2OZOA

Autoinhibited intact human zap-70
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
612
structure length
545
Chain Sequence
b'PDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPNMDTSVFESPFSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRNLAARNVLLVNRHYAKISDFGLSKALGPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGGSALEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase ZAP-70
publication title Structural Basis for the Inhibition of Tyrosine Kinase Activity of ZAP-70.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 150
structure length 545
sequence length 612
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ozoA05
1.10.930.10 Mainly Alpha Orthogonal Bundle Syk Kinase; Chain A, domain 2 Syk Kinase; Chain A, domain 2 2ozoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ozoA04
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2ozoA03
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2ozoA01
2VD5A 1W8CA 4O0WA 3ORNA 5CVFA 3ZM9A 5A3XA 3BUWB 3KXGA 4D28A 2P55A 3QF9A 3OXIA 2BIYA 4LI5A 5IMEA 4BTFA 4PQNA 3FY2A 3LCKA 3NUAA 3DB6A 1P4FA 4RFZA 2ETZA 1O4RA 4DHFA 4L3PA 3PWYA 3MJ2A 1IRKA 2UVYA 2XNEA 4FTKA 5LCKA 4F0IA 2EYYA 1TKIA 4RJ4A 5DC0B 4FUYA 4CCUA 2NP8A 4V0GB 3BHTA 2WMWA 3OC1A 5CANA 2BDFA 5L2SA 2W1GA 3QXPA 3HA6A 5L2TA 3FPQA 3R8VA 1JVPP 3ZDUA 4EZ5A 4IXPA 5ICPA 1WVXA 3KGAA 4RA4A 3HMIA 3UNKA 1Q24A 2EXMA 1J7UA 4G3DA 4K6ZA 4LQMA 2IPXA 4DGGA 3PFVA 2YAKA 3OCSA 3WZEA 4AN2A 4RMZA 4XEYA 3GQIB 2RSVA 1O4QA 2ITQA 3QQFA 4BVUA 5I4NA 3QTSA 1CTPE 4FK3A 2UW9A 2X6EA 5IEXA 2CGVA 3UGCA 1TVOA 4IC7A 4XZ1A 2BFYA 4R1YA 4EOSA 1O4OA 1YI4A 3HV3A 2ZB0A 4FF8A 4IVCA 1PXJA 3W2SA 5AAEA 2F9GA 1PF8A 4FSRA 4EOMA 3EQFA 2VTHA 2C68A 1VR2A 4GJ3A 3U4WA 4JQEA 3M7FA 3D7TA 4V05A 2XM9A 2BDJA 1IS0A 2I0EA 4GW8A 5DC4A 3RI1A 3C4WA 3VBXA 4O96A 2Y4IB 1PMNA 2YCSA 3IO7A 4RWJA 3FLNC 1LR4A 4F6SA 3FZPA 3OT3A 4YLJA 3GOKA 4BR3A 5FTGA 3CR0A 4FKVA 4MXYA 1XH7A 1OUKA 5ANKA 4A7CA 2PULA 3RVGA 4UMQA 2JKMA 3A60A 3R7UA 4NTTA 2GFCA 2X8IA 4I6BA 3ORXA 3R0TA 4YJNA 3UIMA 4AUAA 3OROA 4IDTA 3RZBA 3V6RA 2ZV8A 3ZFXA 4UWYA 5LVNA 4C34A 4D1SA 4RX8A 4ASDA 4D4VA 3Q9ZA 4FNYA 4DINA 4O7VA 1BHHB 3PA3A 3VW6A 3ZLSA 2C5XA 1SYKA 4WOVA 3QCSA 1W98A 3IS5A 4YJPA 5CXZA 1D4WA 2J0JA 3TWJA 3BHHA 4MEDA 4FKTA 2OZOA 2XKFA 1OPJA 2BPMA 2QI8A 2VTMA 3EN7A 5CVHA 4U8ZA 5EFQA 3R8MA 5J9LA 2XK7A 4E6AA 1R1PA 2PVKA 3D7TB 3KRLA 3OUNB 4DITA 1H1PA 2Z7SA 4BI2A 1WCCA 1O4HA 3G0EA 5IUIA 2BAJA 2F7EE 3BYMA 4U79A 3CE3A 3RGFA 3RM7A 5LJJA 3VBWA 2J50A 4B9DA 3HCKA 4CKIA 2XM8A 3DJ5A 3FXZA 4BTKA 3BGQA 4WRSA 2V55A 5HKYA 2EB3A 4PPCA 3PYYA 2ITWA 5ANEA 1CSYA 2FSMX 2IVSA 4DEEA 2BROA 1MRUA 2FB8A 4GG5A 3OXTA 3UNZA 1RJAA 4HCUA 4NWMA 4DFZE 2GNJA 1YW2A 2PNBA 1YHVA 2B4SB 3O7LB 3ULIA 1GAGA 1BKLA 4G34A 4EH5A 3R22A 5T68A 3O2MA 4RWKA 3U55A 2F49A 4YNOA 3GXXA 3BHVA 5CX9A 2XA4A 4D9UA 5AR8A 2BRMA 2EB2A 3BRBA 3W2OA 1SPRA 3FY0A 1F3MC 3FMDA 3R7YA 3UG1A 1PRYA 2XNGA 3CXLA 3PPKA 4CQEA 4PNKA 1ZWSA 3WF8A 5EDPA 4R8QA 4W4WA 5K3YA 2DUVA 3PG1A 2WMTA 4M7IA 1WZYA 2OSCA 3C9WA 4I20A 3RTPA 2W9FB 3FMKA 3RK7A 3VF9A 5I9UA 5HVKA 4FT0A 5CAOA 3RM6A 4E6CA 3SXRA 3OP5A 4ANOA 3LLAA 4QP6A 1KSWA 4O7RA 2W99B 2JKKA 4ZZOA 4UYNA 4HOKA 4XG3A 2OZAB 5AM6A 4WBBB 1JKKA 4FL1A 2O2UA 4FA2A 2ZAZA 3VUHA 2WTVA 3AC2A 4AA5A 2O64A 4EIHA 5DR6A 4LGDA 5FTQA 2Q83A 5J87A 4EH9A 4F9CA 1YVJA 3BLHA 1R78A 2X7FA 4XBRA 5C26A 4FV5A 5CTPA 3S8OA 4KRDA 4QTDA 1PYEA 4ANLA 4UWCA 3FSKA 4CKJA 3T9IA 4AW0A 4N6ZA 5LWMA 1FGKA 2R3QA 3Q4ZA 4O81A 2JKOA 4JLCA 4ZJJA 4R3RA 3UYOA 2WMVA 4Q9SA 5JH6A 4M4ZA 2GPHA 3KQ7A 4IW0A 2XJ1A 3MS9A 2C1AA 4TNDA 4AZFA 4IM0A 4DBNA 2PUNA 4CG9A 1JYUA 3ZDIA 4MWHA 3IW5A 3C5IA 5E90A 5M55A 5K0XA 1CSZA 2GSFA 5EM7A 3PS5A 4F4PA 2XKDA 3LE6A 5LMKC 3D2IA 5HKMA 4FKJA 3R00A 4C3FA 2RMXA 4XP3A 3ORKA 4EYJA 4EC8A 1JSTA 4BYIA 5DF6A 4LUDA 3R28A 3UZRA 2C5OA 1A1EA 2FVDA 2A0CX 3QBNA 4L52A 2WB8A 1K2PA 3HHMB 2QOFA 4NH1A 4ZZNA 3NYVA 2OW3A 2PK9A 3PRFA 4F9AA 2VTAA 2YWVA 4D2PA 1H07A 2HZNA 2WXVA 2DQ7X 2C9WA 3P9JA 4FVQA 5KHWA 4G5JA 3KF4A 4RVMA 3PXFA 2WMBA 4RVKA 3LKMA 3KK9A 3NVKI 4RWIA 3SAYA 4QPAA 3UG2A 3PZHA 4U6RA 5AIKA 3ZO1A 2H6DA 4ZS4A 3T8OA 3EAZA 4OTFA 3PXRA 3BV3A 4KKGA 4IX5A 3UPXA 3SA0A 2ITVA 2DWBA 4PMTA 3GC8A 2P0CA 3LJ2A 1NZVA 1WBPA 2HZ4A 3Q9XA 4F6WA 4FNWA 1R1QA 2W4OA 5FEDA 4BCQA 5L8JA 3T3VA 4DH1A 2XK9A 4FTJA 5HTIA 1JU5A 3ZNIA 5EQEA 3LJ1A 4LGHA 4GPLB 3E88A 3L8VA 3NMUF 3W2CA 4B6LA 4USEA 5JRSA 4FG8A 3UO4A 3VBQA 3V5QA 4TL0A 3ZH8A 4JG8A 4MD7E 3PPJA 4D2TA 3ORPA 1CM8A 4J8NA 4QYGA 1PW2A 3R73A 4D1XA 1WVYA 4LUEA 4JXFA 1L3RE 4D58A 2LNWA 1O48A 3R21A 5BYYA 3VS5A 3R8UA 3P1AA 4FKIA 2WO6A 3VHEA 4RZVA 3TXOA 4H3QA 2OI4X 4HVDA 3NCGA 1KE9A 1P5EA 4L6QA 4ARKA 4DEGA 1O46A 2RIOA 3H9RA 4AGDA 4IVAA 4O6LA 4L3JA 5EHYA 1M14A 2O63A 3TM0A 2HDVA 4JGHA 2PZIA 3JPVA 5HI2A 4FKPA 3I0QA 4HYHA 2QO2A 3QRIA 3B8RA 4ZXTA 5GZAA 5BYZA 5F95A 3R2BA 2XEYA 2BHEA 5HE3A 5F4NA 2UVXA 4NKAA 3Q96A 1XBCA 4BI1A 1LUMA 3QHRA 2I0HA 5CQUA 4E6DA 4YTFA 5BYLA 4GYIA 1M61A 1X6CA 4I5CA 2ESMA 1VEBA 4O0SA 5F94A 3Q3BA 4KS8A 2QHMA 4FZDB 3QA0A 5TOZA 3WA4A 5CF5A 4EOPA 2ACXA 4DFYA 3PIYA 2F2CB 3AD4A 5CEKA 1GOLA 2B3OA 