2OZOA

Autoinhibited intact human zap-70
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
612
structure length
545
Chain Sequence
PDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPNMDTSVFESPFSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRNLAARNVLLVNRHYAKISDFGLSKALGPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGGSALEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase ZAP-70
publication title Structural Basis for the Inhibition of Tyrosine Kinase Activity of ZAP-70.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 150
structure length 545
sequence length 612
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ozoA05
1.10.930.10 Mainly Alpha Orthogonal Bundle Syk Kinase; Chain A, domain 2 Syk Kinase; Chain A, domain 2 2ozoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ozoA04
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2ozoA03
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2ozoA01
2OH0E 2PVKA 1BLXA 2C3IB 2GCDA 2AUGA 1OIYA 3GI3A 5KMNA 3TL0A 1H1RA 2ITTA 5IH5A 3S00A 4UWCA 5KO1A 3C13A 5H2UA 2CKOA 3N4VA 4TRLA 3THBA 5BO4A 4LOPA 2PSQA 2IZSA 5BNJA 3E92A 2O64A 4JBVA 2I6LA 2XB7A 3DFCB 5E8SA 3PJPA 4ASXA 5IG1A 5E91A 4V04A 4JG7A 1M2RA 2QOOA 4E20A 5HLWA 4X2JA 3CGOA 3R8UA 4DF3A 1AGWA 2CS0A 2Y8OA 2FVDA 3FYJX 1U5QA 4X3FC 1MW4A 2J0KA 1O4QA 4BDJA 2YIXA 4O91A 4F7LA 4CT2A 3EQIA 2G15A 3IW5A 3QA0A 1CTPE 2JBOA 4OTDA 5E1EA 3R01A 1CKJA 4YNEA 5CEPA 5AR3A 5JZNA 3GGFA 5KX8A 4EOSA 4AGDA 1OBDA 4LRJA 2RFDA 2W1DA 4QYEA 3HA6A 3W16A 2DLZA 5LWNA 1O6LA 1QPEA 4M66A 1GIJA 4JIAA 2O0UA 4M67A 3VS1A 3EN9A 4FKOA 5J3XA 4CFUA 4OAVB 1IAJA 4EZ5A 3R1NA 3MJ2A 1HCTB 1YOMA 2L6KA 3EOCA 1OGUA 5AR8A 3JVRA 4TN6A 5E92A 3OHTA 3SRVB 4C4EA 4BY9E 2RORA 3MPMA 4C2VA 5HG8A 4CLJA 3BWJA 3F3WA 3TI1A 5CZIA 3TV7A 3PQZA 4FIFA 2PVYA 5IBMA 2EXEA 3MWUA 1YDSE 4JS8A 3VBXA 3AC5A 3GU6A 2C6OA 5IQDA 3FJQE 1WFCA 3E3BX 3P5KA 4RJ3A 4IH8A 2OF2A 4MQ2A 3GC7A 1J7UA 2NRUA 4IMYA 4Y72A 3NUNA 1FU5A 1B6CB 3OCSA 1F2FA 5BVOA 4OGRA 1FMOE 1H27A 1UVRA 3FZTA 2XMYA 2WTKC 3NLBA 4C35A 4TWOA 5I3OA 4CTBA 2XIYA 4EH5A 4ERWA 3PZHA 3UOHA 2ZB1A 1A1CA 4M0ZA 4UV0A 4EH7A 3L8PA 3FDNA 2BCJA 3EFWA 4C33A 3BUNB 2UW0A 4RFMA 4DEEA 1E9HA 3REPA 2WOUA 3ZO1A 4F7NA 2CNUA 4C02A 1FPUA 3A2CA 1U54B 4D2SA 2FSTX 3WF6A 4QTDA 3ZO2A 1YHVA 3UMWA 2GQRA 4IWQA 2HDVA 5FD2A 4G2FA 4PPBA 3NNUA 2YDIA 5JFSA 1BKMA 2GE9A 3M7FA 4DEAA 4FBNA 2F4JA 4D2WA 4E5WA 1QL6A 2C6MA 2Z8CA 3EQGA 3NNWA 4DGXA 4D8KA 2HY0A 4QSYA 3KXGA 4K45A 3R1YA 2C5YA 2EYZA 3QTWA 5DT4A 3FPMA 3VROA 4DE4A 2QOHA 3GCPA 4E6CA 3RKBA 3ZEWA 4A4XA 4BB4A 2B9FA 3WF7A 3R9HA 4EK3A 2WTDA 4OHEA 4V01A 3AGLA 3MYGA 4PP7A 4DFZE 4S34A 4XUFA 1WBNA 3F66A 3UG1A 3AMYA 3B2TA 1PICA 3H10A 1H1SA 4R77A 3CXLA 5I6VA 4HZRA 4ZLYA 3W2OA 4YJSA 5AAFA 5HVKA 3QUDA 4O96A 1IRKA 5H8BA 5LMKA 3ORXA 4G16A 4EQMA 4AOJA 4X0MA 3EKKA 2H34A 3JY0A 3CD8A 4C4HA 3KRXA 1MQBA 3P4KA 4BCKA 1OO3A 3MDYA 1S9IA 3MJ1A 3TUBA 2IG7A 2YCRA 5E8TA 4C7TA 1H25A 4FTJA 4G3EA 4TW9A 3SDJA 3TJDA 3QYWA 4L44A 1J7IA 3T04A 4WG5A 5L6OA 4IZYA 3O17A 2E9UA 4PMSA 2GHLA 4IWPA 2BVAA 5CI7A 3FLWA 4CFFA 4FSQA 1Y1UA 3KN5A 5TE0A 2RMXA 2HELA 3D5WA 3ANRA 3BI6A 1JOWB 3QRJA 4FOBA 2PVMA 3IG7A 2EU0A 4FZDB 3K54A 4H3BA 2HXQA 4JG6A 4L67A 3BQRA 2BDJA 4ANBA 4D0XA 3KRLA 1W98A 1J1CA 3OWJA 3PP0A 4AA4A 2Y9QA 2W9FB 3A7HA 4BGGA 5FQDC 2XEZA 4PWNA 4D1SA 3BX5A 3E63A 4ACMA 4YO4A 2CCIA 3QGWA 5EW9A 5AX9A 2BTSA 3EFJA 3TEIA 2DYLA 2QU6A 2HENA 5GJHA 4ACGA 2X2KA 1FMKA 2WPAA 4NJDA 2JITA 2XBJA 4LV5A 5BUIA 4FL2A 3GVUA 2FB8A 1AYAA 2PE1A 3AD6A 1Q61A 1Y8GA 4O21A 5HG5A 1M14A 2CLXA 1XKKA 4OTFA 4QP7A 4YJQA 1ZMVA 1OIUA 3S3IA 2Y1NA 2OFVA 5ANEA 4BBEA 5D0JA 3DGKA 3IS5A 3NVKI 5EYMA 4CFXA 4FL1A 2BZHB 4ID7A 3FBVA 2L3TA 1BI7A 4FKIA 4YLJA 5L3AA 2ONLA 4E6QA 3H0ZA 3POZA 3WILA 3ALNA 3D2KA 3QX2A 5ETFA 3MVHA 4BKZA 3IMDA 3ZC6A 2YM4A 1J1BA 1UNLA 4EEVA 5CXZA 2J50A 2DM0A 2PY3A 3F5XA 5L2WA 2VWUA 4G3GA 4S30A 4XBRA 4ANMA 4NYEA 4EK4A 3F2AA 4HVDA 4UMUA 1CWDL 1X8BA 2YM5A 3Q6UA 5DVRA 5CEIA 1A9UA 4YR8A 1MP8A 1OM1A 5BVEA 2HMHA 4DH5A 4FTMA 3DQXA 2J0JA 4FMQA 4D2VA 4R3PA 3R7YA 1BL6A 1Z3KA 4BBFA 2R7BA 4QYGA 4BVUA 3DKCA 5I9VA 3OF0A 2XM8A 4P90A 1PXIA 3SOAA 3UOJA 2ITOA 4UYNA 5FG8A 3VJNA 2QMSA 1BKXA 2QONA 2ERKA 4A06A 3RGFA 3BYUA 3HZTA 3E62A 3HVCA 2EU9A 2E9VA 3WZJA 2GFCA 5D7AA 4JLCA 4WRGA 1H28A 2Z7LA 3QWXX 1FINA 3TIZA 4OW8A 4HVSA 2K7AB 1VEBA 4OLIA 3SG8A 1NW1A 3PSBA 2JFLA 4BICA 5GJDA 4XMOA 1OL7A 5AUXA 3RTPA 4TXCA 1YOLA 3FWQA 4QMVA 3MS9A 3MESA 3GNIB 1LR4A 5AP3A 3EIDA 1I44A 4MXYA 2X8IA 4OBQA 4E26A 4C37A 3C50A 3IDBA 1OIQA 3EN5A 5F1ZA 3Q52A 4QNAA 4Y83A 4BC6A 3IDCA 1Z5MA 3F5PA 4F7SA 2QOIA 1F5QA 2XP2A 2YAAA 1XWSA 5CAUA 1A08A 4ZJJA 3LXPA 4O86A 4LOQA 4ITHA 4GUBA 5CEQA 3R83A 3NUPA 5D41A 3QF9A 3DCVA 4UMPA 4O84A 1ZMWA 4G34A 3A61A 4MVFA 4EC8A 5IQHA 3PRIA 4S31A 4YUQA 5AA8A 4ACCA 2ITUA 3Q3BA 4KA3A 3RK9A 3NCGA 3V8TA 5IA1A 3O50A 4O0UA 5EM8A 3K3JA 5CU6A 4A4CA 3RI1A 4KKGA 4JVGA 2B9IA 3QTUA 4AOIA 3TNPC 4BWKA 4YC3A 2BIKB 3DJ5A 1PXLA 4QP1A 4DH1A 3GOPA 2QOKA 3R8PA 3RAIA 5HOAA 2PNAA 3GQLA 2NRYA 2OJJA 4GMYA 2EWAA 4S32A 2R3JA 3FMNA 4KINA 3TNWA 3VHEA 3LQ3A 4KKEA 3E8DA 3O0GA 