2OZOA

Autoinhibited intact human zap-70
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
612
structure length
545
Chain Sequence
PDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPNMDTSVFESPFSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRNLAARNVLLVNRHYAKISDFGLSKALGPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGGSALEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase ZAP-70
publication title Structural Basis for the Inhibition of Tyrosine Kinase Activity of ZAP-70.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 150
structure length 545
sequence length 612
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ozoA05
1.10.930.10 Mainly Alpha Orthogonal Bundle Syk Kinase; Chain A, domain 2 Syk Kinase; Chain A, domain 2 2ozoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ozoA04
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2ozoA03
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2ozoA01
4EH2A 4GG5A 3R7IA 3QA8A 5I9WA 3U6JA 1KUTA 3UNKA 3F3UA 2PUNA 1QADA 3NZ0A 1CM8A 4QRCA 4GJ3A 4A9RA 4XV2A 3IMDA 3LFBA 3DK6A 3K3IA 3PY0A 2R64A 4LMUA 5HNIX 2VTTA 1IA8A 4EUTA 4QP3A 4FNYA 2OZOA 3FEGA 1T45A 3CQWA 4AA0A 3KRXA 1OIRA 2G15A 4MKCA 1FVTA 4QMSA 3GCSA 4F7LA 4FV2A 2R3KA 3QX4A 4MCVA 4OUCA 3ZFXA 3BYUA 3ZBXA 4FEXA 1W98A 2BFXA 1O4GA 4CD0A 3Q4ZA 5HTIA 4O7ZA 3BGPA 4QMWA 2RSYA 4OTRA 4OHHA 1PXJA 1Y8YA 4FTQA 5EDRA 4UBAA 3R1NA 3VRQA 5C9CA 2RVFA 4IM3A 3NUAA 2Z60A 3TKIA 3A4OX 3MFUA 4XJ0A 1LR4A 4YJVA 4EK3A 3BHVA 3Q9YA 1A48A 2ETMA 3Q2MA 4QTAA 3U4WA 4AN9A 5ICPA 3MXYA 5CF4A 2IW9A 2NNWB 5CI6A 1NVRA 2WELA 3U9CA 4F7SA 2YJSA 5IPJA 4GKIA 3VQHA 4RWKA 5BVKA 2F7XE 2BRGA 1BLXA 2C4GA 2JBOA 4XOZA 5HNGA 4L00A 4EYMA 2F2CB 3C5IA 4QYHA 5IA3A 3RK9A 1OB3A 4FG9A 3FPQA 4PTGA 2P2HA 4FK3A 5HO8A 4C7TA 5LMKA 1UURA 1CKIA 4ANLA 4A4CA 3EQCA 2PVNA 5D7AA 2WTDA 1GHUA 1VEBA 1YXVA 4TWNA 3BLHA 1J1BA 4IW0A 1ATPE 4I1ZA 5HCZA 1REKA 3EQFA 4DGOA 1B47A 3L9LA 3Q9XA 3AC5A 4O2ZA 3FYKX 3IGGA 2GS7A 2PMIA 4E8AA 4ENYA 4GIIA 4I6HA 3AT2A 3BEAA 1KOBA 3R63A 1ZWSA 4LRJA 3TUDA 3QAME 4FSUA 1G5SA 3AOXA 3GCQA 5CU3A 4DEIA 4E4MA 3LHJA 3IW5A 4H36A 3QD4A 1FMKA 4DGNA 5KMOA 5IKWA 2I0VA 3MVLA 4HNFA 2OJGA 2VWZA 3OP0A 3FY0A 2GU8A 5LVPA 3TV7A 2I0YA 3LMHA 