1IJRA 4ZSGA 5E8SA 3RK9A 5J95A 3E3PA 3DGKA 2C6TA 3O8PA 5CT0A 5DFPA 4DG3E 4PDYA 1BF5A 3TNPC 5B2KA 3TKZA 4O7ZA 3COMA 4FOCA 2ITUA 2WTDA 3I5NA 3FUPA 5BPYA 2W1CA 4OGRA 2YIYA 4MBIA 2YFXA 3P23A 4WG5A 3SDJA 4AAAA 5EI2A 3WZJA 1AGWA 4H39A 1OIQA 2EXEA 3Q4TA 5CU6A 4E3CA 1FMOE 2G1TA 3ZUUA 4F70A 4J96A 2R3FA 5AADA 4B8MA 3CJFA 1YDTE 4IZ7A 4GJ2A 4CFWA 3GQIA 4G3FA 1Q8YA 3PJCA 1XR1A 3GC0A 3BEGA 3ROCA 2A19B 2VTNA 3GFEA 1OO4A 3OT8A 4OTRA 3F5GA 5GHVA 3MDYA 2W9ZB 3BWJA 3UVPA 3TUBA 3MPAA 4YZMA 3RAKA 4GUBA 4L53A 5D9HA 4ASEA 5AJQA 3ETAA 2JIUA 3LQ8A 4PMMA 5A4TA 2AOBA 2MQIA 3WF7A 4NT4A 3DZQA 2BFXA 4KBAA 3MA6A 4OLIA 2Y6MA 3WOWA 4C4FA 5CF4A 3GP0A 5CZIA 3CP9A 4MD9E 5FGKA 4DBXA 2ITNA 5AWMA 3OWPA 4ALUA 4E73A 3NNUA 3I79A 4OTWA 1IA8A 4XS2A 4ZTSA 3GU5A 2HUWA 3HDNA 4HZRA 5BVDA 4GVAA 4RX5A 1VYWA 5CT7A 3U9NA 3DKGA 3WBLA 4FC0A 5AUWA 2LCTA 3LM0A 2L4KA 1JAMA 3OTVA 2C3JA 1Q8ZA 4BDHA 5M4CA 4NKSA 5J8IA 3RHXA 3OG7A 3JR1A 4FEXA 2CN8A 5JSMA 4L00A 4J97A 2V5QA 4YZCA 1H1QA 1MQBA 4FSNA 3I6WA 4FV0A 4HVSA 5LWNA 2R3PA 1BKMA 4XZ0A 2BRNA 4W9XA 4G6NA 5I9ZA 5LVMA 4FEWA 4GSBA 5L8KA 2EOBA 2XIXA 3M42A 4GEOA 3I81A 4OBPA 2VU3A 4ZSLA 4BDBA 4EI4A 4BHNA 1QPEA 2EU0A 4NFMA 4R7HA 2W5HA 1KA7A 5KUPA 4Z3VA 1O4NA 4JR7A 4AOTA 5J7HA 3KMWA 4B0GA 4ROJA 4E20A 1B47A 4XJ0A 3CQUA 3CCNA 3R01A 4BTMA 1OB3A 5JFVA 5EYCA 2B55A 2O5KA 3HKOA 4ONAA 3V3VA 4C8BA 3TKHA 1ZRZA 4JQ7A 2X4FA 4WSYA 5GZ9A 4LRJA 4WNPA 2P2IA 2VO0A 1YHSA 4QMLA 5ANDA 2YJSA 4KNBA 2W1ZA 4FUXA 4UY9A 4NYEA 4JBVA 4XX9A 2CGWA 5KMMA 2RFNA 3HNGA 5ANIA 4MHAA 1RE8A 3KL8A 2RGPA 4Z7HA 1FBNA 1PKGA 3C7IA 4IAYA 1AD5A 3R7GA 2VTOA 5KMLA 5C9CA 5HNIX 2OJJA 2XNBA 4YZDA 3GCUA 4MXAA 2WELA 4P9VA 4L01A 4EJ7A 2YLEA 1RQQC 2E9VA 3O17A 3FWQA 4I5MA 5CWZA 2ZM4A 1Q8WA 3OD6X 3QUPA 4R3PA 3W55A 3SW4A 3G15A 5EQYA 3MAZA 3EJ1A 3Q52A 1BLXA 1FHSA 1SHDA 4JT3A 3QFVA 2OLCA 3V5WA 1GNGA 2OG8A 4D1ZA 1OL7A 4ZOGA 4AZSA 5KNJA 5M44A 2C6DA 2JFMA 2PZPA 2YDIA 1XH6A 3UJGA 1BL6A 3KCFA 1F1WA 4GH2A 5FWKK 4FTLA 5CU3A 3HV4A 3VBVA 3NW6A 2LNXA 4EOOA 3D5VA 4XG9A 5LMKA 2XEZA 3G0FA 3FI2A 1WBOA 1YDRE 4DF3A 4S31A 2GNHA 4D55A 3ACKA 5J9ZA 1OKWA 1A1BA 3EHAA 2G01A 1JNKA 3WE8A 2A27A 3DAEA 4F5BA 4RFMA 3CQWA 2JIVA 3NNXA 4RLLA 4CXAA 5EG3A 3P7AA 3E8DA 3PIZA 3ULZA 4DTAA 3ZM4A 2K7AB 4IQ6A 3D7ZA 3EN4A 4YLLA 4ASZA 1SKJA 1OUYA 4RBLA 3R7EA 5B7VA 1ZYDA 3F2NA 5CI6A 3S0OA 5GIPE 5JN2A 3SGCA 4J95A 5CEOA 4M67A 4I0SA 1U5QA 4LYNA 4E1ZA 3CY3A 4WSQA 3F82A 4EL9A 5CF8A 5HX8A 3S9KA 4MXZA 3TN8A 3ZUTA 5HG9A 3KMMA 4UMPA 2WTKB 3HMMA 2PZ5A 4HZSA 4IX3A 2JDRA 1H08A 3FHRA 3DK7A 3PVBA 3ET7A 4IJ9A 2L6KA 2OIBA 2OH0E 3IW4A 3CS9A 3DKCA 4EOJA 3QWYA 3HP2A 3P08A 4CV9A 3DA6A 4P5ZA 3UIXA 4YNEA 3D94A 3FC1X 1H9OA 2CCHA 3C0IA 2I1MA 5DGZA 4AOJA 4C4JA 5AP1A 4EK4A 5EG3B 3EQBA 3Q4UA 1AB2A 1UU8A 3UZTA 2J4ZA 1TQMA 3UBDA 2WIHA 2Y7JA 5D1JA 3KRXA 2X1NA 4O21A 3MJ1A 3DDPA 2YCQA 2F2UA 4F9YA 3MW1A 3A7HA 3R8ZA 3KULA 4QSYA 3F7WA 4BCJA 3PXKA 4JS8A 3GVUA 1B39A 1KE5A 1IAHA 2F4JA 3QZGA 2JEDA 3BBWA 3BKBA 3DNDA 4D4RA 2FCIA 3AC1A 1CJ1A 4RJ7A 1NVRA 2I40A 2IJMA 2OF4A 4IZAA 1CKJA 2R4BA 4UWBA 5E7RA 4YBJA 3LMIA 5E8YA 4L43A 5AP3A 5M4FA 1UNLA 4GMYA 1LUIA 2JYQA 3KB7A 4XV9A 4FODA 4GCJA 2VNWA 3K5UA 2VO7A 4YURA 2HXQA 1O4EA 3Q5ZA 4IMYA 1QMZA 3DDQA 2AC3A 4ZK5A 3TTIA 4IDVA 3PFQA 4TZRA 1PXMA 5CU2A 5AUVA 2ZM3A 2C1BA 4QP1A 1K3AA 3MN3A 4FKOA 3OV1A 3NUXA 3FI4A 1UU3A 4RIXA 2CSNA 3KULB 2H5KA 2MK2A 3CBLA 3PVGA 4A4BA 4BCPA 5EYMA 1W82A 2OWBA 4FNXA 3NUYA 2ZYBA 3RPVA 3E63A 5EYKA 4M0YA 4EQCA 1UUSA 2EL8A 2WGJA 4K1BA 3UYSA 4AE9A 3OMVA 5E8TA 3R7OA 2UZUE 3R83A 4J71A 3K5VA 3O50A 2RG6A 3A7JA 5LARA 3TKUA 4KRCA 3CPBA 1IASA 1PMUA 2HOGA 4HYSA 2XZSA 4AQCA 4J99A 4BDGA 2ITYA 5M57A 4XLIA 4FIHA 4R77A 3P0MA 4I93A 4P5QA 1NVQA 5HCZA 2OICA 3PY0A 4U44A 2R0IA 3QXOA 1FU5A 4DAWA 1MRVA 5IMXA 1Y6BA 4GVJA 5JEBA 4DFNA 1OVEA 4QT1A 2J0KA 4FIFA 4BC6A 5FDPA 5GJDA 5C27A 1IA9A 3VQHA 3HRCA 2YITA 4RIXB 3VUKA 3ZS5A 4I0RA 4FVRA 4C38A 1IR3A 4NSTA 5H9BA 3MH2A 1BMKA 2YACA 3LAUA 4QP8A 4FI1A 4LGGA 2VWYA 3UOLA 2OK1A 2YJRA 3UOHA 1O4KA 2A1AB 3HECA 2WQMA 3GNIB 4XG8A 3R9RA 4IB5A 1ZYSA 4FKSA 4YSJA 1OIUA 2Z7QA 4O0TA 5AR7A 5HX6A 3E87A 3RAWA 4J1RA 1YXXA 4EYMA 3R1NA 4KBKA 2WPAA 1LUKA 3EWHA 4N6YA 4S34A 3PLSA 3AXWA 3EFJA 3QGWA 4KKEA 1O4IA 3DAJA 4OTQA 1P14A 4ZTHA 4BFMA 4P90A 5DT3A 1GZOA 3OB1B 3KY2A 3KN6A 4PTEA 4FVPA 5IA5A 1PXKA 4GFOA 4JJRA 5BQ0A 4O7WA 1HCLA 2WQNA 5FG8A 5F9EA 3TUCA 2GNFA 3PJ1A 3CEKA 3TNIA 4D0WA 4IAAA 4O2PA 1H1WA 3VF8A 2CIAA 2BKKA 4RFYA 4UX9A 3QX2A 1O9UA 4M8TA 5M51A 5IQBA 3RBWA 3DBQA 4H34A 2XNNA 2VGOA 5IUHA 4O1PA 3PE1A 4WNOA 3FZRA 3VC4A 4DGLC 2PNAA 3NLBA 1FVTA 3KF7A 5IKWA 1SZMA 4L46A 4QP4A 2CKQA 4BDJA 1WAKA 3FMLA 3FMMA 4EUTA 5M53A 1DAYA 2VX1A 3MV5A 3OHTA 4YHJA 2C5YA 4EH2A 5L6PA 1O47A 1PXLA 4FSWA 2J5EA 3GU8A 4UB7A 4RIYA 3R9NA 4QO9A 2RKUA 3UPZA 2ITOA 3UO5A 2EUFB 5E91A 3GCPA 1GZKA 2O0UA 4IB0A 4FV1A 4TPTA 3QWJA 1YXSA 2WAJA 4FX3A 5EDRA 3TZMA 2UV2A 5M06A 4RQKA 2BCJA 3W33A 3HAMA 3POZA 3TDWA 3KREA 2RSYA 4QMXA 1QPJA 4QRCA 3QWXX 3IK3A 1NY3A 2QURA 4O0RA 4IWDA 1ZAOA 4CEGA 3PJ3A 4YJOA 4FV9A 4YO6A 3V8TA 3WZKA 2WMXA 4TYEA 3JVSA 4ZS0A 4A9UA 4BRXA 5JGBA 1Q62A 4K2RA 2I7QA 2CJMA 2C47A 2X2LA 1URWA 2ZB1A 