5L2QA 3C0IA 5EFQA 1NT2A 4XHKB 1Y6BA 4IWOA 4W8DA 3PJ8A 4ZTMA 1SMHA 4K18A 3DOGA 3QUEA 4MXAA 4U8ZA 3I5ZA 3ZXZA 4AT4A 1SM2A 3DPKA 2VTMA 4XG7A 2X8DA 3N8MA 2B55A 4JX3A 2KTYA 3BGQA 5AP1A 4EI4A 4D1ZA 3BCEA 4PDYA 3US4A 5CU3A 2W9ZB 4PX6A 5CWZA 2H46E 3I79A 3HMPA 1ZYDA 3UVRA 2MQIA 2RG6A 2XJ0A 4BCPA 4EWQA 4GL9E 3W10A 4KSQA 3TZMA 4J8MA 3FC1X 3GC8A 4TYHA 3V51A 4OTIA 4O0WA 3FLZA 4YNOA 4ZS0A 2X9EA 4IB1A 4IX6A 3PDTA 1SPRA 5LARA 1E1XA 1SHDA 5TR6A 3CKXA 4QTAA 2WGJA 2ZMCA 3HMOA 3OS3A 4BWXA 4USEA 2XNGA 4IB3A 1RDQE 5IQAA 4RLKA 5K0XA 3CTJA 5DT3A 2C4GA 1H9OA 2V22A 3PLAE 3MI9A 3NVMB 4H3PA 3CPBA 2FA2A 4FV0A 1ATPE 4GVAA 2XJ1A 1Q4LA 3C7IA 5EI8A 4J98A 3VW6A 4OHDA 5EYKA 3RVGA 4YSJA 1AYCA 4RGJA 2LNWA 3ITZA 3TKIA 2JDOA 5CU2A 5D10A 2R7IA 4L53A 5AUYA 3U4UA 3A60A 3F6XA 3OB2B 3LIJA 3F9NA 4ARKA 3R63A 4RX9A 5TO8A 3PA5A 1ERKA 4O1OA 5GJIA 4YC6A 4GEOA 3DA6A 3I7CA 2PMIA 5KMJA 4JEGA 3KMWA 4Q5HA 5CAPA 1AOTF 5KMOA 4B8LA 3KXNA 3AC3A 1H4LA 4MYGA 2BAQA 2UZUE 3FZOA 3EMGA 1SVGA 3V5LA 3PVUA 5B7VA 5ETAA 3RCDA 5JKGA 5L8KA 2VTTA 4WNOA 2BDFA 5EW3A 1RW8A 5E8XA 3PXFA 2X7FA 3COMA 4CZTA 4ZS4A 1HCSB 4X6QC 4APCA 4K11A 3R9RA 1KE6A 1IAHA 1SNUA 1JPAA 2O8YA 4F9AA 4OHHA 2XRUA 2YIRA 5GJGA 4MNEB 5E8VA 2BPMA 3GEQA 3QKKA 5DT0A 1BKLA 5AJQA 1KV2A 1M7NA 4E93A 3QGYA 2NNWB 4AF3A 4USFA 5M09A 4U0IA 4W4YA 5EM5A 3OC1A 5JN2A 2XKDA 4I0TA 2X39A 3A7IA 4M13A 2UZTA 3RJCA 4QT1A 4RIWA 3MXYA 3FQHA 1Q8TA 4BCHA 3ULZA 1FYRA 3GCQA 2V55A 2AC5A 3D15A 3E3PA 3KF4A 3F69A 3VN9A 4R1YA 5HTBA 4I23A 1UKIA 4LV8A 3O7LB 2Q0BA 3QU0A 4KBAA 1XH4A 5AV4A 1WBWA 4DA5A 5HTCA 3ZH8A 4RJ7A 1JWOA 4QMYA 4XV3A 3BHTA 4TNDA 1ND4A 3CQWA 1WBSA 2I1MA 2ITVA 4CRLA 5HBJA 4FKVA 4IBMA 4NCTA 3WA4A 4RIXA 2XH5A 4FTTA 5TOZA 5LVLA 3F7WA 1JAMA 5FBNC 3B8RA 4CZYB 2UZWE 5AFVA 1BMBA 4HPTE 2C6LA 1FVVA 5DC9A 3FKNA 1H0VA 1VYZA 1W8CA 4YU2A 2OIBA 2X1NA 3OZ6A 5IUGA 2PU8A 3MW1A 2V7AA 4FOCA 4APPA 5JGAA 3MY0A 5BMMA 3BYOA 4HNFA 3F2NA 4L3PA 4NZWB 1NXKA 1ZY5A 4WUNA 1F3MC 3ZO3A 3LCOA 2A27A 2X9FA 4R7IA 4ITJA 4NM7A 3PFVA 5AV2A 2OZAA 3LMIA 3BUMB 5A4LA 2PUUA 4BFMA 3LFAA 2B7AA 4G9CA 3G5DA 2QU5A 1I3ZA 3R7GA 1YVLA 2QOQA 5IA0A 1ZYCA 2BTRA 2OBJA 3ZZWA 3ALOA 4D58A 5AUTA 2I0VA 4BL1A 3A8XA 1JKLA 3CTHA 1O41A 4I24A 4O0YA 3FEGA 3PPKA 4M68A 3DTWA 3DJ6A 3SVVA 4FV5A 4J7BA 2BR1A 3QTSA 4RA4A 2BRBA 2RFSA 5DBXA 4AGWA 3RK7A 4BGQA 2BMCA 2H6DA 3Q96A 4R6VA 2HWPA 4XS2A 4G5PA 2EO6A 3A4PA 1OL6A 4R3RA 1OL2A 2JKMA 1SZMA 2VO3A 5AWMA 3PJ3A 1LUMA 4QP9A 5H9BA 2VWBA 3PP1A 4P2KA 4LRKA 4DC2A 3MPTA 4MBJA 2IVTA 1G3NA 3LQ5A 4I6QA 4KNBA 4TT7A 4DEIA 1UU9A 3RMFA 3R9NA 4ASDA 4D4VA 4IFCA 4F0FA 1OL1A 3FY0A 4LG4A 5DRBA 4ZAUA 1B47A 1XA6A 1Y57A 3BEAA 3PS5A 3R21A 3DLZA 1YHWA 2UZVA 2B54A 3PJ2A 5T3QA 4FV6A 1O46A 2UVZA 2H96A 3D94A 3ORLA 3EN7A 3KKVA 3R0TA 4PV0A 4X2KA 4DFLA 4PMTA 4BDFA 4CYIA 3AMAA 4ZSJA 4I5CA 3VAPA 3R2BA 4OTWA 4HZSA 4FKSA 3VUIA 3ORPA 4FGRA 4ALWA 2L4KA 2JIVA 3COKA 2UW5A 2R0IA 2PZIA 4CEGA 4QPAA 3HAVA 4E3CA 5I9XA 4GS6A 3OFMA 2RKUA 5CXHA 3IN7A 2IWIA 4LYNA 2YM7A 5ANJA 2W1ZA 3COHA 4TZRA 1JYQA 4HYUA 3SD0A 2BFYA 2W1FA 3QRTA 2ITWA 3D5UA 3V04A 3L1SA 5GINE 4HYIA 3TTIA 3DXNA 4TY1A 2XNMA 3V8WA 1MRYA 4RJ5A 4L8MA 3AGMA 4L43A 5F95A 5TT7A 3NEWA 5DFPA 3MVJA 3O7LD 4BIEA 5IBSA 4TTHB 4EOQA 2R3QA 2C6IA 4LUEA 3MFTA 4E4XA 2SRCA 4M0YA 4ZTHA 4ANNA 4FV1A 4C62A 5DMZA 5IEXA 2OIDA 1GY3A 1BHFA 3VS2A 5CVHA 4BDHA 1XQZA 2F9GA 1PXOA 2XIZA 3BE2A 4MXZA 3FPQA 2XCKA 1U4DA 2GSFA 4M8TA 1A07A 4BCJA 4CV8A 2W4OA 4R5SA 1UKHA 5K3YA 1KOAA 2C5OA 4IB0A 4EY0A 3VBTA 3VIDA 4R1VA 1VJYA 3OXZA 4MD7E 3ID6C 3FY2A 3BWFA 5JGDA 3G0EA 2W1EA 4KUJA 2MRKA 4AOTA 1WAKA 4JI9A 5IKWA 4QMTA 1O9UA 5FGKA 2YLEA 4EBVA 5AV1A 3FI8A 3NYOA 1A09A 4IX4A 2C3JA 4E5AX 4FA2A 4I4EA 3OUKA 2PYWA 4AZEA 4BHZA 4GU6A 1BLJA 4WHZA 2REIA 3E64A 3GENA 3LFSA 3BV3A 3QQFA 5JT2A 5H8EA 3QWJA 4GFGA 2CR4A 3UVPA 5KHWA 1IS0A 1QMZA 4G3FA 4W9XA 4FSMA 4EYJA 5CYIA 2G2HA 3C7QA 2WNTA 1JKSA 3LM0A 4Y8DA 2PMLX 3DBDA 4RC2A 5JFXA 4L6QA 3QHRA 4A9TA 5J1WA 3NS9A 4K1BA 3QQLA 4JAJA 4JBQA 4DINA 2QO2A 3PY0A 3QD0A 3H9OA 2HZIA 4G6NA 4LGHA 3N4TA 3LW0A 2C0IA 3PUPA 3QC9A 3AMBA 2QHMA 2ZB0A 1Y8YA 2OJIA 3NW5A 4FICA 3DTCA 4HPUE 4XLIA 1AOUF 2OXDA 1OPKA 1J3HA 1URWA 3EFLA 1BF5A 3EWHA 5IF1A 2Y1MA 4FBXA 4IVBA 1YXSA 3HP2A 4TYIA 2CLQA 2CHLA 4FT0A 3CQUA 3UOKA 3WE4A 4BCMA 4QMNA 4ZZOA 4CQGA 4O7TA 3BU3A 4FTUA 4X2GA 2QR8A 3EQRA 4NSTA 3MVMA 3TCPA 4N70A 4AW1A 4FV7A 1ZY4A 2NO3A 2H8HA 2YWPA 2ZOQA 3G2FA 2OGVA 4RJ8A 1O4IA 5E8UA 3WZDA 3P7BA 3JS2A 4NKAA 2BRNA 3QZGA 3BHYA 4QMZA 5L2SA 1OO4A 2E9OA 3LMGA 4WRSA 1O49A 4YTIA 1NA7A 4IAYA 4D4RA 1FBVA 4L3JA 2WKMA 3DBFA 2J5EA 4GRBA 3ZEPA 4AXAA 2WU7A 3HMMA 3FKOA 4RWJA 3U9NA 2B53A 2HY81 4BCNA 5CSPA 5JH6A 3KU2A 3Q2MA 4AAAA 5LMKC 3OTVA 2PUPA 1WBTA 3ENMA 1Q99A 2BUJA 1K3AA 1ZOEA 3RPOA 2YCQA 1PHKA 2CGUA 3HUBA 3MBLA 3S9KA 2QC6A 2DUVA 3R7OA 4DGPA 4D28A 4YZNA 3V6SA 5IEYA 3LFNA 3O23A 4FG8A 4DG2E 4XEYA 4XX9A 4ANQA 5FEQA 5A4CA 1JNKA 3FLYA 4P5QA 3FL5A 4GSBA 5D1JA 3V8SA 4UY9A 4UXQA 4FV8A 3UO6A 3T9TA 3AXWA 2WIHA 3HUCA 4FEQA 4BTKA 2UW4A 4AZSA 5B2LA 5FTOA 3ZDUA 5LVMA 3RPSA 4H3QA 4NW5A 5J87A 4HGTA 2YSXA 1H08A 4QP2A 5CENA 3EN6A 3ZU7A 4PTGA 2VWXA 5IUHA 2C6DA 4FT3A 2IW6A 2OSCA 4PNKA 5C01A 