3FMMA 3POZA 3VS1A 2CSNA 4KS7A 1NZLA 2WFYA 3N4TA 4RLKA 3BLRA 4RC4A 3ZFMA 4M0YA 5EOBA 2Z7RA 3QYWA 4JQEA 2OXXA 4I23A 3BCEA 2DVJA 1UNLA 3MTLA 4V0GA 4L45A 2CNQA 4FSTA 1W83A 1XHAA 4ALUA 2R4BA 3FJQE 3RHKA 4O91A 4F9CA 1E1VA 5C1QB 2GPHA 2OJJA 1FBNA 5KNJA 3JVRA 3PE2A 3R83A 3MYGA 4LRMA 1M17A 4BY9E 4I0RA 3R02A 1XO2B 4A9TA 3TZ7A 4A4LA 5FTGA 2Z7QA 1H0VA 1OPLA 3LM0A 4S30A 2G2IA 5EOLA 2YABA 4MXYA 3WE4A 4A9UA 2OK1A 3FLNC 4AZVA 4G6NA 1SMHA 4APCA 3BUNB 2OW3A 3DAEA 3PXYA 2R3OA 3ZEWA 5B2KA 1LP4A 5JEBA 2IG7A 3IONA 4GUEA 1A1EA 2PUPA 2ZV7A 1NVQA 2WB8A 3V5LA 2E9UA 3BYOA 3C4EA 4RX5A 2LCTA 2YACA 4K11A 4EOOA 4XCUA 3FHIA 3JPVA 4O22A 2QURA 4PL3A 3PRIA 4O1OA 1YQJA 4EWQA 2J5EA 3SW7A 3SVVA 5IQEA 5GHVA 4J95A 3ITZA 4NWFA 4QPAA 4TNBA 3VBQA 2OICA 4A07A 4KIOA 4I0TA 1PKGA 2UVYA 2W0JA 3VBWA 4JOAA 1LKKA 1I3ZA 5AP4A 3BYVA 4U40A 5HE2A 5I4NA 4FTJA 4D58A 3LCSA 2BKZA 3VNTA 2W1HA 4GV1A 1O48A 3SRVA 3R71A 1OI9A 2W1EA 2C47A 3PLFB 1Q61A 2V22A 1Y8GA 4IM2A 3BX5A 5CDWA 3M11A 3Q4UA 1YWRA 1FQ1B 3MWUA 5M08A 2EXEA 3BYSA 4IVAA 3DLZA 4NSTA 2QNJA 3QQUA 4QNYA 5ETIA 1J7IA 4K9YA 3CXLA 2HZ0A 2EXCX 3COIA 1OKWA 3KXHA 3LXPA 2YIYA 3FI4A 1URWA 5IEYA 1F5QA 2J6MA 4RVKA 4C02A 2W4KA 5B7VA 3KF7A 3TV6A 3I0QA 2UZBA 5F1ZA 4H34A 5IA2A 3IOPA 3AC8A 4YLLA 4Y83A 3PQZA 4LQMA 3OS3A 1YXXA 2XNOA 4HOKA 3CY3A 1XR1A 4MAOA 4BWPA 4YBJA 1O4AA 4PMSA 1Q24A 5ITAA 3UDBA 2VWIA 4E6CA 4XP3A 4YU2A 3NVKI 1IS0A 3QTSA 2JAVA 1WVYA 3HUCA 1YKRA 4GU6A 3ZUUA 4F9AA 3N84A 3O51A 1O4MA 3FMLA 2JKMA 4FTTA 4QTEA 4OBPA 3TKZA 5E9EA 1JSTA 3QTRA 2GS6A 1FVVA 1O4LA 2VX0A 4JRVA 3RAHA 5M06A 3FXZA 5GIPE 3E62A 2IO6A 3EN9A 1KE6A 2KTYA 4WNPA 1GOLA 3ORPA 4EK5A 1KSWA 2G1TA 3W2CA 4EKLA 4EHZA 5JFXA 4J7BA 4QQ5A 4BI1A 3WZDA 2OLCA 4D1ZA 2GSBA 4BI0A 3GC9A 2FH9A 5C8NA 2OG8A 2VO6A 3ORLA 2Y3AB 2YDJA 1Q99A 4U1PA 4ASDA 3GGFA 2CGXA 2G9XA 3L8VA 5CEMA 3BBTB 2UW7A 3NNUA 4II5A 3UE4A 3RNIA 4AA5A 1FYRA 4TXCA 3NW6A 4QQCA 3RM6A 2BRNA 4PP9A 4ZK5A 4L52A 4GVJA 4B0GA 1W8CA 2GNIA 3P7AA 4HNIA 3RVGA 4LOPA 1TQPA 3S2PA 3MA6A 3FE3A 3R7UA 5A9UA 3M1SA 1FOTA 5EQPA 1SHAA 3IMJA 5IZFA 1OO4A 2XNNA 3I1AA 4G6OA 4XYFA 1JAMA 2WTVA 1UWHA 2HUWA 4AZEA 2JIVA 2VIFA 3PPKA 5ETFA 3ACKA 2JYQA 3CS9A 3HP5A 3N51A 4EK4A 4C4EA 5AAFA 5EG3A 4F1TA 1MUOA 3A60A 1O6KA 2VX3A 3EFJA 2UW5A 4NTSA 