3LW0A 5IBMA 3HYHA 3NYXA 3OY1A 5EHOA 4LOOA 4UXLA 3RJCA 5KMNA 5DRDA 2WIPA 4RIYB 3UE4A 5FXRA 5HTBA 3V8WA 1V0BA 5C4KA 4BHZA 3S2PA 2BRBA 4P2KA 2DLYA 2UZWE 5HVYA 2PE2A 4L7FA 5EI8A 4FZ7A 4YJSA 5K4IA 1R1WA 1CKIA 3DJ7A 3LXLA 4OR5A 4RJ8A 4IM2A 4W9WA 4OW8A 1PXPA 2AC5A 3FL4A 3KEXA 3RPOA 4D9TA 2XCKA 3WZDA 2QLUA 3TL0A 2RFDA 3SRVA 4MCVA 4FT7A 3B2WA 4K0YA 2R3RA 4U81A 4IZYA 5GJHA 2DYLA 2K79B 5HG5A 3JY0A 3EQIA 3GBZA 5FUTA 1RW8A 3QL8A 5IH6A 3PP0A 1RDQE 3PQZA 4B8LA 2Y9QA 2W1IA 2YM3A 3NHNA 3A7GA 4CFFA 2PVNA 4TT7A 3OEZA 3R9OA 5CAQA 3P79A 4FIEA 1U4DA 2BZIB 1OI9A 3PY3A 4DLJA 3BI6A 5A4EA 5HLWA 1JWHA 3VS6A 2GFSA 3D2KA 3W16A 3KCKA 4BDDA 2XF0A 4R7IA 4AZVA 4GK3A 1OKYA 4JRNA 5IQHA 2ZMDA 2B9FA 1BHHA 4OTGA 2XBAA 1BM2A 2Y1NA 3Q6WA 5B0XA 4F0GA 4XNEA 3UOJA 4F7NA 1O4PA 3FLWA 2Z7LA 3SRVB 2IZSA 4XG4A 4A9TA 4DGPA 3EH9A 3W32A 4P7EA 1J1BA 5K0KA 1WBTA 2YA9A 4RIWA 3WI6A 4BWPA 1KA6A 3DLZA 2RL5A 4X2FA 1Y6AA 3GB2A 5HICA 4A06A 2FYSA 4HW7A 4W4VA 4JDIA 2YHVA 2C0OA 4JDHA 3TNHA 4U45A 3M1SA 2DVJA 3PSDA 4BCFA 4PNIA 2Y0AA 3MFTA 4RPVA 1CKPA 2FSLX 2VO6A 1ATPE 2OO8X 4CSVA 4K18A 4XP0A 5AP7A 1A09A 2BTRA 1LEWA 4XG6A 5IQDA 5EDQA 5ACKA 3FHIA 2OU7A 3NIZA 3PVWA 4CRSA 3JXWA 3MB6A 2C3KA 1RJBA 4GUEA 4TWOA 4ZMEA 4CD0A 5AUYA 3KXHA 3QYWA 4O83A 2E9UA 4BN1A 4FL3A 1JSUA 2UZBA 2J9MA 1UWJA 2YZAA 4C0TA 1PHKA 2WOUA 5EHLA 5AV0A 5KX8A 4ANBA 1G5SA 4E4XA 4BIEA 1JKLA 3FKLA 3N9XA 3BE9A 1F2FA 2L3TA 3BGZA 4H05A 3ZRMA 2R5TA 2HWOA 4RIWB 4TNBA 5F1ZA 1ZFPE 3MI9A 3THBA 1E1XA 5HIEA 1B38A 1OPKA 3DZOA 4R6VA 4TYHA 5DA3A 3ZFMA 2QO9A 3H0ZA 4ENYA 4EZ3A 4AU8A 4F7SA 2BDWA 3NAXA 4IE9A 3L9PA 5BVKA 3AT2A 2JAVA 3VGOA 1BX6A 1OBGA 2F7ZE 3OTUA 4KIOA 5KE0A 4BIBA 3H10A 5KMJA 2PUPA 5CAPA 3LMHA 5AULA 3COKA 2IW9A 2PVYA 4PPAA 4Y85A 3ZO4A 4E5AX 3FV8A 1WBSA 1ZMUA 4GYGA 4CV8A 4I22A 2X9EA 2ZDUA 3F3VA 4LMUA 3ZRLA 1TZEE 3IW7A 4M69A 1G8SA 4G3EA 2IUIA 2ERKA 4ZIMA 4BBFA 2VTIA 3BUXB 1TQIA 2A4LA 3P78A 4UXQA 5AP2A 4C33A 3GU6A 4GL9A 4UBAA 5AEPA 3CWGA 4FIIA 4PP9A 4S2ZA 3SLSA 3L9MA 2QOOA 3NNVA 5HE2A 2GNLA 2OZAA 2VWXA 4FZ6A 4NJ3A 4NM7A 2B1PA 1J3HA 2GQRA 3U9CA 1OIRA 3UYTA 5GJIA 3BUNB 2NRYA 3QX4A 1ZXEA 1UURA 2DLZA 3PXYA 4FTQA 3TZ9A 4Y5HA 3W18A 4QMVA 4TYHB 3U4UA 2YDKA 2RG5A 3H0YA 4ZP5A 5CQWA 3WF6A 3OCGA 4BWXA 2WHBA 3NAYA 4D2VA 2BAKA 2W17A 4HYUA 3ID6C 2C6MA 2UW5A 3E64A 3QTZA 4YLKA 3NUNA 1J7LA 1Q99A 3EFKA 1OL1A 4RRVA 4DEIA 3PRIA 2CGXA 5EKOA 1G3NA 5AX3A 4ZJIA 2DX0A 4JBPA 3BU6A 4BCHA 5K9IA 5M4UA 5C03A 4AT3A 1NXKA 1SM2A 2WEIA 4AZEA 4M69B 4CYIA 4H1JA 1YI6A 3MWUA 4WG3A 4II5A 4H58A 3EOCA 5FXSA 3PLAE 3NEWA 4KIPA 4DFXE 5HIBA 5K4JA 2J90A 3EFWA 4D5KA 4OHDA 2GHLA 3IDBA 3SQQA 3P5KA 3LLTA 3W8QA 2PUIA 4CZUA 3QRJA 2REIA 3QRUA 4DEAA 2R3JA 4RVLA 4KWPA 1U46A 3QQUA 3VWAA 4HJOA 3TIYA 2H46E 3F2AA 4UALA 3CTHA 1BFJA 4G6OA 3QD0A 2YIWA 4JOAA 1M2QA 4WUNA 1ZOGA 2ITPA 4JX3A 5IUGA 1X0NA 3D5WA 3KRJA 3FMEA 3PG3A 5AR4A 3LJ0A 2JLDA 3A4PA 3CC6A 5BUIA 2R3MA 3SC1A 2YM4A 5FP6A 4C61A 3VUGA 2XVDA 1APME 5KMIA 4OHEA 1PKDA 4OTHA 3K2MA 1KUTA 5HOAA 3VRQA 2WTKC 3DLSA 3R71A 3N4UA 3REPA 4C4EA 1SNXA 4NWGA 2UW8A 3RK5A 3MFSA 3DAKA 4GT4A 1H01A 3ZBFA 3F66A 5BMSA 4YU2A 4IC8A 3Q4CA 2CN5A 4G9RA 1MQ4A 2OH4A 4ITIA 5TO8A 4ACCA 3TUDA 2BZKB 1O45A 4Z55A 2IVTA 4DA5A 4IWOA 2ITTA 3OWKA 3Q04A 1SVEA 3AD5A 3QGYA 4J7BA 4KIQA 4EK6A 4KINA 1KOAA 5KHXA 3GU7A 4JRVA 1UKIA 2B52A 4PRJA 2KNOA 2C6IA 1XH9A 1FBZA 4G2FA 3FMHA 5FEEA 3C7QA 2OXXA 5E92A 2PU8A 2HMHA 5DVRA 5DIAA 2XCHA 4ZSJA 1J1CA 3GC9A 4B7TA 1NW1A 2YU7A 3OB2B 1ERKA 2ERZE 1M7NA 2V0DA 3OEFX 4I1ZA 4BCGA 4WNKA 4AT5A 4DCAA 1OO3A 2ECDA 4AA0A 2PWLA 4AN3A 2XNMA 3N84A 4OUCA 4FSUA 3QTRA 1VJYA 1ND4A 3AGMA 3DB8A 4YJTA 5FP5A 1REJA 4R78A 1P13A 4O84A 4EOQA 4YO4A 2R2PA 1X27A 2IZVA 4B99A 3VHKA 4DH7A 4HCVA 4QMPA 3G9LX 2UZOA 2AUGA 3PJPA 1JQHA 4AW5A 1U54A 4NWFA 1A9UA 2PVRA 1ZMWA 4NFNA 3EQDA 1D4TA 4BGHA 5A6OA 3IQ7A 2E9OA 1O4MA 2VIFA 5CF6A 4RC3A 1URCA 3A8WA 4IX4A 4I24A 3EACA 2X8EA 3GGFA 5KBQA 5D10A 2CI9A 4ERKA 2J2IB 4YBKA 4ACGA 3A99A 4G9CA 1SPSA 2XH5A 3VROA 1REKA 3NYOA 4C4GA 5DT0A 3QQKA 2MC1A 3F9NA 4WT6A 2CR4A 4MK0A 3HL7A 5C1QB 3U6HA 2PZYA 3I7CA 2GS6A 2PE1A 2GNIA 4FTRA 4EWHA 3I1AA 3FXWA 3LXKA 5T3QA 3JS2A 3QTUA 4C62A 3DKFA 4N4SA 3IOPA 3ZCLA 1WQUA 5DHJA 2VNYA 2C6KA 1U54B 2X7OA 2G2IA 2G2HA 4GK4A 4UN0C 4L7SA 3QD2B 3Q2JA 1HCTB 4V01A 4MKCA 3TDVA 4G6LA 3QYZA 3KU2A 4JDJA 1JWOA 5I6VA 1P4OA 4M3QA 4W8DA 3FE3A 5IZFA 2IZUA 4DTKA 4PMPA 4PY1A 5CDWA 3CPCA 4XLVA 3WF9A 4C4IA 4BGQA 4YZNA 4X6QC 4RA5A 1M52A 4YPSA 5CNOA 4A9SA 3IOKA 2IG7A 4JX7A 3LXPA 3W8LA 4CG8A 1GRIA 4ALWA 3CY2A 2UW6A 1FBVA 2IW6A 3O7LD 1O6LA 4A9RA 3FZ1A 4CFUA 1Y1UA 1A08A 2BUJA 3DBDA 5AM7A 2W4JA 2XUUA 2QC6A 3GENA 4BTJA 4Y72A 3VRZA 3E8EA 4WD5A 3N7YA 4X6RA 5ETIA 3EL7A 4D8KA 1CSNA 2JGZA 3A62A 2W05A 3OCTA 1NT2A 2UW7A 4XV1A 2EKXA 5GIOE 2Y6OA 3LFQA 5L6WL 2ZV2A 2CBLA 5EM8A 2J51A 1OL5A 3F6XA 4JDKA 3S8LA 4O86A 2R3OA 4U1PA 1FPUA 1E1VA 5DR2A 4FV2A 4APCA 4CQGA 2E9PA 5HCYA 1UKHA 4PL3A 4M12A 4QP9A 2PZRA 1W0XC 2EU9A 4GRBA 4FGRA 2YAAA 3U8WA 4CFXA 3GCSA 4OHHA 2PMLX 1DI9A 2OFUA 3IMDA 1V0OA 5JQ5A 3H30A 3NR9A 4O6EA 5GINE 3VO3A 4EWQA 4AG8A 4X0MA 1WMKA 3DT1A 3EZRA 4FKLA 2PUUA 2YSXA 2PMNX 4KB8A 3C4XA 1AYDA 4ANSA 4S33A 