1W0XC 3N51A 4U43A 3H4JA 3KN6A 5E8WA 4EH4A 3LCTA 4E8AA 2A4LA 3PE1A 4TPTA 1IA9A 5M4UA 4BKYA 5FBOA 3AOXA 4HOKA 1PYEA 1T45A 3S1HA 5C8NA 2X6DA 4XOYA 4R8QA 2WMWA 4RG0A 3VUDA 1P2AA 4CKIA 5CANA 2X2LA 3DT1A 2OJFE 4RZWA 4BDGA 2JYQA 4FVQA 3LFQA 3TT0A 2BZIB 3HV3A 2PK9A 4DGOA 3O71A 3RAWA 3KFJA 3LXLA 5FDXA 3NIEA 1FBNA 3FZSA 2YIWA 4PMMA 5J8IA 4ZTNA 4EH3A 1M61A 4DEDA 5IDNA 2W96B 3VBWA 2VGOA 2VWWA 4L46A 4GJ2A 5IH6A 5JQ5A 5CSVA 3VF9A 3F61A 4TYHB 5IA2A 3ATSA 5HKMA 3CC6A 4IZ7A 3HLLA 3NUAA 4U44A 3WYYA 1G83A 2XKFA 4C61A 4OHIA 4E68A 3TACA 1PMNA 2QO7A 5M44A 4RVLA 2RVFA 1Y91A 4F6WA 3CXWA 4HYHA 3PE2A 3U54A 3N7YA 1O44A 4EONA 4U80A 4FV9A 4M14A 3LMHA 3ZO4A 2I0YA 2G01A 4MD8E 3PWYA 4M84A 3UP7A 3P08A 4UMTA 3Q4ZA 3H9RA 3ELJA 4H1JA 4HCUA 4RX8A 4C57A 4CFVA 2A2AA 1YVHA 5IU2A 3BPRA 3NW6A 4RRVA 4RC3A 5T68A 3RNYA 1UU3A 4GK3A 3H9FA 4RWLA 1D4TA 4AZTA 4EK5A 4IJ9A 2VTIA 4JBPA 4V0GA 4C4IA 1GNGA 4C34A 5KCVA 2ZM1A 4BIDA 2WTVA 3JY9A 4XV1A 5I5ZA 5AM7A 5CAOA 4BCIA 3MXCA 3PSJA 2OXXA 4MK0A 4AACA 1PRYA 2VX3A 2JDSA 3LLAA 4ZIMA 3BE9A 4AZVA 3WBLA 3OB1B 5CLPA 4OT6A 5G1XA 5EHOA 2HOGA 4IAFA 1O4BA 5CF6A 3VF8A 4AGUA 5K9IA 3SX9A 3JUHA 3EH9A 1AYDA 3BUXB 3GBZA 2WXVA 2J90A 4FG9A 5D11A 1F1WA 4I5HA 1ZFPE 3BBWA 1KA6A 2J51A 2VWVA 4M15A 4PL3A 5M4CA 4JAIA 4XP2A 5HNBA 4BCOA 5EH0A 4GUEA 1O4JA 2V5QA 3NGAA 2VX1A 3D5XA 4U3YA 3LVPA 3OWPA 1M27A 3GT8A 4FTAA 4QMLA 1JSVA 2XK8A 4FL3A 4RPVA 4MBIA 1XJDA 3FQSA 2P3GX 4EWHA 4YLKA 5KZIA 3QRIA 4O0RA 1ZRZA 2BDWA 4PDSA 4FNZA 3ZOSA 1WMKA 1FHSA 1PJKA 4RIWB 2ZVAA 4U97A 4KIPA 5DRDA 5G6VA 2JDRA 2IZRA 4U6RA 3VS6A 3WZUA 4QMPA 1TVOA 5BUJA 3NNVA 3NAYA 4PL4A 2WQBA 3OBJA 1W7HA 1XBBA 4G31A 2FH9A 3BGPA 2A19B 1XBCA 3K5UA 2G2FA 4FYNA 5CT0A 3TZ8A 4YJRA 1YVJA 4WWQA 5HD4A 5BYYA 5CEKA 2F49A 4YHJA 1OZ1A 2RFEA 4D4SA 2IUHA 3GP0A 1UA2A 3NUUA 1REJA 3R9OA 2YM6A 4BCQA 2IVSA 2LQWA 5BVKA 5AUVA 1OIRA 3HP5A 3IK3A 4CMUA 4UZDA 3KXXA 2QQ7A 1Q5KA 4OBOA 1GZKA 4BDBA 1WCCA 3MIYA 2I7QA 1VR2A 4RIXB 4FIIA 4ZTQA 3OUNB 3R9DA 4O7RA 4D2PA 5IQEA 3F7ZA 2XK3A 3HRFA 3QFVA 1LCJA 3ZLWA 5EHPA 4L52A 2EO3A 3AC1A 3P9JA 5HGIA 4I20A 3VUMA 2X7GA 4CTCA 5HNIX 5J5SA 5L2IA 3KRWA 4GK2A 4FV2A 4ONAA 4ACDA 1IASA 5A6NA 2V7OA 3DKGA 4LOOA 5HO6A 2KK6A 1R1WA 1V1KA 2C3KA 5B2KA 5KMKA 4YGAA 4FI1A 3V5PA 4U45A 2PVLA 1JYUA 4BCGA 5LJJA 2VWYA 2VO0A 2XK6A 2BRGA 1CMKE 4HGSA 2AYPA 3G33A 2OZAB 4IAAA 4JNWA 5M08A 1H00A 3W2RA 3U6IA 4KIQA 3UNZA 3BU6A 3IGOA 4R78A 3BUOB 2R3OA 3FMEA 3F82A 3Q53A 4YJTA 2ETRA 2J6MA 3GQIA 3TIYA 2VTNA 1BI8A 4D0WA 4E6DA 4ZLZA 2YJSA 4KWPA 1O48A 2EB3A 3VC4A 3HCKA 2R9SA 3A62A 3I81A 1LUIA 4C3PA 4BDKA 4ERKA 2IUIA 4MHAA 1M2PA 3GC0A 2PZ5A 5HBEA 3UQFA 4KRDA 4JOAA 3OEFX 3R7UA 4AT3A 4F65A 4FZFB 4TL0A 5CS6A 1YXTA 4FE2A 4FKPA 4DLIA 4D4YA 2YHVA 1AYBA 1PXMA 5HLNA 4EOJA 2VTOA 4O7NA 2C9WA 3SKCA 3QTQA 2IO6A 2XA4A 3OG7A 3BRBA 2CNQA 1RQQC 1XR1A 1D1ZA 1OUYA 5FWKK 2JIIA 4L9IA 3W2QA 2YM3A 5AP2A 5AAEA 1DAWA 3HMNA 3DB8A 5IISA 1XH7A 3CJFA 3DXPA 4F99A 4V05A 1VYWA 2YDKA 3IO7A 3DAJA 4YPDA 3RM7A 3QUPA 2RG5A 3ZFMA 2HYYA 2CMWA 4I21A 5IH4A 3W2CA 2UZBA 4F9WA 3NW7A 2QVSE 3PPJA 2W99B 3MH1A 4RA5A 5EQEA 3VULA 3EYHA 4I5MA 4BZNA 1QPJA 1UNGA 4QPMA 5IQCA 2OO8X 3QTRA 3CLYA 5A4QA 4FSTA 3B2WA 2C30A 2UVYA 4N6YA 1FOTA 4NWFA 2IZTA 2WFYA 3LQ8A 4E4MA 2YAKA 4XNEA 3KK9A 5GHVA 3HL7A 2P33A 3ET7A 4DN5A 4Z3VA 4OT5A 3PVWA 2I0HA 3KCFA 1FGKA 1SVHA 5HE1A 3NPCA 4QOXA 4EOLA 2HCKA 4EOPA 1H26A 3KF7A 4FKTA 3UO4A 3IOKA 4AFJA 4L01A 4D55A 2PUNA 2EB2A 1O4AA 4TYGA 2GDOA 4GFOA 2B0QA 5HX8A 5DHJA 1OECA 2CJMA 1Q3DA 4U79A 3ZLXA 4O7WA 3OVEA 5I3RA 3DK3A 3KRRA 4N4SA 1OBGA 5IMEA 4X3FA 1X0NA 3K3IA 1P13A 5C1QB 2W17A 2VNYA 5HU9A 1ZARA 1IJRA 4L68A 2YCFA 4JIKA 4FTRA 5HICA 4AE6A 2XNNA 4E4NA 3QL8A 5H8GA 3DKFA 3I0OA 4AE9A 4H1OA 5JFVA 4UMRA 2W06A 4LQMA 1CSZA 1OPJA 2XIXA 3DAKA 2CI8A 1H0WA 2VZ6A 3A7FA 2YA9A 4NM0A 4XG6A 4RVKA 4BDIA 3C0HA 1JYRA 2J7TA 5HI2A 2WQMA 1TQIA 2QR7A 1YXVA 3QZIA 4PPAA 5H3QA 4BDDA 4F4PA 4C0TA 2BZKB 2XEYA 3R8MA 3I5NA 3MN3A 1RJAA 3GXLA 4AS0A 4LFIA 5EKNA 1XBAA 3LFFA 4ZTLA 4ANSA 3QRUA 3MGYA 3H30A 5C4LA 4N0SA 2GNGA 5D12A 4FKWA 3KMMA 3Q5IA 4IQ6A 2BKKA 1KV1A 5AP0A 4DH8A 4II5A 5DC0B 1IA8A 2Y4IB 4RWIA 4E6AA 3S8LA 3Q9WA 5C8KA 4S2ZA 3K2MA 3VRQA 2VRXA 4FX3A 4PMPA 3U55A 1JSUA 4HCVA 1O42A 5FP5A 1FGIA 3EB0A 1Z9XA 2YITA 2VV9A 4YLLA 1R0EA 1B39A 2VTHA 3AQVA 4ZSAA 1XO2B 2DWBA 2BHEA 3OT8A 2J2IB 3CEKA 2DCRA 1R1PA 5KE0A 3GU7A 5KBRA 4NWGA 2Z7RA 2J9MA 3W33A 4J52A 4ZJVA 3U6HA 4MEDA 4OTGA 3U6JA 3UNKA 3EKNA 2F7ZE 3HAMA 4O7YA 5HO7A 5J7BA 5FUTA 2WTIA 4YPSA 5IQGA 4U9AA 1AD5A 2LAVA 4DFYA 4HYSA 4RT7A 2ZDUA 4U3ZA 3S95A 3SW4A 2X81A 3IKAA 1IR3A 1V0OA 3EQCA 3R73A 3VRYA 4XLVA 2ZMDA 4I6FA 4WO5A 5AP4A 4ZK5A 2JAMA 4D2RA 2HDXA 5M55A 4N6ZA 4FF8A 3I0QA 2ZAZA 2RSVA 1CWEA 2QCSA 2RFNA 3PYYA 2WTWA 3TG1A 1M7QA 4D1XA 4Q9SA 2XKCA 3GU5A 1OPLA 2QI8A 1H1PA 3E7VA 3NRMA 2QOCA 3L8VA 3OVVA 2QOLA 1YWRA 2C5XA 4DEGA 1KUTA 2VD5A 2X0GA 1LKKA 3RWQA 4GH2A 1TKIA 5DR9A 2WQNA 2GS6A 3QCQA 4G1WA 3FZPA 4RSSA 2EYYA 4IW0A 3VRRA 3KVWA 3FMHA 4G6LA 5BUEA 3ZSGA 1FU6A 1YDRE 2P0CA 4QMMA 4CQEA 3GB2A 5DIAA 3DAEA 1UNHA 4MXXA 2PL0A 4LUDA 4QQCA 1UV5A 2YACA 1NVRA 3MTLA 1RJBA 2C6KA 2OKRA 3DFAA 5HKWA 2ZV9A 4ZSGA 