4MD7E 1EH4A 4WBOA 3WYYA 1JOWB 2R2PA 3S95A 3R04A 5D0JA 4OHEA 3ORIA 4U3YA 3GC8A 4ZTMA 3LMIA 4FYNA 5CT0A 3R7YA 1JYUA 5K4JA 1A08A 5DMZA 5KMMA 2XM8A 2EL8A 2YM8A 5TT7A 3AD6A 5I6VA 1ZZLA 1Q62A 3EN4A 4BTFA 3LXKA 3HRBA 1UKHA 4HPUE 3T3UA 1IEPA 4B6LA 2FCIA 3MXCA 3KVWA 4QPMA 1TQIA 2GHGA 4RPVA 5CSWA 2PE2A 4XUFA 3TNIA 2CLXA 2PVHA 3PXZA 5FTQA 2HDVA 4DEBA 4UMPA 3ORNA 4BKZA 3RAIA 3FQEA 1PXIA 5HIBA 4PX6A 3S0OA 1SVEA 2C6TA 2RGPA 5DVRA 5HVYA 1NY3A 3R9DA 1CSZA 1SNXA 1OIQA 2PZ5A 3F6XA 3WF9A 4ZLYA 1SPRA 3ANQA 4F64A 3ULIA 4CNHA 3E3PA 2JEDA 3F61A 1XKKA 3K5VA 4I41A 3QD3A 5IA0A 1BMBA 1AYCA 5JKGA 1CWDL 1FBVA 5FEQA 3NVMB 5E1SA 4FKGA 4AGWA 4QMLA 4QYFA 4NW5A 4YZCA 3NNWA 4X2FA 2AOBA 5GZ9A 3MGYA 2JGZA 5A4EA 3FMHA 1JBPE 2X9FA 2XYUA 4XG7A 4DEEA 4I20A 2OZAA 3RWPA 2ITQA 4EORA 1OL6A 2R3GA 4NM0A 1VJYA 4EBVA 4PNKA 2G01A 3Q9ZA 4FT9A 4FZ6A 3A61A 2A1AB 3E93A 5D1JA 3BQCA 4IAIA 5EQEA 4LYNA 2YIRA 4UV0A 4X3FA 4QT1A 4C4HA 2OFVA 3MY5A 3OUNB 1V0OA 4AG8A 1OBDA 2EB3A 3FQSA 2PZIA 3EN5A 5BVEA 2FSLX 2CN8A 4HGEA 4YC8A 4XG9A 5HESA 1GRIA 3VUHA 3QLFA 3EACA 3O7LB 4J53A 5JH6A 4OBQA 2WMBA 5IQIA 3OXZA 2C1BA 3CGFA 4F9YA 4O82A 2YM4A 3WILA 3IDCA 3N8MA 1CDKA 1A09A 5IQBA 1NA7A 2WMUA 4DFUA 3S8NA 3E8CA 3AMYA 2ERZE 4W9XA 5D11A 4QOXA 4AU8A 5AUYA 4NL0A 5F20A 4RA5A 1UU8A 2QKWB 4IB1A 4FTRA 2C6MA 2VTHA 3ZUVA 2R0IA 4AXAA 2YM7A 2ZV2A 1BX6A 2C69A 3D2IA 3KY2A 2E2BA 4TW9A 4RC3A 4XV9A 3ZFYA 2O3PA 3G33A 2C0OA 2UZEA 4DLJA 2YWPA 2A19B 3K54A 4FF8A 4W8EA 2B9FA 5C8MA 5K9IA 1LCKA 3A7JA 3C5UA 2X4FA 1P4FA 3SG9A 3F69A 5LJJA 3NLBA 4C3RA 2GNLA 3I0OA 3VGOA 3GEQA 3UPZA 1SKJA 4LOQA 4EOJA 2Y1MA 4FEQA 4YTIA 4AUAA 4ANBA 2AUHA 1OITA 1O4JA 4I24A 4DCEA 5JFSA 4NIFB 3MH2A 4C58A 1VR2A 2O0UA 1U54B 4G34A 3F5PA 3UOKA 3ZZWA 3R73A 1YWNA 2XA4A 4O0WA 3QD2B 5LMAA 4FA2A 5TR6A 3CKXA 3RTPA 3QWJA 4FZFB 4RSSA 2VTJA 2R3RA 2RSVA 3UP7A 4HW7A 2E9VA 1YDSE 2J4ZA 3VO3A 3SOCA 3VUIA 3VRNA 3HMMA 2PZPA 2BTRA 4XEYA 4IAFA 3GENA 3U9NA 3ZO1A 3FI3A 4DEHA 4DINA 3ZCLA 1TVOA 4FTMA 4AOJA 2Y4IB 4JEGA 4Q2AA 4IC7A 3L1SA 5HO7A 1Q8YA 2WMVA 5IQCA 1JYQA 1QPDA 5CTPA 1FU5A 4JAJA 4ZXTA 3UOHA 4UXLA 4DGLC 1OL5A 3L8XA 3NS9A 4KD1A 3QZIA 3SXSA 3FXXA 4PMPA 3I5ZA 3KN5A 4DGXA 3HECA 2WGJA 3NSZA 4MWIA 4W8DA 2YM6A 3UMWA 3QTZA 5HKMA 3CR0A 4C59A 1JWOA 2DQ7X 4XG4A 1YVLA 