4BCOA 3S8NA 3BPRA 1XBAA 1UNHA 5HCXA 4HPUE 4PMSA 2IW8A 3RNIA 3EN9A 3U87A 5I9VA 3V04A 5GNKA 1YRPA 4QMWA 5KAZA 3LXNA 2MRKA 4RLKA 2P3GX 4FICA 3DXPA 3I0OA 4QYHA 3OBJA 1FVRA 2VTQA 4L8MA 4TWNA 2W1EA 5CALA 4Q5EA 4DYMA 1DI8A 2WZJA 4AGUA 3FQSA 3JUHA 4I21A 2KTYA 4YMJA 2VTTA 5CSVA 3TL8A 2C30A 3E7OA 4Y5QA 3CTQA 5HBEA 3GXWA 3OCBA 5FXQA 5CU0A 5HZNA 3E5AA 3N4TA 3DKOA 2HDXA 4UYAA 2HZ0A 5BNJA 1YOLA 2E2BA 3MH3A 5HVJA 4I92A 4G16A 2OJFE 3VULA 3EQPA 4EK3A 4CFMA 3JVRA 3G33A 4YZ9A 4YHTA 3KRWA 4L1BB 4XP2A 3OVVA 4QD6A 4O7LA 2GQSA 1W83A 4V04A 2VWZA 3FQHA 3PWDA 3IW6A 4YR8A 3RNYA 4ITHA 1PMEA 2CKEA 3QKLA 3PY1A 4ZTLA 2UVZA 3RPSA 4AE6A 3FLYA 3R30A 1P2AA 4TN6A 2FGIA 2GDOA 5A46A 4C02A 3WIGA 3BCEA 5TR6A 1MILA 3HV6A 4U40A 5HE1A 5C4LA 1LPUA 3GUBA 4FV6A 5E1SA 2VWWA 2QOCA 5HD7A 3VRNA 1H27A 2PLEA 5DOSA 5AXIA 4YZBA 3E92A 3QCQA 4IADA 3V6SA 4FEVA 4PL4A 3QZHA 1UU7A 1OIYA 3IDPA 4DGXA 4QOXA 4I3ZA 4C2VA 1KWPA 3HDMA 1Z5MA 3FI8A 2IUHA 3BQCA 3NZ0A 1GIJA 3K3IA 1PXOA 4H3PA 3AMYA 2VO3A 1OITA 3ORTA 4WO5A 2GTNA 3D5XA 3PJ8A 3VJOA 4BKYA 4W4XA 1YXVA 3L8XA 4Y95A 4F1OA 3OBGA 4MWIA 4C58A 3FL5A 1GY3A 4PUZA 3V51A 3V5TA 4Z7GA 5J1WA 1SMHA 3K3JA 3UQGA 3IKAA 4U42A 4ZAUA 5L2WA 1JSVA 2JBPA 4HPTE 4P9ZA 3A61A 2CPKE 2OKRA 5CS6A 5FM3A 3V8SA 4LG4A 2DCRA 3AC3A 2I0YA 2YM5A 4D4SA 3KXNA 4JG6A 3CTJA 4O0VA 2XK3A 3ZO2A 4GK2A 1O4CA 4UZDA 3MYGA 4FGBA 1OBDA 4E5BA 1Z9XA 3PVUA 4D2SA 3PSBA 4JIKA 4GU6A 5HESA 3PSJA 2XYNA 5DH3A 3BUOB 3E3BX 2GHMA 1HCSB 4ITJA 3ZOSA 4BDCA 4EZ7A 1O4DA 2LQWA 4Y46A 3R6XA 3GT8A 5IH5A 3Q60A 2UZTA 4YGAA 1T46A 4A4OA 3QUEA 3EB0A 3MTFA 4LV8A 3PSKA 2WU6A 2QR8A 4M84A 4U80A 2QU6A 3VS7A 3RZFA 4KIKA 4L67A 3R8PA 3L8SA 3RKBA 4O22A 2BZJA 4HNFA 1K9AA 2RFEA 4BZNA 2ITXA 2PYWA 4MQ2A 4WUAA 2FH9A 2X7GA 5ETFA 3DBEA 3OOMA 4QQ5A 1LUFA 5HG7A 5B2MA 3L1SA 2V22A 3MTLA 1CWEA 4G3GA 2OIDA 3MVJA 4LM5A 5EW9A 3RP9A 3DOGA 3IGOA 4ENXA 1JPAA 2RORA 5DT4A 3VUIA 1S9JA 4UEUA 2AOAA 4AW1A 2WMSA 4FT3A 2BMCA 2FO0A 4O91A 2YERA 2J5FA 3KXZA 4YJVA 3UMWA 4C59A 4ZJVA 3CKWA 2ZVAA 4XRJA 5HEZA 3A7FA 2CCIA 2ONLC 1D1ZA 3VBYA 3ZSHA 4NW6A 5BMMA 3M11A 5IEVA 5LVOA 4GKHA 1BMBA 4JEGA 2X6DA 1Z57A 3FKNA 5IG1A 3MXYA 4XCUA 4O7NA 4KIKB 5DN3A 3TACA 1A1CA 2PVHA 4CMTA 3BELA 5LCJA 4EONA 3DK6A 5EW8A 3W1FA 2PLDA 1YHWA 3ZO3A 4M66A 4F5AA 1J91A 2HELA 4K44A 3QCXA 2B9HA 1OGUA 1ZY5A 3O71A 5CEQA 1O4AA 4PL5A 3QTQA 4YP8A 2ZJWA 5AR5A 5A6NA 2P33A 3ACJA 3OVEA 1AOUF 2BR1A 2CDZA 3WYYA 1U5RA 2X81A 2YIXA 3ODZX 4Z9LA 3TV7A 5JFXA 3A4OX 1O4LA 1F0QA 3G51A 4C57A 1LKLA 3BWFA 4G3CA 4QMTA 3UF4A 1L8TA 3Q6UA 2WTCA 3HAVA 4QMQA 1H4LA 3NPCA 3QLFA 2OJ9A 1YXUA 4FTOA 3NCZA 3MIYA 3LIJA 3S95A 3QC4A 4BIDA 4UMUA 4MF1A 2WOTA 1R1SA 1QPCA 2R64A 4AOIA 5GJFA 3UO6A 4CTBA 4BY9E 4QMMA 3NSZA 3LQ5A 3HRBA 3C0GA 1STCE 2VN9A 3PPZA 2O3PA 2HW7A 3UNJA 5HO6A 3WE4A 4DT9A 3F3UA 4U97A 4L42A 3TTJA 5IPJA 2JKQA 4FL2A 3ZSGA 4O0UA 4ZTNA 3MPMA 3QRKA 2HY81 2RF9A 5D0JA 2UZDA 3G2FA 1GJOA 2XNOA 3DJ6A 4PV0A 5EK7A 5L3AA 1BLJA 5ETCA 1ZYJA 4HGEA 4A07A 3TEIA 1OKZA 4RVTA 5E8ZA 4BDFA 2XB7A 3RCJA 1WBNA 4BGGA 2WFYA 5L2IA 5L8LA 5EEQA 1KC2A 4WHZA 2HYYA 4UMTA 3I5ZA 2DS1A 2IUGA 4EOLA 3ZC6A 3FDNA 2QOHA 2Z8CA 4QYFA 2QCSA 3VVHA 4FE2A 3H3CA 3TIZA 2BKZA 1XH8A 3AQVA 4TXCA 2HCKA 2IVUA 2R0UA 2HZIA 2GCDA 1ZY4A 4YJQA 5EW3A 3SOAA 4BBEA 4EBWA 2NNWB 4I23A 2WTIA 4LOQA 2RFSA 1UU9A 3PLFB 1XJDA 3AGLA 2XBJA 1EH4A 3LCSA 2GS2A 3ENHA 3QHWA 4NCTA 3PA4A 2R3KA 2R3HA 3O51A 5LVPA 3Q9WA 4R5YA 4TRLA 4PDOA 1F5QA 4Y8DA 5J1VA 4JBQA 4KA3A 1H1RA 4GWFA 3PJ2A 2YISA 4JI9A 1YWRA 2F7XE 5EM5A 4ACDA 5CEIA 3FQEA 1R3CA 1JKSA 1XH4A 1Y91A 2W5BA 3DCVA 4MF0A 1MUOA 1T45A 3ZRKA 3O23A 3Q2MA 2ETKA 3MBLA 4FZAB 2CNQA 3D15A 4C4HA 5FLFA 4WNMA 4TKSA 4OAVB 2HY0A 3Q9YA 1JYRA 1BFIA 1WBWA 2XRWA 4XH6A 4FKWA 5AP4A 4O0XA 4AFEA 5KKRC 1IEPA 1MW4A 4PDPA 3AT3A 4AZWA 3F5XA 4S32A 4F65A 5AMNA 1GZ8A 4IANA 4MNEA 2YWPA 1VYZA 3RAIA 2GQGA 1UA2A 3B8QA 4Y83A 3S4QA 2W96B 2B0QA 3CLYA 5TT7A 1J7IA 4IX6A 4L3LA 5FEQA 5C8MA 2VUWA 2MRJA 4BWKA 4L44A 3ELJA 4LV5A 3V01A 3MB7A 4CFNA 5HGIA 3EQCA 3K54A 3KVXA 3NGAA 1Z3KA 4QTEA 2WTJA 2VX0A 3PE2A 4YHFA 4IHPA 5DE2A 3KVWA 4QP7A 3CSVA 4NM3A 2XKCA 5D11A 2QOIA 4C7TA 3U6JA 4KS7A 4W4YA 3ZEWA 5DLSA 3NUUA 4ZSEA 3GFWA 1Q97A 2CHLA 2HENA 5ETAA 1A06A 3F3WA 3FKOA 3H9FA 2Y3AB 5HORA 2KK6A 3NNWA 2EXCX 3HMNA 3WIKA 3B2TA 4PX6A 4YJRA 3AT4A 3E93A 1JKTA 4XG7A 5KZ0A 3QKMA 3AC4A 3SOCA 4APPA 4CLIA 4JBOA 2YDJA 5AA9A 4ZY5A 5HU9A 5ANOA 3FLQA 2XK6A 2PSQA 4BZDA 4DGMA 4I0TA 4FT9A 4MNEB 4O7TA 3LCDA 2C3IB 5CSHA 5HLNA 4QYYA 1SHAA 4EOIA 4YUQA 3FAAA 5D12A 3WYXA 4FK6A 5G6VA 2W0JA 3OOGA 1GIIA 5KBRA 3GC7A 2R9SA 3VJNA 4KABA 3LCTA 3VBTA 2GE9A 1B6CB 4KUJA 5FTOA 4R3CA 1OZ1A 4FTIA 3R7IA 4LRKA 4AZTA 4U3YA 2I0VA 4RJ5A 5ANJA 4XRLA 4I5PA 3AMAA 2PVFA 2W1HA 3F3ZA 2XP1A 5IA4A 3HUBA 2OJGA 4E93A 1YXTA 3CIKA 1Q5KA 5DMZA 2C69A 3CD3A 3N51A 3QTIA 3DTCA 3ZLWA 5AR2A 3G9NA 4G1WA 1ZYCA 5HNGA 3S00A 1BI7A 4F59A 3IPHA 3OUKA 4EHZA 4X6SA 3L8PA 3F5UA 1KV1A 3RINA 4MH7A 1PMVA 2JITA 3OXZA 3VRRA 3IDCA 1TQPA 1A1AA 3VQUA 3NX8A 4CMOA 3LFAA 1LP4A 2R3NA 5IQAA 4C3PA 3NS9A 5HNBA 3BV2A 5A4QA 3V5PA 3VN9A 3TV6A 5E8VA 2BVAA 3TZ7A 4HVHA 3MY0A 3A7IA 4DGNA 3T9TA 4FTAA 4F08A 2PVMA 3R9DA 3I7BA 4FV3A 