2B1PA 3HX4A 4MD9E 1B38A 2OXYA 4AA0A 5I4NA 4A9RA 3FHRA 4H36A 2BRHA 4W4VA 2HWOA 4AFEA 4DEBA 2O5KA 4JQ7A 4QMWA 2EYVA 3CCNA 3L9MA 1DS5A 2X2MA 3FMLA 4F09A 5CF5A 3DLSA 1P5EA 2F7EE 2FGIA 1UURA 2XKEA 3QRKA 3OCBA 3BGZA 2A0CX 5CNNA 5GJFA 5DH3A 4YZDA 4AP7A 1XH9A 4J8NA 1NZLA 4GYIA 5M4FA 4CFNA 3OD6X 4FK6A 5EYDA 2BAKA 2ZYBA 1STCE 3VBVA 3QTZA 4UXLA 4CMOA 4PUZA 5CEOA 3DNDA 3FMJA 4OHLA 3ROYA 4PDPA 5CX9A 1H01A 2HK5A 4FKUA 5AP6A 2WMTA 3FMKA 4JG8A 2Z02A 5J1VA 3UQCA 2R2PA 1HOWA 2R3PA 4XYFA 3ORTA 3O51A 5A4TA 1W82A 3BLHA 4WKQA 5DG5A 3QHWA 5DR2A 3RCJA 4EZ3A 3UIUA 2XZSA 2J0LA 4F7JA 1KE5A 3OY3A 3UYTA 3MB6A 3Q2JA 4JE4A 4BYJA 1E1VA 3DB6A 3EHAA 2YZLA 5J5TA 2ZV8A 2QURA 4WOVA 4XG4A 5HIDA 3KA0A 5HEZA 3GC9A 3NYXA 4WA9A 2AUHA 2W1GA 2W5BA 5GZAA 3UC3A 3VS0A 4PNIA 1GZOA 2GNFA 2OFUA 2YN8A 4RX7A 4ZTSA 3RHKA 3UPZA 5EELA 4AW5A 4XJ0A 4UX9A 3L8XA 3VBQA 3KC3A 3QAME 1OI9A 4UALA 2YERA 4JBOA 5DI1A 2PLEA 3M1SA 4DTBA 4JT3A 3LCDA 3ZBXA 5J9LA 1F0QA 2XM9A 4YJNA 3GUBA 4D2TA 3PG1A 4C36A 3UMXA 2JC6A 3OT3A 3FZRA 3Q4CA 5JFWA 3ZM9A 5M4IA 4DAWA 4DGNA 3PZEA 2YISA 5B0XA 4TKSA 3MA6A 4MXOA 3FXWA 3R7IA 2PTKA 3ORZA 5JEBA 5A54A 4C2WA 4DH3A 3PLSA 4G17A 4IE9A 1H1QA 4TWNA 4YBKA 3ZFXA 4W9WA 4BIBA 4BKJA 3RNIA 1BLKA 2WMQA 4CCBA 3OOMA 3VNTA 3EACA 3JYAA 4K9YA 2Y3AB 4KS8A 3LAUA 5I9YA 2W4KA 3A7GA 3DU8A 3UNJA 3F88A 1PXKA 5CSWA 3R7EA 5CSHA 2HIWA 1CDKA 4V0GB 4BRXA 3IMJA 4FV3A 4PQNA 3UO5A 4Y46A 5FDPA 3RAHA 4CYJA 5KHXA 1T46A 4CXAA 3SA0A 2QLUA 4NIFA 3KCKA 3NHNA 3DK7A 3IPHA 2IZVA 3II5A 4DCAA 4IC8A 4FVRA 3AC8A 3TKHA 3MAZA 1CSYA 2XK7A 2WIPA 3R71A 2B4SB 1V0PA 4EOMA 4GPLB 2ERZE 4F1TA 4QYFA 3Q9XA 4F0IA 3LHJA 4Q2AA 4HVGA 4GT5A 4RIYA 5KKRB 2R3MA 4Y5QA 4XG2A 4EIHA 5AR2A 4GK4A 4XP3A 3PSKA 3RHXA 1LPUA 3E87A 3PSDA 3VO3A 4FKRA 3HHMB 3MIAA 5L6WL 3DXQA 2F57A 2BRMA 5E8ZA 2GHGA 4KABA 5ETIA 2HUWA 5J7HA 4FZ6A 3IONA 5ANKA 1O4CA 5ANDA 2PLDA 5CASA 5I0BA 4FSRA 2GNHA 2W1IA 4MTAA 4J97A 3D9VA 4ZY5A 2IZUA 4J1RA 2JBPA 4O0TA 5GIPE 4L42A 4Q5EA 2BROA 2YLFA 1KC2A 2WEIA 3OY1A 5TF9A 2QG7A 2Y7JA 4PY1A 2CIAA 2ITYA 4WD5A 4EQCA 4WNPA 2VWZA 1PW2A 4QYYA 1O4RA 3R2YA 4FNYA 2XRWA 2RSYA 3SGCA 5E4HA 4CKJA 5L4QA 4DTAA 3BYSA 1OB3A 4AG8A 3QD2B 3PFQA 4FIJA 4IANA 4DGGA 4RZVA 3UBDA 4F08A 3QQUA 3C5UA 1OVEA 1R0PA 5EQYA 1YI6A 4J95A 3ZDIA 5F4NA 5DYJA 4JGHA 1MILA 3VGOA 4J99A 2JLDA 4FTQA 4XV9A 3QLFA 4L45A 5KZ0A 3QWYA 3MH2A 4JL9A 4LGDA 1GOLA 3D14A 4AZFA 4AQCA 4QP8A 1YW2A 3V5WA 5AUWA 1G5SA 3EFKA 3R8ZA 4HW7A 2WELA 4UZHA 4ALVA 2J5FA 5M06A 3TZ9A 2PNBA 4AW0A 1KE7A 1REKA 4IJPA 4QP6A 4O7ZA 4C3FA 4U41A 2ETKA 2V62A 2BILB 3DDPA 3DDQA 4P7EA 3F3ZA 3UIXA 5BMSA 2C69A 1O4KA 4IM0A 3FXXA 4FIHA 4I1ZA 3R22A 1LUKA 3IECA 5I9WA 2CGWA 3VUKA 4B0GA 3SW7A 3FI3A 1A1AA 3NNXA 5EDPA 3QALE 3U51A 3HV7A 4DGLC 3GQIB 3QD4A 3ATTA 4IX3A 2LCTA 5EHYA 4M3QA 4R3CA 5CF4A 5EW8A 3VW8A 4O1PA 2CPKE 3NSZA 3WI6A 4O27B 3MA3A 5EM6A 3S2PA 4E5BA 5A14A 3D7ZA 4BDEA 3O8TA 4NEUA 3OWLA 5LMBA 3S8OA 1UUSA 4B6LA 1BUHA 4NTTA 5AR5A 3PWDA 3Q32A 4GFMA 4ENYA 3DNEA 1SNXA 2FYSA 4MQ1A 4PF4A 4GJ3A 4YZ9A 3ZUTA 3FLSA 4NH1A 3LKMA 2GSBA 5BVNA 3VUTA 4G6OA 2X4ZA 3ZLSA 1BYGA 3EL7A 4IAIA 2PVHA 4ZOGA 4HCTA 4TWCA 3GCUA 4BCFA 4DTKA 4NT4A 5KUPA 3TKZA 1ZOHA 3CTQA 5FTGA 3IQ7A 2CKEA 4IX5A 4O2PA 5IQBA 3CBLA 1BFIA 5HO8A 3G6HA 3HV4A 2E2BA 5JQ8A 4X3JA 1OKZA 1O4LA 5HKZA 3PTGA 1R78A 2PMOX 4FUXA 4IWDA 5HZNA 3C9WA 4ZJIA 3M11A 3RWPA 3EQDA 3NYNA 2B9HA 5BYZA 4ZY4A 3LFCA 2YJRA 3TDVA 3OROA 3DBEA 2OF4A 2UZNA 4HVHA 5ACKA 3V6RA 4C58A 4KD1A 3QTIA 4B99A 1D4WA 3ZRKA 3AD5A 2UV2A 3P86A 4BGHA 3BV2A 4QQTA 5FM3A 4MCVA 1YOJA 1BMKA 3VWAA 1H8FA 2XF0A 2QLQA 4G3DA 4C3RA 4M69A 2FCIA 3PXKA 3QA8A 4O82A 4NM5A 2JIUA 3PLFB 1W84A 3OMVA 1Q8ZA 4GG5A 4WG4A 4A07A 5HORA 3ZCLA 4WNMA 2BHHA 4U42A 2XYUA 4BWPA 1AB2A 1YXXA 2H9VA 3BIZA 3ZONA 2LNXA 1PXJA 3NMUF 3MVLA 2UZEA 2WTJA 3QQGA 4U40A 1MRUA 4X3FB 4YHTA 3F5GA 5HESA 3A99A 4AT5A 4IEBA 2W1HA 5L8LA 2VO7A 3C4FA 3I6UA 1DI9A 4C8BA 2CCHA 2SHPA 2UW6A 5DA3A 2B3OA 1JVPP 4EC9A 2WO6A 5IPJA 3LFDA 1SPSA 1O43A 2PVJA 3VBYA 4RLLA 4O7LA 2XBAA 2Z2WA 4AN3A 2BALA 1R39A 4I22A 3E7OA 3QQKA 3KREA 2OIQA 4TNBA 2QHNA 1YI3A 4YZCA 2PUIA 2HXLA 3FMMA 4FNWA 3PXRA 4FTKA 4EKKA 4YTFA 2WMBA 3LE6A 3L9PA 3MSSA 3SV0A 4NM3A 3K2LA 2IPXA 4KB8A 2QD9A 2YM8A 5LQFA 4FZAB 1BFJA 4LMNA 3Q4UA 4MWHA 5JSMA 4NL0A 2CRHA 3UZPA 4IM3A 1JKTA 2BZJA 3CD3A 5CVFA 4O81A 1A1EA 2IN6A 4FSWA 4X2FA 2VU3A 3NWWA 4BTMA 3RZBA 1CKPA 4X2NA 1OKYA 2UVXA 3R6XA 5DN3A 2YWVA 4ANOA 5E9EA 1PKGA 3BELA 2OICA 4FKLA 4I4FA 4E7WA 4DHFA 3GOKA 2FSMX 3SXSA 2WTKB 2W5AA 3VS3A 2LQNA 3L8SA 2P2IA 3UPXA 1Q62A 5HX6A 2YZAA 4O7VA 3HKOA 5ACBC 3IGGA 3GCVA 4I3ZA 5CT7A 4KIKA 3BQCA 2CKQA 5K5XA 2C68A 3WYXA 3KXZA 2R3IA 2VTLA 3DBQA 5LWMA 2FSLX 3E8EA 2YU7A 2ONLC 4LL5A 2X7OA 4DFUA 1Q97A 5DPVA 4BZDA 1OUKA 2R3NA 5LMAA 3E88A 3MFRA 3UZRA 3LCKA 2AC3A 3LCSA 4EH9A 5K0KA 4XG3A 5HIEA 3C4XA 4CV9A 2I40A 3EL8A 4F9BA 5BPYA 5E7RA 3ZUVA 2XS0A 2GS2A 4E4LA 3W2PA 2ETZA 3AG9A 3DS6A 3M42A 4Y5HA 2YIYA 4ZZMA 4ZMFA 1BG1A 1PY5A 2DS1A 2PE0A 4YJUA 2EKXA 4FTCA 3MB7A 2YABA 3PRFA 5EM7A 1NRVA 4ZY6A 3CR0A 2CN5A 4BR3A 5JGBA 4QTEA 4X7QA 5BYLA 2RL5A 1PXNA 4FTIA 4BF2A 4BN1A 2VIFA 2UZOA 4FTLA 3QXOA 3Q60A 4MWIA 3NIZA 4NTSA 