2VAGA 5BQ0A 5HVJA 2PNBA 4O7LA 3V6RA 3U8WA 3CQEA 2B4SB 3OW3A 5DBXA 4IC8A 3ZC5A 2HY81 5TF9A 2E9NA 4RT7A 1MILA 1PMEA 4NT4A 3PPZA 3QRIA 2HWOA 2UZNA 2EUFB 2OF2A 3MB7A 2BZKB 4XG2A 4W9WA 3DA6A 5LCKA 4O0SA 2XCHA 2YA9A 3FZPA 2UW3A 3R21A 4FKQA 5E8VA 4FV6A 3W18A 5JGAA 1XH7A 4ZOGA 3MESA 4E26A 4FTUA 3MVJA 4D0XA 4NJDA 3NMUF 4B9DA 3DXPA 4BTMA 3ENHA 3DCVA 4C8BA 3BBWA 3AC3A 5E91A 4J1RA 4KSPA 1YRPA 5BMMA 4PMTA 2WTKC 3DDPA 3EYHA 2FVDA 1PICA 4YHTA 4UMQA 4KA3A 1WMKA 4FKIA 4E6QA 5C4LA 1CJ1A 2UW4A 3D9VA 1QPCA 2C5VA 3R1YA 5EI8A 4FE2A 4M3QA 4U6RA 5GJFA 3CE3A 4IAZA 3REPA 4CTCA 2RORA 4GFOA 1BFIA 2CRHA 4NM5A 1O4DA 1DI8A 3G2FA 3O23A 4NEUA 1GZ8A 1W82A 4G31A 2ONLA 5A54A 4G1WA 4EJ7A 4YJNA 4O0RA 3CTHA 2OXYA 3ORMA 3QWXX 3W2RA 3ODYX 4BTKA 3NIZA 2X2KA 3FXWA 4CKRA 3PE1A 4RIOA 1JKSA 4DH1A 3HAMA 4LI5A 3ROYA 3GU6A 3ZSHA 3GUBA 4FKOA 1V0BA 2HWPA 4M67A 3Q5IA 3RWQA 3TACA 4IAYA 4IB5A 3ZEPA 4IWQA 2IVVA 4LL0A 3LCTA 3PZHA 5AM6A 3MFRA 1YOJA 3PSBA 1AD5A 2WD1A 4YMJA 3VROA 4EC9A 3LCKA 3QCXA 1MRUA 3VW6A 1BYGA 3RAKA 5KHXA 4IACA 4ZSJA 2E9OA 3DKFA 5CASA 3BUXB 4TYJA 3RM7A 4QMMA 1U59A 3LMGA 4JX3A 1BL6A 4EHGA 3S1HA 1CSYA 3TJCA 3ZRKA 4QO9A 5A4TA 1TQMA 1GZKA 3F9NA 4XBUA 3UYTA 5I0BA 1HCKA 3R7VA 3CBLA 5AMNA 5AV4A 5CXHA 2CGVA 4DFYA 5FG8A 4FKPA 5FP5A 4G3DA 4JJRA 4AW2A 4G17A 4FTAA 5HNBA 4CLIA 3NAXA 4KABA 4U9AA 5M4IA 3DXQA 3PDTA 2C6DA 3BIZA 4JL9A 3Q32A 4UMTA 3I79A 4R77A 5T68A 4QTBA 3ULZA 4B7TA 4CMTA 3NX8A 4BDIA 4D55A 3IPHA 5FD2A 1JKLA 2XMYA 3I6UA 3KRJA 3UIMA 4BHZA 4EONA 3D7TA 2PUUA 3VW8A 1M14A 4N4SA 4O7WA 4ZY5A 3QRKA 4ZSLA 3ROCA 3OG7A 4FX3A 5HU9A 5I3RA 4HJOA 2R3FA 4XHKB 3Q6WA 5HG9A 4KBAA 4UZDA 5J9ZA 2UV2A 4M68A 4FV7A 3TDWA 1KOAA 4HGLA 4IZAA 4U45A 4E73A 5K0KA 2MQIA 2PSQA 4NM3A 3FYJX 3MJ2A 4ZSAA 4YHFA 1O4KA 1WVXA 4J8NA 4JQ7A 1XBAA 3LJ2A 4LUEA 4Z7HA 5L8LA 5JQ8A 5HBEA 2V0DA 4G9RA 1R39A 2J90A 4WT6A 4E4NA 3OBGA 2CLQA 2HZ4A 3O71A 4L53A 4ZTNA 3T9TA 5BPYA 5HTBA 3ZXZA 3O96A 1I44A 3IECA 4EC8A 1SHDA 1FINA 3US4A 1JQHA 4XLIA 3C50A 4LMNA 5CXZA 3KC3A 5FDXA 3UODA 2RG5A 4I92A 4LGGA 4XG3A 3ZOSA 2C30A 1GNGA 3EKNA 2QONA 2H6DA 4AZWA 1O4RA 4IANA 3WF5A 3MN3A 3W2SA 3UNJA 5G1XA 3VS7A 3EN6A 5CAUA 3S00A 3WOWA 2JD5A 4IXPA 2I1MA 4QP9A 3N4VA 1FU6A 3PXRA 4KKHA 2RMXA 4BCPA 4R7HA 4RZVA 3SGCA 3MB6A 1XBCA 