4AF3A 4UMRA 4FEUA 2VGPA 3MIAA 4EHEA 4HVGA 2XRUA 4E5WA 1G8AA 4RC2A 1KE7A 2YCRA 3NDMA 4ZEGA 5HKWA 2HK5A 2X0GA 3HMPA 3VRPA 3LCOA 3ALOA 3G6GA 2B53A 2ZOQA 4ZY4A 3LM5A 2CGUA 1I44A 4J53A 3S3IA 3FLSA 3ORMA 4L45A 2I6LA 2BRHA 3MH1A 3NW5A 4K77A 4QYEA 4J52A 2ONLA 4IAZA 5E4HA 2YEXA 3P7BA 4KSQA 3BEAA 4GIIA 3WILA 4DEBA 2OQ1A 2CI8A 4JAJA 3S1HA 3CKXA 4QPSA 3D4QA 2B9IA 3AG9A 3F61A 4O38A 5AP5A 3QLGA 2XJ0A 3DV3A 2GNGA 3P7CA 4R7BA 1Q4LA 2Y4PA 3L9NA 5E8XA 4ZY6A 2VX3A 5EM6A 3W2QA 5TF9A 4CRLA 4F0FA 1BKXA 4QP3A 2WQOA 2B54A 5JT2A 1YDSE 3QRTA 1PYXA 4FTNA 5HBJA 4UV0A 2NRUA 1SNUA 5LVLA 5BVEA 1AOTF 2JFLA 3VS1A 5IH4A 3NYNA 3BIZA 2WMAA 1PXIA 3KKVA 4RX7A 4HNIA 4TY1A 5JRQA 3DTWA 3GXLA 4IAFA 4QTBA 3MVMA 4W8EA 4GKIA 1H25A 1QL6A 5CAUA 4EY0A 4U9AA 2UW3A 4QP2A 3C51A 4K11A 3VUTA 1O4GA 1KOBA 3FLZA 4ZSAA 4EUUA 4FKRA 1H24A 3QKKA 3Q32A 4MAOA 1UVRA 3D9VA 4ID7A 5DPVA 2IZRA 1A48A 1O41A 3QCYA 5J79A 2PY3A 3BU5A 4IB3A 5HE0A 3LMGA 5HBHA 2OXDA 3D5UA 1ZLTA 4I6FA 4U3ZA 4XBUA 5F20A 5CVGA 5IQFA 4AS0A 3QQHA 3NRMA 4I5HA 4O27B 4LOPA 3OY3A 4O0YA 3BYOA 3FZTA 2IO6A 4HCTA 4CGAA 5DI1A 5E8WA 3TCPA 4M14A 3ZFYA 4BCNA 4JIAA 5A54A 1Q3WA 4AN9A 1OECA 2R7BA 2Z60A 2W4KA 4I41A 2QQ7A 3FSFA 2PVLA 5FDXA 4E8AA 4ZLOA 2J6MA 1XHAA 4OTIA 5BVOA 1PXNA 3ZBXA 1O4JA 5IQIA 3SHEA 3COIA 4MTAA 4BICA 3DBFA 5T6KA 2PPQA 3QD4A 4E7WA 2NPQA 3D14A 2QR7A 5EKNA 2ITZA 4FKUA 1FVVA 4XUFA 1M17A 1XQZA 5AIRA 3CD8A 2IWIA 2W7XA 1BHFA 3DXQA 4MXCA 3QAME 5CSXA 2ZV7A 4KBCA 4TZIA 2UW4A 4BCIA 4MNFA 3BE2A 3COHA 1PY5A 2Z02A 3PXQA 3ZYAA 4H1OA 1NA7A 1OMWA 1UNGA 3DPKA 3IW8A 4QMZA 2Z7RA 5D7AA 2AYPA 3ZTXA 2X2KA 4E4NA 5FQDC 5M08A 2RVFA 2UZEA 4X3FC 3HUCA 4C35A 2VZ6A 3EQHA 4X21A 3R04A 3VUDA 4CMUA 1WFCA 1XO2B 5L6OA 5JFSA 2R3IA 4DH3A 2PE0A 2R3LA 3G90X 3SXSA 2C5NA 3OFMA 2ETMA 1FGIA 2QD9A 1OPLA 2E9NA 2QODA 4QQTA 4YPDA 4R1VA 3UC4A 3W2PA 4YC3A 5E1EA 4DH5A 1VZOA 2VWVA 1NVSA 2JC6A 3EYHA 2W06A 1BL7A 3LPBA 4IAIA 4O7SA 2PVJA 2Y1MA 3FJQE 1FQ1B 1WBVA 2XK4A 1X8BA 4FSMA 2J7TA 4EHVA 4LFIA 5FRIA 3CJGA 2P2HA 4I4EA 3ORLA 5DYJA 3FZSA 4N70A 4WRGA 5EELA 5J3XA 2IVVA 4FTTA 3RAHA 5JGDA 4PWNA 4DT8A 2QLQA 5TKDA 4CNHA 5IA0A 3NWWA 2R7IA 4FG9A 5IDNA 3PIXA 4NIFA 5H3QA 3WF5A 2XIKA 3ANRA 4E6QA 3ZLYA 3MSSA 1RPYA 4ZMFA 4K33A 4XV3A 3C5UA 2WEVA 3UP7A 2YCFA 3FYKX 4TYGA 2GSBA 3HZTA 1BLKA 5DEWA 4AP7A 3US4A 4PPBA 2R3GA 4TYJA 4C37A 4BB4A 3HGKA 4FBNA 4GIHA 4YJUA 3BYUA 4D2RA 2QOBA 2X2MA 1JOWB 2VTSA 4E26A 4Q9ZA 5KCVA 2XJ2A 5KKRB 5I9XA 4PDSA 3HX4A 3PUPA 2XMYA 4F9BA 3AOXA 3VS3A 4C2WA 4OBOA 4DFUA 1GIHA 4OT6A 4OBQA 3FXXA 3IG7A 5TE0A 4FEQA 4RSSA 4O7YA 3NW7A 3PSCA 4CT1A 5ACBC 3R8LA 4FV8A 4AGWA 2SHPA 3A2CA 1E9HA 3ROYA 4NIFB 5FM2A 5AX9A 2QNJA 4FSTA 4BCMA 4DEDA 5AUTA 2C0IA 3R02A 3ZEPA 4EK5A 2PTKA 2J0MB 3QWKA 5BO4A 5IISA 4FTCA 4IJPA 4ZZMA 5AFVA 5CSWA 2V62A 3ZXTA 3UZPA 5I5ZA 2VAGA 2P4IA 5AP6A 1YVLA 2OF2A 3C1XA 4A4LA 1ZZLA 2C4GA 4IH8A 4OTDA 3DY7A 4KKHA 3W2RA 4EEVA 5J9YA 5KZIA 3OS3A 3ORIA 2F57A 1LUNA 4FTUA 5DWRA 5M07A 3AC5A 2ETRA 3RPYA 2YM7A 3HMOA 3ODYX 4AGCA 4TW9A 4CVAA 3U51A 4AACA 3DQWA 2QOKA 5D7VA 3ZHPC 3P86A 5CEMA 5AV4A 2EO6A 5EOLA 2BHHA 3LFSA 4MXXA 2CLXA 5IU2A 2ZMCA 3FMJA 1W7HA 3IGGA 1FU6A 2GHGA 2FA2A 1XKKA 3FZOA 1FMKA 5DG5A 5AUXA 5I3RA 1QCFA 3UQFA 1H00A 2XIZA 1SHBA 3DQXA 1H0VA 1KE6A 1MRYA 2QKRA 3BYSA 3QZIA 4F7LA 1YKRA 2HW6A 4QMOA 5KMOA 2CMWA 1M2RA 4S30A 4H3BA 5HLPA 4CZYB 4EQUA 5IF1A 2QOLA 4WIHA 2QO7A 4I6QA 4DLIA 1TCEA 3GEQA 4MYGA 5DR9A 4WBOA 2C3LA 2XKEA 3ZZWA 1M2PA 2XIYA 3UVRA 2UUEA 3EN6A 3TI1A 4BDIA 3UODA 5K5XA 5CEPA 1YOJA 5H8GA 3WARA 1LEZA 3JY9A 4IBMA 5JK3A 1YI3A 2C5VA 1O44A 5HIDA 2ABLA 5AUZA 4F9WA 3UIBA 3C4FA 4N57A 4NUSA 4EKKA 3FI3A 4KSPA 4WA9A 4IAKA 4QNYA 1V0PA 2PMOX 3UVQA 4IEBA 4CYJA 5BUEA 4QMUA 2OIQA 5H8EA 3DS6A 4EH7A 3SW7A 3HV5A 4JVGA 1DM2A 4MD8E 5L4QA 4Q5HA 3ZSIA 3VS2A 3IN8A 2YIRA 5CY3A 3FPMA 2CLQA 4OHLA 2VTJA 5DC9A 1Y57A 2G2FA 4BKJA 4FMQA 4ZLZA 4RZWA 2Q0NA 2EYZA 3N8MA 2QVSE 3RMFA 4R5SA 2CNUA 1M27A 3EQRA 3JYAA 1S9IA 4NM0A 3R63A 3R7VA 3UIUA 4TWCA 3UQCA 5CI7A 1FYRA 1I3ZA 3IECA 3MVHA 3NIEA 5C8KA 1V1KA 1AQ1A 2EWAA 2Z2WA 1Q61A 5IQGA 3BBTB 4QPMA 4RG0A 4X2GA 2V7OA 3N4VA 3NUSA 2XK8A 5BVNA 4QNAA 4F09A 2XNPA 5JZNA 4F7JA 5KO1A 3F5PA 4IVBA 1UWHA 2B9JA 2XS0A 2X9FA 4CTCA 3KC3A 4RGJA 4ZTMA 2JDTA 4FSQA 4AA4A 1O42A 4NCTC 1QG1E 4A4XA 3KFAA 3LFDA 3O96A 2YN8A 2C6OA 4M68A 2H9VA 3R1QA 4CKRA 4M13A 4XMOA 3SG8A 4FG7A 5FBOA 4X2NA 2WKMA 3SVVA 3II5A 3LFFA 3C50A 2IZTA 5AV2A 1Q8UA 2PL0A 5LMBA 5GZ8A 1Q8TA 4Q2AA 4FSZA 4O1OA 2VWBA 2G15A 1ZOEA 2VTPA 2WU7A 1SVGA 2WQEA 2UW0A 4GS6A 3BHYA 5HHWA 3V5LA 4DFLA 2XYUA 4JQ8A 4DG2E 2X39A 3QU0A 3ZXZA 5E9EA 2YABA 4F99A 2VWUA 3ZC5A 2BILB 4K9YA 4GFGA 3GQLA 3VIDA 4BYJA 1O43A 3LZBA 3G6HA 3Q5IA 4KD1A 4HGLA 3ALNA 2QOQA 4IIRA 4I4FA 3QTWA 3VS0A 4X3FA 2WD1A 4XHKB 4ANQA 3KRRA 3GI3A 4TWPA 4CT2A 2QKWB 5AV3A 3EQGA 3ITZA 3LFNA 5D41A 4MX9A 4GL9E 4K8AA 4NEUA 4I94A 4JNWA 4F63A 1OM1A 2DM0A 4CLJA 1R39A 1ZARA 3TNWA 4J98A 4BL1A 1A81A 2YM6A 5B2LA 4G31A 3VNTA 5HKZA 3NVMB 4NU1A 4GT5A 1PICA 1FOTA 3BQRA 1I09A 2BALA 2LGCA 2QG5A 3QQJA 3R1SA 3GCQA 2O65A 2VWIA 3LFCA 2V7AA 3BYVA 3H4JA 3EIDA 5J7BA 4U17A 3MY5A 3PXZA 2AUHA 4NL0A 2JIIA 3QTXA 1YVHA 1OL6A 4HYIA 