5BVWA 4IIRA 3OCTA 1KSWA 1CSNA 4O0SA 3PY3A 4XRLA 3GU8A 3TNIA 5AV3A 4O22A 3UJGA 4H05A 3MPAA 3KB7A 4H39A 5KNJA 3KRJA 3DBCA 4HGEA 2B9JA 4M4ZA 4IDVA 4UB7A 5FEDA 5AUUA 3FUPA 4RFYA 3ZLYA 1ZYSA 3O96A 1KE9A 4PRJA 4DGMA 4EJ7A 5AXIA 1M52A 1A06A 1KWPA 3R7VA 3Q04A 4A9YA 4EK6A 2GPHA 3CP9A 2EXCX 3ENHA 3QTXA 4L7FA 5LCJA 1LKLA 4EHVA 3UYOA 2XIRA 3D0EA 1O4EA 2BBUA 1ZLTA 3PJCA 2OWBA 3L9LA 4IVCA 3P79A 4EHGA 2QG5A 2I0EA 3LJ0A 4FNXA 3TZ7A 4AN9A 3G15A 2XNBA 5HHWA 4CFMA 5IA3A 4NKSA 3QWKA 1OMWA 1FVRA 4JXFA 5FP6A 2C3LA 3LPBA 2ITNA 5GIOE 3C0GA 3IW7A 3D2IA 2VGPA 1QPCA 3FMDA 3HRCA 4IVAA 4KIOA 1IG1A 4EHEA 3LXNA 4F70A 2DX0A 5LCKA 3Q9ZA 3KULA 4FKGA 3MH3A 5HLPA 4EK8A 4CGAA 4GT4A 1JBPE 1TCEA 2F2CB 3FC2A 3RM6A 4XV2A 5EYCA 3D4QA 5L8JA 4AX8A 4K6ZA 3JXWA 3QCYA 5K4IA 4UWBA 3RAKA 3I4BA 3LFBA 4BYIA 4U81A 4ZSEA 1QG1E 4QPSA 4QQ5A 4ASZA 4Q9ZA 3G90X 5CEMA 1V0BA 3TJCA 2DQ7X 5CQUA 4YJOA 4FVPA 4ANLA 3TUDA 2WMSA 4ZEGA 3MY1A 4FT7A 3DKOA 3FKLA 4FT5A 2BAJA 3CIKA 3GFWA 3R1SA 5HVJA 4LRMA 4F63A 1KE8A 3VS7A 1Q8WA 4BDCA 3BLRA 5EHRA 3PA3A 3LLTA 4S33A 2IW9A 4RQKA 5M07A 2XP1A 2A1AB 4AW2A 4I93A 5DEYA 5LVNA 4UWYA 2YEXA 4UMQA 5M57A 2VTPA 1KOBA 5DWRA 1LCKA 2W5HA 4CFWA 3FYKX 4P9ZA 2ITQA 2E9PA 4I0SA 1RE8A 3E8CA 3C5IA 4W8EA 3UZTA 1HCLA 1GIIA 1OITA 2XIKA 3CY3A 3QQJA 2EUFB 3EN4A 4F1MA 3D7TA 1CM8A 2UZDA 3O2MA 2ZJWA 2R3RA 4U5JA 2C1AA 4RVTA 3AC4A 5HE3A 2JKQA 2PMNX 3I1AA 5IEVA 1HCKA 2XNPA 3N4UA 1P4OA 4RJ6A 2VX0A 3AT3A 3QCSA 4R7BA 1JWHA 1NY3A 1UU7A 4LM5A 3R8VA 1GAGA 4PPCA 5CZHA 4WG3A 4KBCA 1CKIA 4RX5A 4J71A 4Z9LA 4GIIA 4NIFB 1APME 3G9NA 1QADA 4K33A 3WF8A 4E73A 4JR3A 4MBLA 1O4DA 3OW3A 1R1SA 4FR4A 3VRZA 2QNJA 2IW8A 3OWKA 5KBQA 5BQ0A 2ETMA 4ASEA 3ZNIA 2ACXA 3V01A 4BI0A 3QCXA 1OKVA 2XYNA 4RIYB 3PG3A 4H1MA 2JKOA 5HCXA 5HNGA 4XOZA 3TN8A 2R3LA 1ZMUA 5C27A 5HCYA 5F94A 3MTFA 4XRJA 2WMAA 5DNRA 5CDWA 4EQUA 4OTPA 2QKRA 4FC0A 4UYAA 4FTNA 2C0TA 3FXZA 5HQ0A 3ZYAA 2WHBA 2Q0NA 2HZ0A 2YDJA 2QKWB 4AA5A 1BL7A 2PVRA 3RZFA 4F59A 4D5KA 4ZXTA 4JRVA 1GZNA 3FL4A 5AMNA 4YP8A 2C47A 4ZZNA 5E90A 2GQSA 4NFMA 1P14A 3DY7A 2Z7SA 4YC8A 3AC2A 3D5VA 1AQ1A 3G9LX 3VQHA 5CU0A 3FAAA 1RPYA 1BX6A 2X8EA 3EJ1A 4BTJA 1SHAA 3VRNA 2HZ4A 4CMTA 2JGZA 3IDPA 4HJOA 5DE2A 5LXMA 3UDBA 2ITZA 3QZHA 4RC4A 2G2IA 3DZQA 5DF6A 3IOPA 3H0YA 4I92A 3QKLA 3V3VA 4FV4A 5KMIA 4QTCA 3G0FA 3R02A 4DBNA 3LJ2A 1K2PA 3QQHA 2IVVA 4E1ZA 5D9HA 1O4NA 3VHKA 4LGGA 4DLJA 5M53A 4NCTC 3NCZA 3TV6A 3C4CA 3PA4A 3PXZA 2X4FA 3IW8A 3F5UA 1Q41A 1O4MA 4FT9A 3CE3A 4FK3A 2JFMA 3E8NA 4JQEA 1P4FA 3HECA 3KQ7A 3OEZA 4Z7GA 4WT6A 4GWFA 4EOKA 1XHAA 3SQQA 4CSVA 5A4EA 1L8TA 3W1FA 4EKLA 2OG8A 5KMLA 4IM2A 4BTFA 3GXXA 4X6SA 2J0IA 3AT2A 4MAOA 5AUZA 4A7CA 2EOBA 5L2TA 1OL5A 3COIA 3FSKA 4FSUA 4IZAA 2VN9A 4PP9A 4QMOA 3EYGA 2R3GA 3ZRLA 2NP8A 4JDIA 5FLFA 2G1TA 4ALUA 4JDKA 1U5RA 2PVFA 2R3FA 1X27A 5ITAA 5J95A 5AIKA 4YBJA 5EDRA 1J7LA 3ZBFA 4EH2A 3F3UA 3HYHA 4JDJA 4QYHA 3C4EA 3KXMA 2C5VA 4WBBB 1JQHA 1UWJA 4YSMA 5FRIA 5FXSA 3SXFA 3VJOA 1FBZA 3WOWA 4AU8A 1WBOA 3M2WA 5ANOA 3T3VA 3KL8A 3RP9A 2XCHA 4ITIA 3FI2A 3OXTA 5CSXA 4HVIA 4CLIA 1PMVA 5EOLA 5JRSA 3UE4A 5AAGA 1X6CA 1ZOGA 2WZJA 4OR5A 3SHEA 3ZSIA 1U46A 2J4ZA 3KXHA 3PXQA 1JU5A 4O6EA 4GT3A 2R0UA 4PL5A 4QP4A 4A4LA 4BHNA 4F9CA 4DT8A 4F64A 1MRVA 2OZOA 2YFXA 4R7HA 3SLSA 2EL8A 1LEWA 4BBMA 3QD3A 5BX0A 4AUAA 4XG8A 3QXPA 2W0JA 3HDMA 2WQOA 1SVEA 2WU6A 3FQEA 4MX9A 1ZYLA 4LL0A 5J9YA 5JK3A 3ZM4A 2Z60A 3OP5A 3LFEA 3ORMA 4ZLOA 4FODA 1M2QA 1WBPA 1G8SA 3OW4A 4H34A 2Y0AA 4IAKA 4IADA 2ECDA 4GV1A 1DM2A 3BHVA 3DQWA 3PIXA 3R28A 4FSNA 4MXCA 4NFNA 1XH6A 1SHBA 4YTCA 2JDTA 3KGAA 4O7SA 2UW7A 2WOTA 1GIHA 4GIHA 4M69B 1LP4A 3CGFA 4CRSA 4OUCA 1PMEA 3NYVA 4OTRA 4QMXA 3R8LA 3RALA 3TWJA 5CTPA 1A48A 3UQGA 3WZEA 4F6SA 3E5AA 2GNLA 5LOHA 3T9IA 3C4ZA 3HV5A 1CJ1A 4O6LA 2KNOA 2Y6OA 4AWIA 1IEPA 1YKRA 4GYGA 4KBKA 3W18A 4U17A 5A3XA 1GZ8A 4I5PA 5DLSA 2XUUA 4NJ3A 1O4PA 3DJ7A 3GCSA 3SC1A 5K4JA 1O45A 4IDTA 3ORKA 4QMQA 4M12A 3W32A 3MFUA 4IC7A 1SYKA 1KA7A 3NX8A 3BYMA 4M97A 5EG3A 3UC4A 1SKJA 4CT1A 4L3LA 4FSZA 3EQPA 3U4WA 1LUFA 1UU8A 4NU1A 4Y95A 2UUEA 4GU9A 4QRCA 3W2SA 3WIGA 4FEVA 1YHSA 5EDQA 1WVWA 4KS7A 1NVQA 5DR6A 2VWIA 2UW8A 3WF9A 3VQUA 4A9SA 4Z7HA 5CF8A 1LUNA 4O2ZA 1ZWSA 2CGXA 3ACJA 3VUHA 3PPZA 3WE8A 1TQPA 2FO0A 2F2UA 4NUSA 3EQFA 4ZP5A 5IA5A 3BHHA 3AT4A 2IJMA 1Y6AA 4R5YA 3QYZA 4RVMA 3SRVA 2FSOX 5M56A 2V0DA 2PZYA 4UBAA 4XG9A 3KFAA 2VTQA 4A4BA 2C6EA 4YURA 1MQ4A 5JMSA 4WSYA 4Y73A 1A81A 3O8PA 4GKIA 3E93A 3HNGA 3TKUA 1DI8A 2Y4IC 4H58A 4HNIA 5HBHA 3VUGA 3TXOA 5AP7A 2E9NA 3GFEA 4FYOA 2CSNA 4IXPA 4JR7A 4P4CA 3VS5A 4BI1A 5HCZA 2HZNA 2EXMA 3WZKA 2P55A 3HRBA 1ZZ2A 2B52A 5LVPA 5HTIA 3L9NA 1NZVA 4FSYA 4ENXA 1DAYA 4I41A 3A4OX 4FIEA 1RQQA 4KKHA 2R4BA 4LI5A 4G9RA 2R3KA 4GL9A 3UGCA 3OOGA 3W55A 4CD0A 3VRPA 5JZJA 4U7ZA 4F1OA 4KRCA 4KIKB 4YZMA 4I0RA 4QTBA 5KAZA 4C38A 1WQUA 2G9XA 4XH6A 5C26A 2Z7QA 3NZ0A 5BVDA 3QX4A 4TYJA 1U54A 3CQEA 4I6BA 4L7SA 2XNEA 4RBLA 3U8WA 2CN8A 3FLQA 4OTQA 3RBWA 5L6PA 5EK7A 4USDA 3V5QA 4YJVA 4B9DA 5EI2A 3UG2A 4F5AA 4TYEA 3ZRMA 3ROCA 3UOLA 5J79A 3Q9YA 5IDPA 1K9AA 4F6UA 3MFSA 3P23A 2QOFA 1O4GA 5I9UA 2ZM3A 2Q83A 2X6EA 1FQ1B 2PULA 3PSCA 1YQJA 2JKKA 3CJGA 