The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
150
|
sequence length |
612
|
structure length |
545
|
Chain Sequence |
PDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPNMDTSVFESPFSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRNLAARNVLLVNRHYAKISDFGLSKALGPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGGSALEVA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural Basis for the Inhibition of Tyrosine Kinase Activity of ZAP-70.
pubmed doi rcsb |
molecule tags |
Transferase
|
source organism |
Homo sapiens
|
molecule keywords |
Tyrosine-protein kinase ZAP-70
|
total genus |
150
|
structure length |
545
|
sequence length |
612
|
ec nomenclature |
ec
2.7.10.2: Non-specific protein-tyrosine kinase. |
pdb deposition date | 2007-02-26 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00017 | SH2 | SH2 domain |
A | PF07714 | Pkinase_Tyr | Protein tyrosine kinase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Transferase(Phosphotransferase); domain 1 | Transferase(Phosphotransferase) domain 1 | ||
Mainly Alpha | Orthogonal Bundle | Syk Kinase; Chain A, domain 2 | Syk Kinase; Chain A, domain 2 | ||
Alpha Beta | 2-Layer Sandwich | Phosphorylase Kinase; domain 1 | Phosphorylase Kinase; domain 1 | ||
Alpha Beta | 2-Layer Sandwich | SHC Adaptor Protein | SH2 domain | ||
Alpha Beta | 2-Layer Sandwich | SHC Adaptor Protein | SH2 domain |