4H1MA 4NZWB 4U5JA 3OP0A 4FIGA 4BF2A 5IBSA 4XOYA 5DEYA 3IONA 4X3FB 3LFEA 3HP5A 3ZUVA 1O49A 4ERWA 3PP1A 4EORA 1DAWA 4FZFB 2YLFA 4JG7A 1BG1A 3I6UA 5HTCA 3I4BA 3GOPA 5CZHA 3KXMA 2C6LA 3GCVA 4FYNA 2EVAA 5I9WA 1LCJA 5JMSA 1ZZ2A 3I60A 2OBJA 1SVHA 5CNNA 4DGOA 1FINA 3DBCA 5DNRA 1JBPE 3OZ6A 5K5NA 3FMNA 3VS4A 3POOA 3F3TA 4OTPA 4IB1A 4FYOA 1W84A 4WG4A 2ZM1A 3C4ZA 3SX9A 4ACMA 5JZJA 5CU4A 4ZTRA 2GU8A 4PTGA 3QUDA 1AYBA 2CKOA 2KULA 3HA8A 4P4CA 2WMQA 1BUHA 4NW5A 4G5PA 1O6KA 3ORZA 3KMUA 4JL9A 3CGFA 1H28A 4ZLYA 3MFUA 2WQBA 4C36A 3OWJA 4QMSA 2X4ZA 5I0BA 2BZHB 4BCKA 2H8HA 3ERKA 1LCKA 2HWPA 4FNZA 3C4CA 4RC4A 3RWPA 2W1DA 4IZ5A 2C6EA 4FSYA 4E4MA 3ZONA 1XA6A 3E62A 4F6UA 1H0WA 3C13A 4EH6A 1Y8GA 4F1TA 3MH0A 4IACA 4PTCA 5A14A 5HU3A 2BBUA 4AW2A 3BHUA 3LOKA 2UZVA 4IFGA 3AD6A 1CDKA 1XH5A 3MVLA 1BYGA 5IA3A 4A4CA 1ZOHA 4I6HA 4DEHA 4O2ZA 5JFWA 4OHIA 3IN7A 4GV1A 4HGSA 2G9XA 4IVDA 5LMAA 2BTSA 4IWPA 4D5HA 5IA2A 2Y8OA 1GHUA 3O8UA 3BLRA 4CFVA 2Y4IC 2EO3A 3BLQA 5BVWA 5HD4A 1HCKA 3TJCA 4AX8A 3AMBA 5CAVA 5JGAA 5EYDA 1AYAA 3BUMB 2CKPA 3F88A 5EHRA 5JKGA 5HG8A 4HGTA 1O4FA 1KV2A 3LQ3A 3TNQB 3VW8A 5LXMA 4EOKA 4DE4A 3QD3A 3VAPA 4MXOA 2X8DA 3G5DA 4ZTQA 5HO8A 3VRYA 4D4YA 3KFJA 3C0HA 4FKQA 3EMGA 3UDBA 3AC8A 5M4IA 4AFJA 5H8BA 3EZVA 2OXYA 3LHJA 2CS0A 5BVFA 2BRGA 3OF0A 4FKGA 4N0SA 4M0ZA 5BUJA 5EQPA 3UTOA 3GU4A 4DN5A 4QTCA 3KN5A 1WVWA 3OW4A 3W10A 3Q53A 4LL5A 2ZV9A 5L2QA 3IMJA 3QQGA 1R0PA 4QTAA 4YTCA 3UP2A 3UC3A 4XV2A 4BKZA 4YTIA 3EN5A 2CRHA 3RHKA 2JDSA 5LQFA 4EH4A 4JAIA 3HLLA 4LMNA 4ORKA 2FSOX 4D0XA 5M56A 4FBXA 4ANNA 4Y73A 5IA1A 4CCBA 3ATSA 3E8CA 4UZHA 5GJGA 4AXAA 4ALVA 5M09A 4U7ZA 3H9OA 5AR3A 3FC2A 3EYGA 5CXHA 4DH8A 3HIZB 3DFAA 4ASXA 3DK3A 2XP2A 3QA8A 4M15A 3TZ8A 5KMKA 5AAGA 4J8MA 3O0GA 5EOBA 1O4BA 3M2WA 1BI8A 2YM8A 3CXWA 5IQEA 3SD0A 3LVPA 4E4LA 3P4KA 5EI6A 4GU9A 5AV1A 4MVFA 4BDEA 4FTMA 1M7QA 1XBBA 4RT7A 2YZLA 1NZLA 2QG7A 3EKKA 4A9YA 3TJDA 2PHKA 2UZNA 3HEGA 5AAFA 2OGVA 4LRMA 4U41A 4YC6A 3TG1A 3OWLA 5EHPA 3MFRA 4PF4A 2LAVA 3UOKA 4U0IA 2JDOA 4GG7A 1OKVA 2H34A 2QONA 3FYJX 3UMXA 4DG0E 4EJNA 5JQ8A 1UV5A 1AYCA 3BU3A 4FT5A 4GFMA 4YSMA 4TTHB 4RIOA 3WZUA 4EBVA 4F64A 3CGOA 1HOWA 1H26A 2ZDTA 1YOMA 3BGPA 1MP8A 2BIKB 3F69A 3KXXA 5FBNC 4EK8A 2C0TA 5IDPA 2JDVA 2OJIA 4EH3A 2LQNA 4TYIA 5J5SA 3MESA 3F7ZA 3HVCA 5E8UA 1U59A 2WMUA 3D0EA 5DBXA 5I3OA 3PZEA 4NTSA 4MQ1A 1Q3DA 2NO3A 3HV7A 3SG9A 3EKNA 3MPTA 3KA0A 4XOZA 4U43A 3RCDA 3PDTA 4O82A 1ZMVA 2GTMA 5A4CA 4G17A 4WWQA 3BX5A 2HIWA 2HXLA 3CQEA 3EL8A 1H1SA 4BDKA 4EKLA 2J0LA 3K2LA 1KE8A 4YTHA 1G83A 4X2KA 4JE4A 5ITAA 3F2RA 4DTBA 2WNTA 2BAQA 3HRFA 5ANGA 5AP0A 3SKCA 4BBMA 1IAJA 4MBJA 5LOHA 3BZ3A 3VUMA 3SXFA 3L9LA 4EHGA 5BX0A 3R9HA 4QMYA 1QPDA 3DNEA 2FSTX 4IM3A 3SV0A 2GS7A 3NUPA 5AA8A 3ANQA 4NJDA 2VTRA 2WMRA 4LL0A 4EC9A 4F1MA 3R1YA 3TKIA 3QC9A 4H36A 2QU5A 1CMKE 4L9IA 3ZLXA 4AWIA 1XWSA 2GMXA 4AT4A 2UZLA 4RQVA 5CASA 3PA5A 5HQ0A 2B7AA 3QQLA 2PMIA 3RPRA 4X3JA 4HVIA 5FD2A 1PJKA 5IEYA 4X7QA 5DRBA 3E7VA 2JAMA 5H2UA 3U6IA 3QALE 3E8NA 1O6YA 2Q0BA 4FR4A 2JD5A 4XYFA 4IWQA 4QQCA 3ATTA 3DU8A 4X2JA 4C3RA 4USFA 4WKQA 3ZU7A 1A07A 1DS5A 4QQJA 4DFBA 1Q41A 4BI0A 3MXCA 2WTWA 3O8TA 5AUUA 1ZYLA 2IN6A 2W5AA 3MGYA 5J5TA 3EFLA 4GT3A 3U54A 4E68A 2OFVA 4EH8A 1NRVA 1IG1A 4YC8A 5CYIA 2FUMA 3T3UA 3TT0A 2J0IA 3KK8A 4NM5A 5CENA 3LFBA 2A2AA 3ENMA 4FV4A 1OL2A 4RX9A 1QADA 1CWDL 4EQMA 2VRXA 1YQJA 2JBOA 2O8YA 3A8XA 2VV9A 1H8FA 1RQQA 1GZNA 1YWVA 3D83A 3MY1A 4XG2A 4B4LA 3C4EA 5C8NA 4OAUC 3T04A 4PP7A 3FEGA 4RWLA 4FV7A 1JLUE 4BZOA 4DC2A 4QMNA 4L68A 1Y8YA 5I9YA 4KAOA 4RJ3A 5G1XA 3RALA 1YWNA 4FIJA 2EYVA 2QMSA 3RWQA 4ANMA 2H96A 4Z16A 5A4LA 3QZFA 3FBVA 4JR3A 4RJ6A 5IQCA 3ZMMA 2W1FA 1R0EA 3MA3A 4V0GA 4ACHA 2XIRA 2HAKA 3R2YA 3V5JA 3PTGA 4USDA 5C01A 2QHNA 4K45A 5HO7A 1JYQA 3OW3A 4NK9A 4IFCA 5CLPA 5A9UA 4OT5A 3DFCB 2CNVA 5EH0A 3DXNA 2SRCA 3TV4A 3ZZEA 4CZTA 2YIQA 4D2WA 1LKKA 4MBLA 4BDAA 4FOBA 4M97A 5CSPA 2VTLA 4DCEA
chains in the Genus database with same CATH superfamily
2VD5A 1W8CA 4O0WA 3ORNA 5CVFA 3ZM9A 5A3XA 3BUWB 3KXGA 4D28A 1XMMA 2P55A 3QF9A 3OXIA 2BIYA 4LI5A 5IMEA 4BTFA 4PQNA 3FY2A 3LCKA 3NUAA 3DB6A 1P4FA 4RFZA 2ETZA 1O4RA 4DHFA 4L3PA 3PWYA 3MJ2A 1IRKA 2UVYA 2XNEA 4FTKA 5LCKA 4F0IA 2EYYA 1TKIA 4RJ4A 5DC0B 4FUYA 4CCUA 2NP8A 4V0GB 3BHTA 2WMWA 3OC1A 5CANA 2BDFA 5L2SA 2W1GA 3QXPA 3HA6A 5L2TA 3FPQA 3R8VA 1JVPP 3ZDUA 4EZ5A 4IXPA 5ICPA 1WVXA 3KGAA 4RA4A 3HMIA 3UNKA 1Q24A 2EXMA 1J7UA 4G3DA 4K6ZA 4LQMA 2IPXA 4DGGA 3PFVA 2YAKA 3OCSA 3WZEA 4AN2A 4RMZA 4XEYA 3GQIB 2RSVA 1O4QA 2ITQA 3QQFA 4BVUA 5I4NA 3QTSA 1CTPE 4FK3A 2UW9A 2X6EA 5IEXA 2CGVA 3UGCA 1TVOA 4IC7A 4XZ1A 2BFYA 4R1YA 4EOSA 1O4OA 1YI4A 3HV3A 2ZB0A 4FF8A 4IVCA 1PXJA 3W2SA 5AAEA 2F9GA 1PF8A 4FSRA 4EOMA 3EQFA 2VTHA 2C68A 1VR2A 4GJ3A 3U4WA 4JQEA 1ST4A 3M7FA 3D7TA 4V05A 2XM9A 2BDJA 1IS0A 2I0EA 4GW8A 5DC4A 3RI1A 3C4WA 3VBXA 4O96A 2Y4IB 1PMNA 2YCSA 3IO7A 4RWJA 3FLNC 1LR4A 4F6SA 3FZPA 3OT3A 4YLJA 3GOKA 4BR3A 5FTGA 3CR0A 4FKVA 4MXYA 1XH7A 1OUKA 5ANKA 4A7CA 2PULA 3RVGA 4UMQA 2XARA 2JKMA 3A60A 3R7UA 4NTTA 2GFCA 2X8IA 4I6BA 3ORXA 3R0TA 4YJNA 3UIMA 4AUAA 3OROA 4IDTA 3RZBA 3V6RA 2ZV8A 3ZFXA 4UWYA 5LVNA 4C34A 