4EZ3A 3U51A 1BL7A 2UZLA 4KBCA 4BDFA 4LRKA 4CG8A 4PL4A 5HO6A 1UU7A 2B9JA 4K0YA 5HIDA 4JXFA 3FHRA 2PZYA 2YZLA 2AYPA 4FIJA 3PG1A 3UIBA 4AW1A 3COHA 1ZMVA 5ETAA 4R5SA 5JQ5A 4C61A 4MH7A 2HY0A 1PF8A 2OF4A 3EKKA 3VVHA 2VGPA 4E4LA 5AUWA 3V8TA 3BE9A 4DE4A 5EW9A 5AAGA 4FVQA 3NUNA 1R0EA 4RVTA 4W4YA 5AR3A 4DHFA 4YR8A 4FKRA 1O41A 4NCTC 2QOOA 2J50A 1GIIA 3QKLA 2BAKA 4BZNA 2YN8A 4L7FA 1L8TA 3JR1A 4QP1A 1HCLA 4M97A 4YJUA 1O44A 3PFQA 3F7WA 1YDRE 3E64A 5B2LA 5EW3A 5KKRC 3VAPA 4L8MA 5FDPA 5EM7A 2X8EA 4UWBA 4EH6A 3A7GA 2ABLA 4U8ZA 4MBLA 4PNIA 1OL1A 3OC1A 5FXQA 5IBMA 2Q0BA 2YCSA 3I4BA 3A8WA 4ZJIA 2WZJA 3WIKA 1B38A 1BHHB 3QCYA 3QQGA 1MRYA 2XIYA 3IG7A 5HCXA 4RJ7A 3BHHA 4GFMA 3HCKA 2W1IA 2B7AA 4F1OA 5AR2A 4FKLA 3P0MA 3DB8A 3CC6A 3MSSA 4FZ7A 4MXOA 4AN3A 3PP0A 4P2KA 4RWIA 2ECDA 3C1XA 4CQGA 3RPSA 3BUWB 4KB8A 2VWVA 2V5QA 4V0GB 4D1SA 4M15A 4MF1A 2GQGA 2PWLA 2WO6A 5F9EA 4BC6A 5AUUA 2PL0A 5EYCA 4XOYA 3LXNA 3Q04A 1OPKA 1ZAOA 1HOWA 2XM9A 4PTCA 3D4QA 4RX8A 3SOAA 4IX4A 3DNDA 4B4LA 2HELA 2HXQA 4D4YA 1UU3A 4M0ZA 2XK3A 4O83A 1OL2A 4XP0A 3UO4A 3V51A 3HZTA 3V5TA 3PFVA 2VRXA 5J7BA 2IJMA 5HGIA 4L68A 5CAPA 4OTWA 4FUXA 2CPKE 2CCIA 2OIQA 2GQSA 3UPXA 2F7ZE 5AP1A 2GNFA 3K5UA 3PIYA 4GSBA 3TTJA 4AZTA 3HV4A 4GT4A 2YIQA 4YPSA 4USEA 3H30A 4RMZA 4RJ8A 3GQLA 5GJDA 1H1PA 3OCSA 3IDPA 3FL4A 1P13A 3A7HA 2FGIA 4DEAA 2IZSA 4EI4A 3MIAA 2OKRA 3GU5A 3QQLA 3D94A 4UB7A 2ZOQA 2BILB 4YZMA 4BWXA 5DC4A 4E6AA 3D5UA 3ALNA 2X1NA 3DOGA 4BGHA 3R8ZA 4ZEGA 4Y8DA 2EU9A 5DT4A 1H1QA 4EOKA 4OAVB 1H26A 4IH8A 2PMNX 4FKTA 4IIRA 3RZFA 3ZMMA 2B3OA 4X6QC 5D7VA 5EKOA 4IDTA 3FLYA 2DUVA 3F5XA 5L4QA 4CZYB 3AXWA 4PTEA 4WRGA 4CFVA 4ALVA 5E7RA 4FSQA 1NT2A 3SRVB 3V04A 5B2MA 3CPCA 5E8TA 4HGSA 4HZSA 4RJ6A 4Y5QA 5TKDA 5IU2A 4TWOA 2QG7A 5DGZA 3RJCA 3C4XA 1Z3KA 5BO4A 4FGBA 5FLFA 4YZNA 3ZHPC 4F7JA 3SG8A 2XJ2A 3RPYA 5HI2A 4QMUA 2XNBA 3TJDA 2Y4PA 4I22A 2W05A 3II5A 3OT8A 4J8MA 5K0XA 4M4ZA 3IDBA 5CS6A 2XEZA 5IA4A 1G3NA 1PXLA 1YHSA 2BFYA 2Z7SA 4FTOA 4FVPA 4ZSGA 5H9BA 5EI6A 5JFWA 3TL8A 5HKWA 3OTVA 4ZY4A 2HIWA 1RE8A 2Y6MA 4L01A 5C01A 3TN8A 3FAAA 3SX9A 2HW6A 5DYJA 5ETCA 4AOIA 3PSKA 3AD5A 1U5QA 4C33A 4K8AA 2XKCA 3QGWA 2PVKA 5KHWA 3AMAA 2RF9A 3FBVA 3KB7A 4RGJA 2XBJA 4YO4A 3R1QA 4O7NA 3DFAA 3GU8A 2YCRA 4MBJA 3Q9WA 