5TF9A 2W5AA 3L8SA 5HE0A 2HW7A 3QALE 3R2BA 3BIZA 2WMRA 3FKNA 4DEGA 3TYKA 4AAAA 1KOAA 3H9RA 2GHGA 4OBPA 4FEWA 1SPRA 5K9IA 2VX0A 3NW6A 3DGKA 3GUBA 2A4LA 3R73A 3EHAA 4IHPA 3A99A 3TN8A 4ANQA 1PYEA 2ECDA 4PPBA 3VS7A 2VO0A 4HVDA 2YU7A 1PHKA 2JIUA 4HYHA 5DI1A 1G8KA 1ZMVA 2ITWA 4B8MA 2YN8A 4JDKA 4OT5A 3V8TA 2IJMA 2YEXA 4FKSA 3ZFMA 3ZOSA 4OHEA 3CPCA 4DC2A 4LRKA 1Q97A 4ZSLA 1RE8A 3W2OA 2OG8A 4NM3A 2R64A 1LUIA 4WUNA 2WMXA 1YHVA 3W10A 1TQIA 2CSNA 4DEHA 3QKKA 5CY3A 2PVYA 4G3DA 1Q8WA 3W2CA 1XA6A 5ETFA 4O81A 4ASXA 2LAVA 2ZDTA 5HX6A 5FTOA 2R3QA 2O65A 3OHTA 3MJ1A 4FV3A 5KZIA 4D1ZA 3MWUA 5J9ZA 5JGBA 3ZFXA 2UVZA 5D11A 3VVHA 3UO6A 4M13A 5EFQA 4AA4A 4AN2A 4BBEA 2KGYA 3ZRKA 2IUIA 3A7JA 4NFNA 1G3NA 3EN9A 5A4QA 3K2MA 1P2AA 2WMBA 4O6LA 4R78A 3NUXA 2XNMA 4CLJA 1W83A 5BUIA 3FLNC 3HA6A 3OY1A 4BGHA 2X9FA 4E26A 3G0FA 1FBVA 1SHAA 2CLXA 5IZFA 5CVHA 3PVBA 3NAYA 3L8VA 4PNIA 3Q53A 2OXDA 4IQ6A 4L46A 3TJCA 4XYFA 5B2LA 2IZRA 2XH5A 5DR6A 5HCYA 1BHHA 4BYIA 3PG3A 3LYVA 2OJJA 4MNFA 4EZ3A 2H8HA 3H3CA 4V04A 5CDWA 4X2FA 2VWWA 2J51A 4B7TA 2FSLX 3BYMA 3ORXA 5CAQA 1APME 5JFSA 4V0GA 3BKBA 3UF4A 3R9NA 3MH3A 4IX3A 3KXXA 1ZY4A 4M68A 2X0PA 4ANBA 5DHJA 1PXPA 4BWXA 3OVEA 4I6FA 4N4SA 4PL3A