4D1SA 4RX8A 4ASDA 4D4VA 3Q9ZA 4FNYA 4DINA 4O7VA 1BHHB 3PA3A 3VW6A 3ZLSA 2C5XA 1SYKA 4WOVA 3QCSA 1W98A 3IS5A 4YJPA 5CXZA 1D4WA 2J0JA 3TWJA 3BHHA 4MEDA 4FKTA 2OZOA 2XKFA 1OPJA 2BPMA 2QI8A 2VTMA 3EN7A 5CVHA 4U8ZA 5EFQA 3R8MA 5J9LA 2XK7A 4E6AA 1R1PA 2PVKA 3D7TB 3KRLA 3OUNB 4DITA 1H1PA 2Z7SA 4BI2A 1WCCA 1O4HA 3G0EA 5IUIA 2BAJA 2F7EE 3BYMA 4U79A 3CE3A 3RGFA 3RM7A 5LJJA 3VBWA 2J50A 4B9DA 3HCKA 4CKIA 2XM8A 3DJ5A 3FXZA 4BTKA 3BGQA 4WRSA 2V55A 5HKYA 2EB3A 4PPCA 3PYYA 2ITWA 5ANEA 1CSYA 2FSMX 2IVSA 4DEEA 2BROA 1MRUA 2FB8A 4GG5A 3OXTA 3UNZA 1RJAA 4HCUA 4NWMA 4DFZE 2GNJA 1YW2A 2PNBA 1YHVA 2B4SB 3O7LB 3ULIA 1GAGA 1BKLA 4G34A 4EH5A 3R22A 5T68A 3O2MA 4RWKA 3U55A 2F49A 4YNOA 3GXXA 3BHVA 5CX9A 2XA4A 4D9UA 5AR8A 3NFFB 2BRMA 2EB2A 3BRBA 3W2OA 1SPRA 3FY0A 1F3MC 3FMDA 3R7YA 3UG1A 1PRYA 2XNGA 3CXLA 3PPKA 4CQEA 4PNKA 1ZWSA 3WF8A 5EDPA 4R8QA 4W4WA 5K3YA 2DUVA 2XANA 3PG1A 2WMTA 4M7IA 1WZYA 2OSCA 3C9WA 4I20A 3RTPA 2W9FB 3FMKA 3RK7A 3VF9A 5I9UA 5HVKA 4FT0A 5CAOA 3RM6A 4E6CA 3SXRA 3OP5A 4ANOA 3LLAA 4QP6A 1KSWA 4O7RA 2W99B 2JKKA 4ZZOA 4UYNA 4HOKA 4XG3A 2OZAB 5AM6A 4WBBB 1JKKA 4FL1A 2O2UA 4FA2A 2ZAZA 3VUHA 2WTVA 3AC2A 4AA5A 2O64A 4EIHA 5DR6A 4LGDA 5FTQA 2Q83A 5J87A 4EH9A 4F9CA 1YVJA 3BLHA 1R78A 2X7FA 4XBRA 5C26A 4FV5A 5CTPA 3S8OA 4KRDA 4QTDA 1PYEA 4ANLA 4O4EA 3FSKA 4UWCA 4CKJA 3T9IA 4AW0A 4N6ZA 5LWMA 1FGKA 2R3QA 3Q4ZA 4O81A 2JKOA 4JLCA 4ZJJA 4R3RA 3UYOA 2WMVA 4Q9SA 5JH6A 4M4ZA 2GPHA 3KQ7A 4IW0A 2XJ1A 3MS9A 2C1AA 4TNDA 4AZFA 4IM0A 4DBNA 2PUNA 4CG9A 1JYUA 3ZDIA 4MWHA 3IW5A 3C5IA 5E90A 5M55A 5K0XA 1CSZA 2GSFA 5EM7A 3PS5A 4F4PA 4QDEA 2XKDA 3LE6A 5LMKC 3D2IA 5HKMA 4FKJA 3R00A 4C3FA 2RMXA 4XP3A 3ORKA 4EYJA 4EC8A 1JSTA 4BYIA 5DF6A 4LUDA 3R28A 3UZRA 2C5OA 1A1EA 2FVDA 2A0CX 3QBNA 4L52A 2WB8A 1K2PA 3HHMB 2QOFA 4NH1A 4ZZNA 3NYVA 2OW3A 2PK9A 3UDZA 3PRFA 4F9AA 2VTAA 2YWVA 4D2PA 1H07A 2HZNA 2WXVA 2DQ7X 2C9WA 3P9JA 4FVQA 5KHWA 4G5JA 3KF4A 4RVMA 3PXFA 2WMBA 4RVKA 3LKMA 3KK9A 3NVKI 3W0SA 4RWIA 3SAYA 4QPAA 3UG2A 3PZHA 4U6RA 5AIKA 2ZFYA 3ZO1A 2H6DA 4ZS4A 3T8OA 3EAZA 4OTFA 3PXRA 3BV3A 4KKGA 4IX5A 3UPXA 3SA0A 2ITVA 2DWBA 4PMTA 3GC8A 2P0CA 3LJ2A 1NZVA 1WBPA 2HZ4A 3Q9XA 4F6WA 4FNWA 1R1QA 2W4OA 5FEDA 4BCQA 5L8JA 3T3VA 4DH1A 2XK9A 2LRAA 4FTJA 5HTIA 1JU5A 3ZNIA 5EQEA 3LJ1A 3W0MA 4LGHA 4GPLB 3E88A 3L8VA 3NMUF 3W2CA 4B6LA 4USEA 5JRSA 4FG8A 3UO4A 3VBQA 3V5QA 4TL0A 3ZH8A 4JG8A 4MD7E 3PPJA 4D2TA 3ORPA 1CM8A 4J8NA 4QYGA 1PW2A 3R73A 4D1XA 1WVYA 4LUEA 4JXFA 1L3RE 4D58A 2LNWA 1O48A 3R21A 5BYYA 3VS5A 3R8UA 3P1AA 4FKIA 2WO6A 3VHEA 4RZVA 3TXOA 4H3QA 2OI4X 4HVDA 3NCGA 1KE9A 1P5EA 4L6QA 4ARKA 4DEGA 1O46A 2RIOA 3H9RA 4AGDA 4IVAA 4O6LA 4L3JA 5EHYA 1M14A 2O63A 3TM0A 2HDVA 4JGHA 2PZIA 3JPVA 5HI2A 4FKPA 3I0QA 4HYHA 2QO2A 3QRIA 3B8RA 4ZXTA 5GZAA 5BYZA 5F95A 3R2BA 2XEYA 2BHEA 5HE3A 5F4NA 2UVXA 3O5AA 4NKAA 3Q96A 1XBCA 4BI1A 1LUMA 3QHRA 2I0HA 5CQUA 4E6DA 4YTFA 5BYLA 4GYIA 1M61A 1X6CA 4I5CA 2ESMA 1VEBA 4O0SA 5F94A 1VLRA 3Q3BA 4KS8A 2QHMA 4FZDB 3QA0A 5TOZA 3WA4A 5CF5A 4EOPA 2ACXA 4DFYA 3PIYA 2F2CB 3AD4A 5CEKA 1GOLA 2B3OA 1IJRA 4ZSGA 5E8SA 3RK9A 5J95A 3E3PA 3DGKA 2C6TA 3O8PA 5CT0A 5DFPA 4DG3E 4PDYA 1BF5A 3TNPC 5B2KA 3TKZA 4O7ZA 3COMA 4FOCA 2ITUA 2WTDA 3I5NA 3FUPA 5BPYA 2W1CA 4OGRA 2YIYA 4MBIA 2YFXA 3P23A 4WG5A 3SDJA 4AAAA 5EI2A 3WZJA 1AGWA 4H39A 1OIQA 2EXEA 3Q4TA 5CU6A 4E3CA 1FMOE 2G1TA 3ZUUA 4F70A 4J96A 1TFFA 2R3FA 5AADA 4B8MA 3CJFA 1YDTE 4IZ7A 4GJ2A 4CFWA 3GQIA 4G3FA 1Q8YA 3PJCA 1XR1A 3GC0A 3BEGA 3ROCA 2A19B 2VTNA 3GFEA 1OO4A 3OT8A 4OTRA 3F5GA 5GHVA 3MDYA 2W9ZB 3BWJA 3UVPA 3TUBA 3MPAA 4YZMA 3RAKA 4GUBA 4L53A 5D9HA 4ASEA 5AJQA 3ETAA 2JIUA 3LQ8A 4PMMA 5A4TA 2AOBA 2MQIA 3WF7A 4NT4A 3DZQA 2BFXA 4KBAA 3MA6A 4OLIA 2Y6MA 3WOWA 4C4FA 5CF4A 3GP0A 5CZIA 1XMLA 3CP9A 4MD9E 5FGKA 4DBXA 2ITNA 5AWMA 3OWPA 4ALUA 4E73A 3NNUA 3I79A 4OTWA 1IA8A 4XS2A 4ZTSA 3GU5A 2HUWA 3HDNA 4HZRA 5BVDA 4GVAA 4RX5A 1VYWA 5CT7A 3U9NA 3DKGA 3WBLA 4FC0A 5AUWA 2LCTA 3LM0A 2L4KA 1JAMA 3OTVA 2C3JA 1Q8ZA 4BDHA 5M4CA 4NKSA 5J8IA 3RHXA 3OG7A 3JR1A 4FEXA 2CN8A 5JSMA 4L00A 4J97A 2V5QA 4YZCA 1H1QA 1MQBA 4FSNA 3I6WA 4FV0A 4HVSA 5LWNA 2R3PA 1BKMA 4XZ0A 2BRNA 4W9XA 4G6NA 5I9ZA 5LVMA 4FEWA 4GSBA 5L8KA 4LV7A 2EOBA 2XIXA 3M42A 4GEOA 3I81A 4OBPA 2VU3A 4ZSLA 4BDBA 4EI4A 4BHNA 1QPEA 2EU0A 4NFMA 4R7HA 2W5HA 1KA7A 5KUPA 4Z3VA 1O4NA 4JR7A 4AOTA 5J7HA 3KMWA 4B0GA 4ROJA 4E20A 1B47A 4XJ0A 3CQUA 3CCNA 3R01A 4BTMA 1OB3A 5JFVA 5EYCA 2B55A 2O5KA 3HKOA 4ONAA 3V3VA 4C8BA 3TKHA 1ZRZA 4JQ7A 2X4FA 4WSYA 5GZ9A 4LRJA 4WNPA 2P2IA 2VO0A 1YHSA 4QMLA 5ANDA 2YJSA 4KNBA 2W1ZA 4FUXA 4UY9A 4NYEA 4JBVA 4XX9A 2CGWA 5KMMA 2RFNA 3HNGA 5ANIA 4MHAA 1RE8A 3KL8A 2RGPA 4Z7HA 1FBNA 1PKGA 3UDTA 4IAYA 1AD5A 3R7GA 3C7IA 2VTOA 5KMLA 5C9CA 5HNIX 2OJJA 2XNBA 4YZDA 3GCUA 4MXAA 2WELA 4P9VA 4L01A 4EJ7A 2YLEA 1RQQC 2E9VA 3O17A 3FWQA 4I5MA 5CWZA 2ZM4A 1Q8WA 3OD6X 3QUPA 4R3PA 3W55A 3SW4A 3G15A 5EQYA 3MAZA 3EJ1A 3Q52A 1BLXA 1FHSA 1SHDA 4JT3A 3QFVA 2OLCA 3V5WA 1GNGA 2OG8A 4D1ZA 1OL7A 4ZOGA 4AZSA 5KNJA 5M44A 2C6DA 2JFMA 2PZPA 2YDIA 3W0QA 1XH6A 3UJGA 1BL6A 3KCFA 1F1WA 4GH2A 5FWKK 4FTLA 5CU3A 3HV4A 3VBVA 3NW6A 2LNXA 4EOOA 3D5VA 4XG9A 5LMKA 2XEZA 3G0FA 3FI2A 