4TTHB 2P2IA 3SV0A 2WMAA 4HYSA 4J52A 3A8XA 3GC0A 4BCFA 1UV5A 5KZ0A 3MH0A 3DAKA 2ZM1A 5CU4A 3QQKA 4BGGA 1BHHA 1MQ4A 4QP8A 4IX3A 5DR6A 4FKUA 4QSYA 2P3GX 5AR5A 4L67A 1YOMA 4JBPA 2XP2A 4CKJA 4IAKA 1T46A 2CDZA 3VS3A 1F1WA 3HRFA 4BVUA 3ZZEA 4FTNA 4ZLOA 4Y85A 4MTAA 1I09A 3EFWA 3QXOA 3S8LA 3K2LA 2VGOA 2G2FA 4D4RA 4FT5A 1KV1A 5DR9A 3VRZA 4IVCA 1ZYJA 2YERA 3FMEA 4ACCA 3MVMA 5L2SA 3TCPA 4HVDA 5DEYA 2R9SA 3OMVA 4GMYA 4BZDA 4Y72A 3AC1A 3FZOA 3U6HA 1PJKA 1CKJA 2GHLA 5DA3A 3QWYA 3LFFA 3NWWA 5HVKA 3Q53A 2WU6A 2V7OA 2XEYA 2ZB0A 2VTAA 3DQWA 2RFDA 3OZ6A 4RG0A 4GUBA 2OO8X 5F94A 5EG3B 2BAQA 2OIBA 4I94A 3PXKA 4WRSA 1H25A 3LQ8A 4NWMA 5L2WA 4FV4A 4BDHA 4IM0A 5I5ZA 3C4FA 5LVNA 4FKVA 1UKIA 5I9XA 2VWYA 2XK8A 4N6ZA 4YJOA 3TNWA 4TWCA 3DLSA 4DGPA 1SVGA 2DWBA 4L42A 3UVQA 4AWIA 5BVNA 3QTWA 3LZBA 4PPBA 3EWHA 4P9ZA 3B2TA 2HK5A 5HQ0A 5BVFA 3CJGA 3DPKA 5KMNA 3RAWA 5HBHA 2XNPA 3ZRLA 3FSFA 2K79B 2QD9A 2PY3A 3DK7A 4CXAA 4FG7A 2HYYA 3I7CA 4DFXE 4R1VA 3BKBA 3PXFA 3DB6A 5E90A 4CKIA 2HZIA 3BHTA 1URCA 2RFEA 5CY3A 5BNJA 3FLWA 2YDIA 5HX8A 4FBXA 5LOHA 5T6KA 4ZS0A 1G8AA 4GYGA 4YBKA 3QUPA 4LM5A 4O0XA 4O81A 1WAKA 1OKVA 1XQZA 3VS4A 3Q5ZA 3D7ZA 5AP7A 5C03A 4UMRA 2IWIA 3JY9A 1NW1A 3S3IA 3BUMB 2CKPA 3F3ZA 4N6YA 4ITHA 4I21A 5HZNA 3MS9A 2WQNA 3LFCA 3W2PA 4BDBA 5HU3A 1AYDA 3KXGA 2BZJA 4JRNA 3E8NA 1YXUA 2EYYA 1YHVA 1BUHA 3LJ1A 1Q3WA 4YTFA 1AOUF 2I0HA 4OT5A 3R7OA 2C5YA 4I4FA 2O63A 4KNBA 4AW0A 3HMPA 4FZAB 4NH1A 4NM7A 4CMUA 2OZAB 3HDMA 4O27B 1O4NA 4IJ9A 1KA6A 2JBPA 2Z7LA 4MXAA 3KXZA 4RA4A 2WMRA 4GRBA 3WZEA 2UW6A 5CAQA 3P23A 4OR5A 3IO7A 4DA5A 2R3HA 4X3FB 1KE8A 4MX9A 1X8BA 4C57A 4TPTA 1ZOHA 4F65A 3EMGA 5HLPA 3I60A 2OJFE 3MDYA 3MY1A 5EW8A 3IK3A 2YAAA 2ZV9A 4K6ZA 4OW8A 2GE9A 2WIPA 4HVSA 4FSZA 4P5ZA 5J95A 3LLTA 4RX9A 2X6DA 1O4HA 1JSUA 4BYIA 1M61A 5AULA 2O64A 1LUNA 5H8GA 2W5AA 2Z02A 3Q60A 2XKFA 4WO5A 2VNYA 4LOOA 1A9UA 1Z9XA 2ITPA 5AP6A 2LNXA 1S9JA 4RQKA 2IVSA 3Q6UA 1OECA 3MH3A 4B99A 1O4QA 2CN5A 5M4FA 1STCE 1R1QA 4IMYA 3VQUA 4CYIA 3CPBA 4K44A 3ZBFA 3QUEA 1IA9A 3MY0A 3OWLA 4GH2A 4CZUA 4NKAA 3DBCA 4D2RA 4BICA 3W55A 2EXMA 4ANOA 4O7RA 2RKUA 4FSMA 4PV0A 4RQVA 4PWNA 4Z9LA 5AP0A 4ASZA 4ZZNA 1M2QA 4KUJA 4O7TA 2X9EA 5M09A 3HKOA 5HE0A 3PS5A 5DNRA 4RJ4A 3UIUA 1VYWA 4KKGA 3PG3A 3POOA 