5DGZA 5FM2A 4MNFA 5IMXA 3CWGA 2MC1A 4B8MA 5I9ZA 3KVXA 4JJRA 3RINA 2GHMA 1JLUE 5EQPA 4QD6A 1H24A 3NDMA 3NUYA 4WNKA 5EOBA 2GNJA 5CI6A 2VTRA 3FZ1A 4YJPA 4YZBA 2K79B 4I94A 4YTHA 5B2MA 3P7CA 5AM6A 4EHZA 3JR1A 3ACKA 5DC4A 4G5JA 4A4OA 1O6YA 3BBTB 3HV6A 3BZ3A 2JEDA 5HG7A 4WUAA 2XK4A 2Y4PA 4GG7A 4RMZA 3A8WA 5CVGA 4RWKA 4WBOA 2ESMA 1BHHA 4QMUA 1A1BA 3PVGA 4DFXE 4NWMA 3G51A 1YI4A 3K5VA 1I09A 1BM2A 5LVOA 4EORA 3A7JA 1TZEE 3N9XA 2HW6A 3ORIA 4GW8A 4IZ5A 2CDZA 3C4WA 5M51A 4ORKA 3ULIA 4EOIA 5IUIA 5C4KA 2GS7A 1PXPA 3D83A 3PIZA 1W83A 3S0OA 4TZIA 4KSPA 4K77A 3KEXA 4EZ7A 5IQIA 4Y85A 1H07A 3PXYA 3LOKA 3HEGA 3UYSA 2PWLA 1YWNA 3W8LA 4F9YA 5GNKA 3KK8A 3CSVA 4K8AA 1R1QA 4MH7A 2OQ1A 1R3CA 5AX3A 1ZAOA 3OXIA 2YCSA 5EKOA 2RIOA 4W4XA 2DVJA 2AOAA 5KMMA 4U1PA 3H3CA 4FG7A 3MV5A 2AOBA 2R5TA 4EL9A 4NW6A 3KULB 4FZ7A 1J91A 5EI6A 2P2HA 1YRPA 5IZFA 2PPQA 3IW6A 2OH4A 4JRNA 4CNHA 5CNOA 4DT9A 2FUMA 4CVAA 3Q5ZA 3Q6WA 2VTAA 5FTQA 4C4FA 4YMJA 3S8NA 4BI2A 1ZYJA 4G3CA 2WQEA 4XP0A 3NR9A 4K0YA 4AGCA 3U9CA 2C0OA 3EZRA 3F2RA 5CY3A 1EH4A 4FTOA 5BVFA 5HG9A 3PVBA 4Z55A 3IW4A 3R1QA 4GCJA 3BLQA 1GHUA 5EHLA 4CKRA 5HKYA 4FKJA 4PDOA 1G8AA 2XVDA 4QO9A 2KULA 3BEGA 4O38A 3UIBA 2WB8A 1ZXEA 4ACHA 1Q8YA 4D9TA 5GZ8A 2QO9A 2UW9A 4XZ0A 2UZLA 3QZFA 3RK5A 4FEWA 4L1BB 3RPRA 4FUYA 3RPYA 4DYMA 4JQ8A 2ITXA 3HA8A 3OCGA 5FXRA 4QNYA 4EUTA 1XH5A 2PE2A 2YIQA 3JVSA 5AR7A 5F20A 5CALA 3TUCA 4ZMEA 3ANQA 2VUWA 4CCUA 3SOCA 4EBWA 4EUUA 2OLCA 2JD5A 1ZZLA 2H5KA 2OJ9A 4AZWA 2GQGA 2LGCA 4F5BA 3ZZEA 3D7TB 4DG0E 3KMUA 1Q3WA 4GVJA 3ZMMA 2JAVA 3QC4A 5EG3B 5AADA 4X21A 4X6RA 4ZSLA 3Q4TA 3TNHA 4YO6A 4N57A 4QQJA 2OI4X 3FSFA 3ODYX 4B4LA 3ODZX 4DBXA 5CQWA 3UP2A 3BKBA 2P4IA 2GNIA 3WARA 1TQMA 4D9UA 2GTMA 4IFGA 2GMXA 5HE2A 4EH6A 4QMSA 4RJ4A 2BKZA 2GU8A 3V5TA 2WMXA 3O8UA 3TNQB 3TV4A 2Y6MA 2ZM4A 4XBUA 2RGPA 3QLGA 3WIKA 3FE3A 3F3VA 4C59A 3P78A 3R04A 2WTCA 2PZRA 4HGLA 4JX7A 4DEHA 5JRQA 2WEVA 1O47A 4P9VA 1WBVA 2XNOA 3ERKA 3C1XA 4KAOA 5CAVA 2WAJA 3HIZB 3QKMA 2VO6A 2WMRA 3BU5A 5KKRC 3DV3A 2F7XE 3JPVA 3FLNC 3ZUUA 4AN2A 2W1CA 3BYVA 4ZTRA 3GU4A 4W4WA 3U87A 4PTEA 4WIHA 5GZ9A 3POOA 4TWPA 2IVUA 4A9UA 4EOOA 2ABLA 1FVTA 4DFNA 2W05A 2XK9A 3FV8A 2IUGA 4O0VA 3BHUA 4GKHA 2O2UA 4D5HA 3VVHA 2BIYA 3DZOA 4RFZA 3F3TA 2CNVA 3NAXA 1URCA 4I6HA 4CZUA 1PKDA 3TDWA 3CKWA 3BUWB 3LXKA 2R64A 5AP5A 3I6WA 4O0XA 3MH0A 2CGVA 1O6KA 1UWHA 3ZSHA 3G6GA 3OP0A 5EEQA 3SAYA 3TL8A 4DCEA 1GRIA 2ZDTA 1VZOA 2XJ2A 3I60A 3UVQA 4M7IA 5AR4A 3ZTXA 4DFBA 4DH7A 3ETAA 4FEUA 4FEXA 5A6OA 5DOSA 5C03A 1QCFA 5K5NA 4OTHA 2PHKA 3PJ1A 2PZPA 2WD1A 2VAGA 4NK9A 1PMUA 3LM5A 4IACA 3UIMA 3P0MA 4OAUC 1JSTA 2QOBA 4QP3A 4UEUA 3TTJA 3R30A 4C4GA 1Q8UA 2O65A 1JKKA 2OK1A 4FIGA 4K2RA 4B7TA 4PTCA 2R3HA 3NUXA 3R00A 3ZXTA 4UN0C 4K44A 5C9CA 1O4HA 2HAKA 5E8YA 1YWVA 5HIBA 3I7BA 4JDHA 3ZFYA 2CI9A 3KY2A 5AEPA 2PVNA 3TM0A 3OV1A 1OKWA 3QBNA 5IA4A 3V5JA 1WVYA 3VS4A 5AV0A 3HMIA 4EH8A 4BZOA 5HE0A 4WSQA 2J0MB 3CS9A 3UODA 4XZ1A 2VNWA 3IN8A 1PYXA 4MKCA 5ICPA 5DEWA 2ITPA 3LZBA 4IVDA 2O3PA 2HW7A 4RQVA 2CKPA 3OBGA 3N84A 1H1WA 1QPDA 2ZV2A 3PIYA 2BFXA 1WVXA 5AULA 1Z57A 5HD7A 3EQBA 1GJOA 3WF5A 3HDNA 4XCUA 3SXRA 3P7AA 5F9EA 2RF9A 5D7VA 4C4JA 1S9JA 4J53A 3ZHPC 4F0GA 5HU3A 2GTNA 2CBLA 2O63A 2DLYA 1O4OA 2MRJA 4IHPA 3EZVA 3EQHA 2VTJA 2WMVA 4J96A 5E1SA 3GXWA 4L00A 2GFSA 5ANGA 5HVYA 3ZS5A 3C51A 4BDAA 1Q24A 3FI4A 1XH8A 3CPCA 3W8QA 5T6KA 2OU7A 2OJGA 2EVAA 5ETCA 4MF0A 2JDVA 3DK6A 4DG3E 5J9ZA 4MF1A 2C6TA 3PY1A 4OBPA 3NUSA 2OW3A 2UW3A 2ZV7A 5ANIA 5TKDA 5CAQA 3T8OA 1BHHB 3OTUA 3AD4A 2QODA 3ZC5A 3P1AA 4FGBA 3T3UA 4Z16A 5A46A 4CG9A 1YDTE 4RIOA 4YHFA 4IB5A 4O83A 5IQFA 3EAZA 5A9UA 3UF4A 3B8QA 2VTSA 1LEZA 1MUOA 1U59A 1M17A 1NVSA 1WZYA 4MNEA 1O4FA 2MK2A 2W4JA 3MY5A 4EJNA 5AA9A 3ORNA 4ROJA 1PF8A 3RPVA 2W7XA 1YXUA 3LJ1A 3S4QA 5C8MA 2WMUA 4P5ZA 3FHIA 3UTOA 2NPQA 2C1BA 4CG8A 4LMUA 4FKQA 4DITA 4IAZA 4EYMA 3SG9A 1L3RE 3HGKA 5AIRA 5CU4A 2C5NA 5FEEA 5FXQA 3CY2A
chains in the Genus database with same CATH superfamily
2OH0E 2PVKA 1BLXA 2C3IB 2GCDA 2AUGA 1OIYA 3GI3A 5KMNA 1W2FA 1H1RA 3TL0A 2ITTA 5IH5A 3S00A 4UWCA 5KO1A 3C13A 5H2UA 2CKOA 3N4VA 4TRLA 3THBA 5BO4A 4LOPA 2PSQA 2IZSA 5BNJA 3E92A 2O64A 4JBVA 2I6LA 2XB7A 3DFCB 5E8SA 3PJPA 4ASXA 5IG1A 5E91A 4V04A 4JG7A 1M2RA 2QOOA 4E20A 5HLWA 4X2JA 3CGOA 3R8UA 4DF3A 1AGWA 2CS0A 2Y8OA 2FVDA 3FYJX 1U5QA 4X3FC 1MW4A 4F78A 2J0KA 1O4QA 4BDJA 2YIXA 4O91A 4F7LA 4CT2A 3EQIA 2G15A 3IW5A 3QA0A 1CTPE 2JBOA 4OTDA 5E1EA 3R01A 1CKJA 4YNEA 5CEPA 2XAOA 5AR3A 5JZNA 3GGFA 5KX8A 4EOSA 4AGDA 1OBDA 4LRJA 2RFDA 2W1DA 4QYEA 3HA6A 3W16A 3W0RA 5LWNA 1O6LA 1QPEA 4M66A 1GIJA 4JIAA 2O0UA 4M67A 3VS1A 3EN9A 4FKOA 5J3XA 4CFUA 4OAVB 1IAJA 4EZ5A 3R1NA 3MJ2A 1HCTB 1YOMA 2L6KA 3EOCA 1OGUA 5AR8A 4O4DA 3JVRA 4TN6A 5E92A 3OHTA 3SRVB 4O4FA 4C4EA 4BY9E 2RORA 3MPMA 4C2VA 5HG8A 4CLJA 4AXFA 3BWJA 3F3WA 3TI1A 5CZIA 3TV7A 3PQZA 4FIFA 2PVYA 5IBMA 2EXEA 3MWUA 1YDSE 4JS8A 3VBXA 3AC5A 3GU6A 2C6OA 5IQDA 3FJQE 1WFCA 3E3BX 3P5KA 4RJ3A 4IH8A 2OF2A 4MQ2A 3GC7A 1J7UA 2NRUA 4IMYA 4Y72A 3NUNA 1FU5A 1B6CB 3OCSA 1F2FA 5BVOA 4OGRA 1FMOE 1H27A 1UVRA 3FZTA 2XMYA 2WTKC 3NLBA 4C35A 4TWOA 5I3OA 4CTBA 2XIYA 4EH5A 4ERWA 