1WBOA 1YDRE 4DF3A 4S31A 2GNHA 4D55A 3ACKA 5J9ZA 1OKWA 1A1BA 3EHAA 2G01A 1JNKA 3WE8A 2A27A 3DAEA 4F5BA 4RFMA 3CQWA 2JIVA 3NNXA 4RLLA 4CXAA 5EG3A 3P7AA 3E8DA 3PIZA 3ULZA 4DTAA 3ZM4A 2K7AB 4IQ6A 1W2CA 3D7ZA 3EN4A 4YLLA 4ASZA 1SKJA 1OUYA 4RBLA 3R7EA 5B7VA 1ZYDA 3F2NA 5CI6A 3S0OA 5GIPE 5JN2A 3SGCA 4J95A 5CEOA 4M67A 4I0SA 1U5QA 4LYNA 4E1ZA 3CY3A 4WSQA 3F82A 4EL9A 5CF8A 5HX8A 3P5JC 3S9KA 4MXZA 3TN8A 3ZUTA 5HG9A 3KMMA 4UMPA 2WTKB 3HMMA 2PZ5A 4HZSA 4IX3A 2JDRA 1H08A 3FHRA 3DK7A 3PVBA 3ET7A 4IJ9A 2L6KA 1W2FA 2OIBA 2OH0E 3IW4A 3CS9A 3DKCA 4EOJA 3QWYA 3HP2A 3P08A 4CV9A 3DA6A 4P5ZA 3UIXA 4YNEA 3D94A 3FC1X 1H9OA 2CCHA 3C0IA 2I1MA 5DGZA 4AOJA 4C4JA 5AP1A 4EK4A 2AEGA 5EG3B 3EQBA 3Q4UA 1AB2A 1UU8A 3UZTA 2J4ZA 1TQMA 3UBDA 2WIHA 2Y7JA 5D1JA 3KRXA 2X1NA 4O21A 3MJ1A 3DDPA 2YCQA 2F2UA 4F9YA 3MW1A 3A7HA 3R8ZA 3KULA 4QSYA 3F7WA 4BCJA 3PXKA 4JS8A 3GVUA 1B39A 1KE5A 1IAHA 2F4JA 3QZGA 2JEDA 3BBWA 3BKBA 3DNDA 4D4RA 2FCIA 3AC1A 1CJ1A 4RJ7A 1NVRA 2I40A 2IJMA 2OF4A 4IZAA 1CKJA 2R4BA 4UWBA 5E7RA 4YBJA 3LMIA 5E8YA 4L43A 5AP3A 5M4FA 1UNLA 4GMYA 1LUIA 2JYQA 3KB7A 4XV9A 4FODA 4GCJA 2VNWA 3K5UA 2VO7A 4YURA 2HXQA 1O4EA 3Q5ZA 4IMYA 1QMZA 3DDQA 2AC3A 4ZK5A 3TTIA 4IDVA 3PFQA 4TZRA 1PXMA 5CU2A 5AUVA 2ZM3A 2C1BA 4QP1A 1K3AA 3MN3A 4FKOA 3OV1A 3NUXA 3FI4A 1UU3A 4RIXA 2CSNA 3KULB 2H5KA 2MK2A 3CBLA 3PVGA 4A4BA 4BCPA 5EYMA 1W82A 2OWBA 4FNXA 3NUYA 2ZYBA 3RPVA 3E63A 5EYKA 4M0YA 4EQCA 1UUSA 2EL8A 2WGJA 4K1BA 3UYSA 4AE9A 3OMVA 5E8TA 3R7OA 2UZUE 3R83A 4J71A 3K5VA 3O50A 2RG6A 3A7JA 5LARA 3TKUA 4KRCA 3CPBA 1IASA 1PMUA 2HOGA 4HYSA 2XZSA 4AQCA 4J99A 4BDGA 2ITYA 5M57A 4XLIA 4FIHA 4R77A 3P0MA 4I93A 4P5QA 1NVQA 5HCZA 2OICA 3PY0A 4O4BB 4U44A 2R0IA 3QXOA 1FU5A 4DAWA 1MRVA 5IMXA 1Y6BA 4GVJA 5JEBA 4DFNA 1OVEA 4QT1A 2J0KA 4FIFA 4BC6A 5FDPA 5GJDA 5C27A 1IA9A 3VQHA 3HRCA 2YITA 4RIXB 3VUKA 3ZS5A 4I0RA 4FVRA 4C38A 1IR3A 4NSTA 5H9BA 4DHJA 3MH2A 1BMKA 2YACA 3LAUA 4QP8A 4FI1A 4LGGA 2VWYA 3UOLA 2OK1A 2YJRA 3UOHA 1O4KA 2A1AB 3HECA 2WQMA 3GNIB 4XG8A 3R9RA 4IB5A 1ZYSA 4FKSA 4YSJA 1OIUA 2Z7QA 4O0TA 5AR7A 5HX6A 3E87A 2IEWA 3RAWA 4J1RA 1YXXA 4EYMA 3R1NA 4KBKA 2WPAA 1LUKA 3EWHA 4N6YA 4S34A 3PLSA 3AXWA 3EFJA 3QGWA 4KKEA 1O4IA 3DAJA 4OTQA 1P14A 4ZTHA 4BFMA 4P90A 5DT3A 1GZOA 3OB1B 1TZDA 3KN6A 3KY2A 4PTEA 4FVPA 5IA5A 1PXKA 4GFOA 4JJRA 5BQ0A 4O7WA 1HCLA 2WQNA 5FG8A 5F9EA 3TUCA 2GNFA 3PJ1A 3CEKA 3TNIA 4D0WA 4IAAA 4O2PA 1H1WA 3VF8A 2CIAA 3W0OA 2BKKA 4RFYA 4UX9A 3QX2A 1O9UA 4M8TA 5M51A 5IQBA 3RBWA 3DBQA 4H34A 2XNNA 2VGOA 5IUHA 4O1PA 4F78A 3PE1A 4WNOA 3W0RA 3FZRA 3VC4A 4DGLC 2PNAA 3NLBA 1FVTA 3KF7A 5IKWA 1SZMA 4L46A 4QP4A 2CKQA 4BDJA 1WAKA 3FMLA 3FMMA 4EUTA 5M53A 1DAYA 2VX1A 3MV5A 3OHTA 4YHJA 2C5YA 4EH2A 5L6PA 1O47A 1PXLA 4FSWA 2J5EA 3GU8A 4UB7A 4RIYA 3R9NA 4QO9A 2RKUA 3UPZA 2ITOA 3UO5A 2EUFB 5E91A 3GCPA 1GZKA 2O0UA 4IB0A 4FV1A 4TPTA 3QWJA 1YXSA 2WAJA 4FX3A 5EDRA 3TZMA 2UV2A 5M06A 4RQKA 2BCJA 3W33A 3HAMA 3POZA 3TDWA 3KREA 2RSYA 4QMXA 1QPJA 4QRCA 3QWXX 3IK3A 1NY3A 2QURA 4O0RA 4IWDA 1ZAOA 4CEGA 3PJ3A 4YJOA 4FV9A 4YO6A 3V8TA 3WZKA 2WMXA 4TYEA 3JVSA 4ZS0A 4A9UA 4BRXA 5JGBA 1Q62A 4K2RA 2I7QA 2CJMA 2C47A 2X2LA 1URWA 2ZB1A 3LW0A 3LYVA 5IBMA 3HYHA 3NYXA 3OY1A 5EHOA 4LOOA 4UXLA 3RJCA 5KMNA 5DRDA 4DDGA 2WIPA 4RIYB 3UE4A 5FXRA 5HTBA 4AXEA 3V8WA 1V0BA 5C4KA 4BHZA 3S2PA 2BRBA 4P2KA 2DLYA 2UZWE 5HVYA 2PE2A 4L7FA 5EI8A 4FZ7A 4YJSA 5K4IA 1R1WA 1CKIA 3DJ7A 3LXLA 4OR5A 4RJ8A 4IM2A 4W9WA 4OW8A 1PXPA 2AC5A 3FL4A 3KEXA 3RPOA 4D9TA 2XCKA 3WZDA 2QLUA 3TL0A 2RFDA 3SRVA 4MCVA 4FT7A 3B2WA 4K0YA 2R3RA 4U81A 4IZYA 5GJHA 2DYLA 2K79B 5HG5A 3JY0A 3EQIA 3GBZA 5FUTA 1RW8A 3QL8A 5IH6A 3PP0A 1RDQE 3PQZA 4B8LA 2Y9QA 2W1IA 2YM3A 3NHNA 3A7GA 4CFFA 2PVNA 4TT7A 3OEZA 3R9OA 5CAQA 3P79A 4FIEA 1U4DA 2BZIB 1OI9A 3PY3A 4DLJA 3BI6A 5A4EA 5HLWA 1JWHA 3VS6A 4BJJA 2GFSA 3D2KA 3W16A 3KCKA 4BDDA 2XF0A 4R7IA 4AZVA 4GK3A 1OKYA 4JRNA 5IQHA 4FJVA 2ZMDA 2B9FA 1BHHA 4OTGA 2XBAA 1BM2A 2Y1NA 3Q6WA 5B0XA 4F0GA 4XNEA 3UOJA 4F7NA 1O4PA 3FLWA 2Z7LA 3SRVB 2IZSA 4XG4A 4A9TA 4DGPA 3EH9A 3W32A 4P7EA 1J1BA 5K0KA 1WBTA 2YA9A 4RIWA 3WI6A 4BWPA 1KA6A 3DLZA 2RL5A 4X2FA 1Y6AA 3GB2A 5HICA 4A06A 2FYSA 4HW7A 4W4VA 4JDIA 2YHVA 2C0OA 4JDHA 3TNHA 4U45A 3M1SA 2DVJA 3PSDA 4BCFA 4PNIA 2Y0AA 3MFTA 4RPVA 1CKPA 2FSLX 2VO6A 1ATPE 2OO8X 4CSVA 4K18A 4XP0A 5AP7A 1A09A 2BTRA 1LEWA 4XG6A 5IQDA 5EDQA 5ACKA 3FHIA 2OU7A 3NIZA 3PVWA 4CRSA 3JXWA 3MB6A 2C3KA 4BJJB 1RJBA 4GUEA 4TWOA 4ZMEA 4CD0A 5AUYA 3KXHA 3QYWA 4O83A 2E9UA 4BN1A 4FL3A 1JSUA 2UZBA 2J9MA 1UWJA 2YZAA 4C0TA 1PHKA 2WOUA 5EHLA 5AV0A 5KX8A 4ANBA 1G5SA 4E4XA 4BIEA 4DHIB 1JKLA 3FKLA 3N9XA 3BE9A 1F2FA 2L3TA 3BGZA 4H05A 3ZRMA 2R5TA 2HWOA 4RIWB 4TNBA 5F1ZA 1ZFPE 3MI9A 3THBA 1E1XA 5HIEA 1B38A 1OPKA 3DZOA 4R6VA 4TYHA 5DA3A 3ZFMA 2QO9A 3H0ZA 4ENYA 4EZ3A 4AU8A 4F7SA 2BDWA 3NAXA 4IE9A 3L9PA 5BVKA 3AT2A 2JAVA 1G8KA 1BX6A 1OBGA 2F7ZE 3OTUA 4KIOA 5KE0A 4BIBA 3H10A 5KMJA 2PUPA 5CAPA 3LMHA 5AULA 3COKA 2IW9A 2PVYA 4PPAA 4Y85A 3ZO4A 4E5AX 3FV8A 1WBSA 1ZMUA 4GYGA 4CV8A 4I22A 2X9EA 2ZDUA 3F3VA 4LMUA 3ZRLA 1TZEE 3IW7A 4M69A 1G8SA 4G3EA 2IUIA 2ERKA 4ZIMA 4BBFA 2VTIA 3BUXB 1TQIA 2A4LA 3P78A 4UXQA 5AP2A 4C33A