4DG0E 5IUGA 1PMVA 5L8KA 3BU6A 3ZDIA 1O42A 3FDNA 3Q52A 2W4OA 1HCSB 1CKPA 3HA6A 5CZIA 2REIA 3NR9A 3ODZX 5LVMA 1Q4LA 2PVMA 2QKRA 3NIEA 1J91A 4WNKA 4KRDA 5BVWA 4A06A 4UXQA 4HCVA 4PDPA 4DBNA 4E3CA 4DBXA 4F5BA 4I6QA 3UMXA 3DAJA 2UZVA 3C0HA 2RL5A 4KS8A 4CCUA 4S32A 2QO7A 3I7BA 3OBJA 4MF0A 3QQJA 5CENA 1QPEA 2XRUA 4NFNA 4G3GA 3IN8A 2JLDA 2O5KA 3M7FA 3RMFA 2XIRA 1JVPP 3LVPA 3OTUA 3R00A 1W7HA 3VS2A 2XH5A 4P9VA 2QR8A 1O6LA 2J0MB 3LXLA 3R22A 3GCVA 5E8XA 4E5AX 2W17A 4KSQA 2QQ7A 4ITIA 5LWMA 4RLLA 2JDRA 4RWLA 3ZM9A 1PY5A 4ORKA 1UUSA 4L46A 4LGHA 3R8PA 4IFGA 2K7AB 4GK3A 4KBKA 5KO1A 3O0GA 4BCNA 4M12A 4BCOA 4DH7A 2XKEA 3DJ5A 4I0SA 4GK2A 4XMOA 2C5NA 2RIOA 5BUJA 5JGDA 5D12A 4TWPA 3ET7A 1OM1A 2ZVAA 5HICA 3P7BA 2UW8A 2LGCA 2WQBA 5CU0A 3HRCA 3QALE 4O7YA 3OVEA 1ND4A 5IQAA 4X0MA 4CQEA 3VRRA 2PLEA 4PL5A 1KA7A 2WQMA 3H3CA 3NNXA 4HZRA 4WG5A 4HYHA 5DF6A 5M57A 5HTCA 2ITTA 1PHKA 3VS5A 2Y1NA 5HKYA 3EH9A 1OUKA 4NU1A 5AUZA 3EAZA 2WXVA 3HGKA 4AT5A 1WBNA 5L2IA 4MQ2A 2OFUA 4ZY6A 4BIDA 2J0IA 3KKVA 2CCHA 4EJNA 4LV8A 1WBWA 4ZAUA 3RZBA 3QTQA 3L9MA 5LXMA 4W4WA 4D0WA 3HV6A 1O6YA 1M27A 4Q9ZA 3BE2A 3HLLA 3D83A 3I6WA 4D1XA 5BX0A 3EQBA 5J9YA 4CVAA 3DQXA 3G51A 2X81A 3AQVA 1SHBA 3Q96A 4JE4A 2YFXA 3GOKA 3KK9A 5CEQA 2R3QA 1MQBA 4JDKA 2Y8OA 4YJPA 4GVAA 2IZRA 2Y9QA 4RJ5A 3ZTXA 4JNWA 3UBDA 2FB8A 3LQ3A 1ZRZA 4QMPA 3FLQA 2DCRA 2C3LA 3KXMA 5D9HA 3R8VA 3EJ1A 3UZPA 2MRKA 2EOBA 2PHKA 1UNGA 3R8LA 2GS2A 2VU3A 3ELJA 1DI9A 3QZGA 3GU7A 3Q2JA 4FR4A 4EK8A 2BRBA 3FUPA 1Q8UA 5AV0A 2QOKA 5FQDC 3O2MA 5KX8A 1LUIA 5AXIA 1BKMA 4O0TA 3IGOA 4BL1A 4DFNA 2I0EA 4UWYA 4N70A 3MV5A 4BHNA 1JLUE 3FPMA 5GZAA 5J3XA 5LVLA 3WA4A 4U5JA 4W4VA 3RPVA 3TG1A 2CS0A 2GFCA 3O7LD 4ACMA 4D8KA 4C4GA 4O0UA 4FIFA 1YXSA 2YCQA 3LFAA 4C2WA 4RIXA 2RG6A 5LVOA 2XIXA 1KV2A 2QR7A 1R1WA 3AMBA 3FZSA 4TYGA 2C6KA 4XS2A 1K9AA 2HCKA 2VWXA 4DTBA 3VBYA 3ORXA 4KKEA 4Y73A 1Y57A 4PDOA 5IF1A 4HGTA 5ANIA 2UW0A 4F0FA 3C4WA 4EEVA 3GC7A 4EYJA 3KXXA 4U44A 3LKMA 3H4JA 1DM2A 2J0JA 2B1PA 4DG2E 1JPAA 3UZRA 4YURA 2X2LA 4AE9A 4Q9SA 5CSVA 2XK6A 4YJTA 1QMZA 3CJFA 3KRLA 3MPTA 1BI8A 3VRYA 3FWQA 2ZYBA 3KMWA 1O43A 3TKHA 4BWKA 2QOBA 2ZMDA 3F66A 4F63A 4RVLA 1JYRA 4I6FA 5C8KA 4OHLA 1O4EA 1ZARA 3BELA 1YXTA 4UALA 4ANMA 3BYMA 2WMTA 3FQHA 3VBXA 3JXWA 5CU6A 