3PZHA 3UOHA 2ZB1A 1A1CA 4M0ZA 4UV0A 4EH7A 3L8PA 3FDNA 2BCJA 3EFWA 4C33A 3BUNB 2UW0A 4RFMA 4DEEA 1E9HA 3REPA 2WOUA 3ZO1A 4F7NA 2CNUA 4C02A 1FPUA 3A2CA 1U54B 4D2SA 2FSTX 3WF6A 4QTDA 3ZO2A 1YHVA 3UMWA 2GQRA 4IWQA 2HDVA 5FD2A 4G2FA 4PPBA 3NNUA 2YDIA 5JFSA 1BKMA 2GE9A 3M7FA 4DEAA 4FBNA 2F4JA 4D2WA 4E5WA 1QL6A 2C6MA 2Z8CA 3EQGA 3NNWA 4DGXA 4D8KA 2HY0A 4QSYA 1G8JA 3KXGA 4K45A 3R1YA 2C5YA 2EYZA 3QTWA 5DT4A 3FPMA 3VROA 4DE4A 2QOHA 3GCPA 4E6CA 3RKBA 3ZEWA 4A4XA 4BB4A 2B9FA 3WF7A 3R9HA 4EK3A 2WTDA 4OHEA 4V01A 3AGLA 3MYGA 4PP7A 4DFZE 4S34A 4XUFA 1WBNA 3F66A 3UG1A 3AMYA 3B2TA 1PICA 3H10A 1H1SA 4R77A 3CXLA 5I6VA 4HZRA 4ZLYA 3W2OA 4YJSA 5AAFA 5HVKA 3QUDA 4O96A 1IRKA 5H8BA 5LMKA 3ORXA 4G16A 4EQMA 4AOJA 4X0MA 3EKKA 2H34A 3JY0A 3CD8A 4C4HA 3KRXA 1MQBA 3P4KA 4BCKA 1OO3A 3MDYA 1S9IA 3MJ1A 3TUBA 2IG7A 2YCRA 5E8TA 4C7TA 1H25A 4FTJA 4G3EA 4TW9A 3SDJA 3TJDA 3QYWA 4L44A 1J7IA 3T04A 4WG5A 5L6OA 4IZYA 3O17A 2E9UA 4PMSA 2GHLA 4IWPA 2BVAA 5CI7A 3FLWA 4CFFA 4FSQA 1Y1UA 3KN5A 5TE0A 2RMXA 2HELA 3D5WA 3ANRA 3BI6A 1JOWB 3QRJA 4FOBA 4LV7A 2PVMA 3IG7A 2EU0A 4FZDB 3K54A 4H3BA 2HXQA 4JG6A 4L67A 3BQRA 2BDJA 4ANBA 4D0XA 3KRLA 1W98A 1J1CA 3OWJA 3PP0A 4AA4A 2Y9QA 2W9FB 3A7HA 4BGGA 5FQDC 2XEZA 4PWNA 4D1SA 3BX5A 3E63A 4ACMA 4YO4A 2CCIA 3QGWA 5EW9A 5AX9A 2BTSA 3EFJA 3TEIA 2DYLA 2QU6A 2HENA 5GJHA 4ACGA 2X2KA 1FMKA 2WPAA 4NJDA 2JITA 2XBJA 4LV5A 5BUIA 4FL2A 3GVUA 2FB8A 1AYAA 2PE1A 3AD6A 1Q61A 1Y8GA 4O21A 5HG5A 1M14A 2CLXA 1XKKA 4OTFA 4QP7A 4YJQA 1ZMVA 1OIUA 3S3IA 2Y1NA 2OFVA 5ANEA 4BBEA 5D0JA 3DGKA 3IS5A 3NVKI 5EYMA 4CFXA 4FL1A 2BZHB 4ID7A 3FBVA 2L3TA 1BI7A 4FKIA 4YLJA 5L3AA 2ONLA 4E6QA 3H0ZA 3POZA 3WILA 3ALNA 3D2KA 3QX2A 5ETFA 3MVHA 4BKZA 3IMDA 3ZC6A 2YM4A 1J1BA 1UNLA 4EEVA 5CXZA 2J50A 2DM0A 2PY3A 3F5XA 5L2WA 2VWUA 4G3GA 4S30A 4XBRA 4ANMA 4NYEA 4EK4A 3F2AA 4HVDA 4UMUA 1CWDL 1X8BA 2YM5A 3Q6UA 5DVRA 5CEIA 1A9UA 4YR8A 1MP8A 1OM1A 5BVEA 2HMHA 4DH5A 4FTMA 3DQXA 2J0JA 4FMQA 4D2VA 4R3PA 3R7YA 1BL6A 1Z3KA 4BBFA 2R7BA 4QYGA 4BVUA 3DKCA 5I9VA 3OF0A 2XM8A 4P90A 1PXIA 3SOAA 3UOJA 2ITOA 4UYNA 5FG8A 3VJNA 3AKJA 1BKXA 2QONA 2ERKA 4A06A 2QMSA 3RGFA 3BYUA 3HZTA 3E62A 3HVCA 2EU9A 2E9VA 3WZJA 2GFCA 5D7AA 4JLCA 4WRGA 1H28A 2Z7LA 3QWXX 1FINA 3TIZA 4OW8A 4HVSA 2K7AB 1VEBA 4OLIA 3SG8A 1NW1A 3PSBA 2JFLA 4BICA 5GJDA 4XMOA 1OL7A 5AUXA 3RTPA 4TXCA 1YOLA 3FWQA 4QMVA 3MS9A 3MESA 3GNIB 3NFFB 1LR4A 5AP3A 3EIDA 1I44A 4MXYA 2X8IA 4OBQA 4E26A 4C37A 3C50A 3IDBA 1OIQA 3EN5A 5F1ZA 3Q52A 4QNAA 4Y83A 4BC6A 3IDCA 1Z5MA 3F5PA 4F7SA 2QOIA 1F5QA 2XP2A 2YAAA 1XWSA 5CAUA 1A08A 4ZJJA 3LXPA 4O86A 4LOQA 4ITHA 4GUBA 5CEQA 3R83A 3NUPA 5D41A 3QF9A 3DCVA 4UMPA 4O84A 1ZMWA 4G34A 3A61A 4MVFA 4EC8A 5IQHA 3PRIA 4S31A 4YUQA 5AA8A 4ACCA 2ITUA 3Q3BA 4KA3A 3RK9A 3NCGA 3V8TA 5IA1A 3O50A 4O0UA 5EM8A 3K3JA 5CU6A 4A4CA 3RI1A 4KKGA 4JVGA 3UDTA 2B9IA 3QTUA 4AOIA 3TNPC 4BWKA 4YC3A 2BIKB 3DJ5A 1PXLA 4QP1A 4DH1A 3GOPA 2QOKA 3R8PA 3RAIA 5HOAA 2PNAA 3GQLA 2NRYA 2OJJA 4GMYA 2EWAA 4S32A 2R3JA 3FMNA 4KINA 3TNWA 3VHEA 3LQ3A 4KKEA 3E8DA 3O0GA 5L2QA 3C0IA 5EFQA 1NT2A 4XHKB 1Y6BA 4IWOA 4W8DA 3PJ8A 4ZTMA 1SMHA 4K18A 3DOGA 3QUEA 4MXAA 4U8ZA 3I5ZA 3ZXZA 4AT4A 1SM2A 3DPKA 2VTMA 4XG7A 2X8DA 3N8MA 2B55A 4JX3A 2KTYA 3BGQA 5AP1A 4EI4A 4D1ZA 3BCEA 4PDYA 3US4A 5CU3A 2W9ZB 4PX6A 5CWZA 2H46E 3I79A 3HMPA 1ZYDA 3UVRA 2MQIA 2RG6A 2XJ0A 4BCPA 4EWQA 4GL9E 3W10A 4KSQA 3TZMA 4J8MA 3FC1X 3GC8A 4TYHA 3V51A 4OTIA 4O0WA 3FLZA 4YNOA 4ZS0A 2X9EA 4IB1A 4IX6A 3PDTA 1SPRA 5LARA 1E1XA 1SHDA 5TR6A 3CKXA 4QTAA 2WGJA 2ZMCA 3HMOA 3OS3A 4BWXA 4USEA 2XNGA 4IB3A 1RDQE 5IQAA 4RLKA 5K0XA 3CTJA 5DT3A 2C4GA 1H9OA 2V22A 3PLAE 3MI9A 3NVMB 4H3PA 3CPBA 2FA2A 4FV0A 1ATPE 4GVAA 2XJ1A 1Q4LA 3C7IA 5EI8A 4J98A 3VW6A 4OHDA 5EYKA 3RVGA 4YSJA 1AYCA 4RGJA 2LNWA 3ITZA 3TKIA 2JDOA 5CU2A 5D10A 2R7IA 4L53A 5AUYA 3U4UA 3A60A 3F6XA 3OB2B 3LIJA 3F9NA 4ARKA 3R63A 4RX9A 5TO8A 3PA5A 1ERKA 4O1OA 5GJIA 4YC6A 4GEOA 3DA6A 3I7CA 2PMIA 5KMJA 4JEGA 3KMWA 4Q5HA 5CAPA 1AOTF 5KMOA 4B8LA 3KXNA 3AC3A 1H4LA 4MYGA 2BAQA 2UZUE 3FZOA 3EMGA 1SVGA 3V5LA 3PVUA 5B7VA 5ETAA 3RCDA 5JKGA 5L8KA 2VTTA 4WNOA 2BDFA 5EW3A 1RW8A 5E8XA 3PXFA 2X7FA 3COMA 4CZTA 4ZS4A 1HCSB 4X6QC 4APCA 4K11A 3R9RA 1KE6A 1IAHA 1SNUA 1JPAA 2O8YA 4F9AA 4OHHA 2XRUA 4DHIB 2YIRA 5GJGA 4MNEB 5E8VA 2BPMA 3GEQA 3QKKA 5DT0A 1BKLA 5AJQA 1KV2A 1M7NA 4E93A 3QGYA 4O4EA 2NNWB 4AF3A 4USFA 5M09A 4U0IA 4W4YA 5EM5A 3OC1A 3W0PA 5JN2A 2XKDA 4I0TA 2X39A 3A7IA 4M13A 2UZTA 3RJCA 4QT1A 4RIWA 3MXYA 3FQHA 1Q8TA 4EOPA 4BCHA 3ULZA 1FYRA 3GCQA 2V55A 2AC5A 3D15A 3E3PA 3KF4A 3F69A 3VN9A 4R1YA 4MUQA 5HTBA 4I23A 1UKIA 4LV8A 3O7LB 2Q0BA 3QU0A 4KBAA 1XH4A 5AV4A 1WBWA 4DA5A 5HTCA 3ZH8A 4RJ7A 1JWOA 4QMYA 4XV3A 3BHTA 4TNDA 1ND4A 2ITVA 1WBSA 2I1MA 3CQWA 4CRLA 5HBJA 4FKVA 4IBMA 4NCTA 3WA4A 4RIXA 2XH5A 4FTTA 5TOZA 5LVLA 3F7WA 1JAMA 5FBNC 3B8RA 4CZYB 2UZWE 5AFVA 1BMBA 4HPTE 2C6LA 1FVVA 5DC9A 3FKNA 1H0VA 1VYZA 1W8CA 4YU2A 2OIBA 2X1NA 3OZ6A 5IUGA 2PU8A 3MW1A 2V7AA 4FOCA 4APPA 5JGAA 3MY0A 5BMMA 3BYOA 4HNFA 3F2NA 4L3PA 4NZWB 1NXKA 1ZY5A 4WUNA 1F3MC 3ZO3A 3LCOA 2A27A 2X9FA 4R7IA 4ITJA 4NM7A 3PFVA 5AV2A 2OZAA 3LMIA 3BUMB 5A4LA 2LRAA 2PUUA 4BFMA 3LFAA 2B7AA 4G9CA 3G5DA 2QU5A 1I3ZA 3R7GA 1YVLA 2QOQA 5IA0A 1ZYCA 2BTRA 2OBJA 3ZZWA 3ALOA 4D58A 5AUTA 2I0VA 4BL1A 3A8XA 1JKLA 3CTHA 1O41A 4I24A 4O0YA 3FEGA 3PPKA 4M68A 3DTWA 3DJ6A 3SVVA 4FV5A 4J7BA 2BR1A 3QTSA 4RA4A 2BRBA 2RFSA 5DBXA 4AGWA 3RK7A 4BGQA 2BMCA 2H6DA 3Q96A 4R6VA 2HWPA 4XS2A 4G5PA 2EO6A 3A4PA 1OL6A 4R3RA 1OL2A 2JKMA 1SZMA 2VO3A 5AWMA 3PJ3A 1LUMA 4QP9A 5H9BA 2VWBA 3PP1A 4P2KA 4LRKA 4DC2A 3MPTA 4MBJA 2IVTA 1G3NA 3LQ5A 4I6QA 4KNBA 4TT7A 4DEIA 1UU9A 3RMFA 3R9NA 4ASDA 4D4VA 4IFCA 4F0FA 1OL1A 3FY0A 4LG4A 5DRBA 4ZAUA 1B47A 1XA6A 1Y57A 3BEAA 3PS5A 3R21A 3DLZA 1YHWA 2UZVA 2B54A 3PJ2A 5T3QA 4FV6A 1O46A 2UVZA 2H96A 3D94A 3ORLA 3EN7A 3KKVA 3R0TA 4PV0A 4X2KA 4DFLA 4PMTA 4BDFA 4CYIA 2AEGA 3AMAA 4ZSJA 4I5CA 3VAPA 3R2BA 4OTWA 4HZSA 4FKSA 3VUIA 3ORPA 4FGRA 4ALWA 2L4KA 2JIVA 3COKA 2UW5A 2R0IA 2PZIA 4CEGA 4QPAA 3HAVA 4E3CA 5I9XA 4GS6A 3OFMA 2RKUA 5CXHA 3IN7A 2IWIA 4LYNA 2YM7A 5ANJA 2W1ZA 3COHA 4TZRA 1JYQA 4HYUA 3SD0A 2BFYA 2W1FA 3QRTA 2ITWA 3D5UA 3V04A 3L1SA 5GINE 4HYIA 3TTIA 3DXNA 4TY1A 2XNMA 3V8WA 1MRYA 4RJ5A 4L8MA 3AGMA 4L43A 5F95A 5TT7A 3NEWA 5DFPA 3MVJA 3O7LD 4BIEA 5IBSA 4TTHB 4EOQA 2R3QA 2C6IA 4LUEA 3MFTA 2X0QA 4E4XA 2SRCA 4M0YA 4ZTHA 4ANNA 4FV1A 4C62A 5DMZA 5IEXA 2OIDA 1GY3A 1BHFA 3VS2A 5CVHA 4BDHA 1XQZA 2F9GA 1PXOA 2XIZA 3BE2A 4MXZA 3FPQA 4DHZA 2XCKA 1U4DA 2GSFA 4M8TA 1A07A 4BCJA 4CV8A 2W4OA 4R5SA 1UKHA 5K3YA 1KOAA 2C5OA 4IB0A 4EY0A 3VBTA 3VIDA 4R1VA 1VJYA 3OXZA 4MD7E 3ID6C 3FY2A 3BWFA 5JGDA 3G0EA 2W1EA 4KUJA 3K2TA 2MRKA 4AOTA 1WAKA 4JI9A 5IKWA 4QMTA 1O9UA 5FGKA 2YLEA 4EBVA 5AV1A 3FI8A 3NYOA 1A09A 4IX4A 2C3JA 4E5AX 4FA2A 4I4EA 3OUKA 2PYWA 4AZEA 4BHZA 4GU6A 1BLJA 4WHZA 2REIA 3E64A 3GENA 3LFSA 3BV3A 3QQFA 5JT2A 5H8EA 3QWJA 4GFGA 2CR4A 3UVPA 5KHWA 1IS0A 1QMZA 4G3FA 4W9XA 4FSMA 4EYJA 5CYIA 2G2HA 3C7QA 2WNTA 1JKSA 3LM0A 4Y8DA 2PMLX 3DBDA 4RC2A 5JFXA 4L6QA 3QHRA 4A9TA 5J1WA 3NS9A 4K1BA 3QQLA 4JAJA 4JBQA 4DINA 2QO2A 3PY0A 3QD0A 3H9OA 2HZIA 4G6NA 4LGHA 3N4TA 3LW0A 2C0IA 3PUPA 3QC9A 3AMBA 2QHMA 2ZB0A 1Y8YA 2OJIA 3NW5A 4FICA 3DTCA 4HPUE 4XLIA 1AOUF 2OXDA 1OPKA 2KGYA 1J3HA 1URWA 3EFLA 1BF5A 3EWHA 5IF1A 2Y1MA 4FBXA 4IVBA 1YXSA 3HP2A 4TYIA 2CLQA 2CHLA 4FT0A 3CQUA 3UOKA 3WE4A 4BCMA 4QMNA 4ZZOA 4CQGA 4O7TA 3BU3A 4FTUA 4X2GA 2QR8A 3EQRA 4NSTA 3MVMA 3TCPA 4N70A 4AW1A 4FV7A 1ZY4A 2NO3A 2H8HA 2YWPA 2ZOQA 3G2FA 2OGVA 4RJ8A 1O4IA 5E8UA 3WZDA 3P7BA 3JS2A 4NKAA 2BRNA 3QZGA 3BHYA 4QMZA 5L2SA 1OO4A 2E9OA 3LMGA 4WRSA 1O49A 4YTIA 1NA7A 4IAYA 4D4RA 1FBVA 4L3JA 2WKMA 3DBFA 2J5EA 4GRBA 3ZEPA 4AXAA 2WU7A 3HMMA 3FKOA 4RWJA 3U9NA 2B53A 2HY81 4BCNA 5CSPA 5JH6A 3KU2A 3Q2MA 4AAAA 5LMKC 3OTVA 2PUPA 1WBTA 3ENMA 1Q99A 2BUJA 1K3AA 1ZOEA 3RPOA 2YCQA 1PHKA 2CGUA 3HUBA 3MBLA 3S9KA 2QC6A 2DUVA 3R7OA 4DGPA 4D28A 4YZNA 3V6SA 5IEYA 3LFNA 3O23A 4FG8A 4DG2E 4XEYA 4XX9A 4ANQA 5FEQA 5A4CA 1JNKA 3FLYA 4P5QA 3FL5A 4GSBA 5D1JA 3V8SA 4UY9A 4UXQA 4FV8A 4I6LA 3UO6A 3T9TA 3AXWA 2WIHA 3HUCA 4FEQA 4BTKA 3TYKA 2UW4A 4AZSA 5B2LA 5FTOA 3ZDUA 5LVMA 3RPSA 4H3QA 4NW5A 5J87A 4HGTA 2YSXA 1H08A 4QP2A 3W0SA 4O4BB 5CENA 3EN6A 3ZU7A 4PTGA 2VWXA 5IUHA 2C6DA 4FT3A 2IW6A 2OSCA 4PNKA 5C01A 1W0XC 3N51A 4U43A 3H4JA 3KN6A 5E8WA 4EH4A 3LCTA 4E8AA 2A4LA 3PE1A 4TPTA 1IA9A 5M4UA 4BKYA 5FBOA 3AOXA 4HOKA 1PYEA 1T45A 3S1HA 5C8NA 2X6DA 4XOYA 4R8QA 2WMWA 4RG0A 3VUDA 1P2AA 4CKIA 5CANA 2X2LA 3DT1A 2OJFE 4RZWA 4BDGA 2JYQA 4FVQA 3LFQA 3TT0A 2BZIB 3HV3A 2PK9A 4DGOA 3O71A 3RAWA 3KFJA 3LXLA 5FDXA 3W0NA 3NIEA 1FBNA 4DDIA 3FZSA 2YIWA 4PMMA 5J8IA 4ZTNA 4EH3A 1M61A 4DEDA 5IDNA 2W96B 3VBWA 2VGOA 2VWWA 4L46A 4GJ2A 5IH6A 5JQ5A 5CSVA 3VF9A 3F61A 4TYHB 5IA2A 2XALA 3ATSA 5HKMA 3CC6A 4IZ7A 3HLLA 3NUAA 4U44A 3WYYA 1G83A 2XKFA 4C61A 4OHIA 4E68A 3TACA 1PMNA 2QO7A 5M44A 4RVLA 2RVFA 1Y91A 4F6WA 3CXWA 4HYHA 3PE2A 3U54A 3N7YA 1O44A 4EONA 4U80A 4FV9A 4M14A 3LMHA 3ZO4A 2I0YA 2G01A 4MD8E 3PWYA 4M84A 3UP7A 3P08A 3UDZA 4UMTA 3Q4ZA 3H9RA 3ELJA 4H1JA 4HCUA 4RX8A 4C57A 4CFVA 2A2AA 1YVHA 5IU2A 3BPRA 3NW6A 4RRVA 4RC3A 5T68A 3RNYA 1UU3A 4GK3A 3H9FA 4RWLA 1D4TA 4AZTA 4EK5A 4IJ9A 2VTIA 4JBPA 4V0GA 4C4IA 1GNGA 4C34A 5KCVA 2ZM1A 4BIDA 2WTVA 3JY9A 4XV1A 5I5ZA 5AM7A 5CAOA 4BCIA 3MXCA 3PSJA 3PFYA 2OXXA 4MK0A 4AACA 1PRYA 2VX3A 2JDSA 3LLAA 4ZIMA 3BE9A 4AZVA 3WBLA 3OB1B 5CLPA 4OT6A 5G1XA 5EHOA 2HOGA 4IAFA 1O4BA 5CF6A 3VF8A 4AGUA 5K9IA 3SX9A 3JUHA 3EH9A 1AYDA 3BUXB 3GBZA 2WXVA 2J90A 4FG9A 5D11A 1F1WA 4I5HA 1ZFPE 3BBWA 1KA6A 2J51A 2VWVA 4M15A 4PL3A 5M4CA 4JAIA 4XP2A 5HNBA 4BCOA 5EH0A 4GUEA 1O4JA 2V5QA 3NGAA 2VX1A 3D5XA 4U3YA 3LVPA 3OWPA 1M27A 3GT8A 4FTAA 3P5JC 4QMLA 1JSVA 2XK8A 4FL3A 4RPVA 4MBIA 1XJDA 3FQSA 2P3GX 4EWHA 4YLKA 5KZIA 3QRIA 4O0RA 1ZRZA 2BDWA 4PDSA 4FNZA 3ZOSA 1WMKA 1FHSA 1PJKA 4RIWB 2ZVAA 4U97A 4KIPA 5DRDA 5G6VA 2JDRA 2IZRA 4U6RA 3VS6A 3WZUA 4QMPA 1TVOA 5BUJA 3NNVA 3NAYA 4PL4A 2WQBA 3OBJA 1W7HA 1XBBA 4G31A 2FH9A 3BGPA 2A19B 1XBCA 3K5UA 2G2FA 4FYNA 5CT0A 3TZ8A 4YJRA 1YVJA 4WWQA 5HD4A 5BYYA 5CEKA 2F49A 4YHJA 1OZ1A 2RFEA 4D4SA 2IUHA 3GP0A 4FJVA 1UA2A 3NUUA 1REJA 4QEBA 3R9OA 2YM6A 4BCQA 2IVSA 2LQWA 5BVKA 5AUVA 1OIRA 3HP5A 3IK3A 4CMUA 4UZDA 3KXXA 2QQ7A 1Q5KA 4OBOA 1GZKA 4BDBA 1WCCA 3MIYA 3NFGB