3HHMB 2WMXA 1FPUA 1X0NA 4G16A 5ANJA 4XNEA 5DN3A 4XZ0A 4PPCA 3EIDA 5AM7A 3PVGA 3UQFA 3D7TB 3KVXA 4EOMA 5A14A 2PE0A 4PQNA 5AEPA 3W32A 2BZIB 4GT3A 4OTQA 1PXPA 3H9OA 3HX4A 3HNGA 3PYYA 5CEKA 4X6SA 5IBSA 5HLNA 1GIJA 4GW8A 5ANDA 5TO8A 5AIRA 4FNZA 2OXDA 4BN1A 1GZNA 2C6IA 2IPXA 4RVMA 5CANA 4HYIA 2CKOA 2WKMA 4IWPA 5FP6A 2W9FB 3UOLA 4YZ9A 5I9VA 3GXXA 4RIYB 4EZ7A 4L9IA 1WQUA 2XNEA 1A06A 4RX7A 2CJMA 2RFNA 4S31A 3C7IA 3EQRA 2Z2WA 3HA8A 3D15A 3NCGA 3C4CA 3HDNA 4ID7A 4O96A 4AS0A 3ORTA 4GK4A 1K2PA 3C4ZA 3IW7A 3TIYA 4GL9A 4C0TA 2I7QA 3PWYA 3GNIB 4OTDA 4AFEA 5IQFA 4GL9E 4L6QA 1R78A 3CXWA 4HCTA 3HP2A 4MD9E 3B8RA 4C34A 1Q8ZA 2QOQA 2W5HA 3KK8A 2V7AA 2WTKB 1FGIA 1YI4A 2WMWA 2BRMA 3E8EA 3PJCA 5EHOA 2LQWA 2QU5A 3BI6A 4ARKA 4XV1A 5EM5A 4ACDA 4RBLA 2OH0E 3C0IA 5HHWA 2C9WA 5EH0A 3T9IA 2C5OA 3UC3A 4O86A 4ANQA 5HD7A 5EYMA 1RQQC 3GFEA 5FEEA 2R3IA 3ZRMA 2OU7A 4I6BA 3BRBA 3F2RA 5JGBA 4CYJA 4CSVA 5HCYA 3C13A 2LQNA 3OXIA 5AUXA 4TKSA 5EYKA 4XX9A 3EYGA 1AQ1A 2I40A 2J0KA 4QYEA 2G2HA 4YNEA 4USFA 2B9HA 3EZVA 5IUHA 1QCFA 3MI9A 4FKWA 1ZOGA 3DBEA 2PMOX 1JKTA 3HYHA 3PPJA 4QMTA 4AP7A 3PSCA 4GCJA 5CSXA 1H0WA 4OTIA 5DH3A 5BUEA 2UVXA 4GIHA 2AOAA 4FUYA 1SM2A 3R7GA 1NVSA 2IW8A 4XG6A 4YHJA 2FUMA 3FZRA 5DFPA 5J87A 2PMLX 2CHLA 4S2ZA 1X6CA 4I5PA 4M7IA 3GI3A 2BR1A 3PY3A 4F4PA 4XH6A 2CIAA 2JFLA 1BF5A 2DYLA 2FSOX 3H9FA 3RK7A 4IZ5A 1WBPA 4CFFA 2R7IA 1MW4A 2CNVA 2VUWA 3G15A 4DFBA 1U4DA 1BLJA 2QO9A 2NP8A 2R3LA 3ZLXA 1KE7A 1Q8TA 3QD0A 2DLYA 2IN6A 4OTPA 4A4OA 4DYMA 2B0QA 2R0UA 4AFJA 3G5DA 5E1EA 3MPMA 4QMQA 1JKKA 5DR2A 3HIZB 2QC6A 3F5GA 4IAAA 1H1RA 2IUHA 1BKXA 4U80A 2C5XA 2OIDA 5E8SA 4IDVA 4EOIA 5KMLA 3G0FA 4B8MA 3NUYA 4U97A 3FV8A 2DS1A 2YISA 1XJDA 1R1SA 2PU8A 3GXWA 4H1MA 3KU2A 4WOVA 3D5WA 5L2TA 4E20A 1GIHA 4Y5HA 5J1VA 4X2NA 5KUPA 4YSJA 2WQEA 2BTSA 4TL0A 3LPBA 3DY7A 3OCGA 3ZSGA 3FZTA 1DS5A 4X2KA 3U87A 4L1BB 2HDXA 5AIKA 1YDTE 3TZ9A 3WYXA 3IQ7A 5J8IA 5A6NA 4K45A 2SRCA 3C7QA 3VUKA 2QHMA 3LLAA 1QG1E 3MAZA 4JBQA 4ZZMA 5ACBC 4D2TA 3LW0A 3BWFA 5IQHA 3R8MA 3TEIA 2BCJA 2HENA 3OROA 5M44A 4RIYA 4O7SA 3GCUA 4BCJA 1V1KA 3A7IA 3PZEA 3KRRA 5ANKA 2LAVA 4AZFA 2GNJA 2X0GA 4QMZA 5T3QA 1IJRA 3E5AA 2VD5A 3LFEA 4BDJA 2PUIA 4AA4A 4FSRA 3R28A 1ZMWA 4FOCA 3V8SA 4EH7A 1OL7A 5HG5A 3KCFA 3R30A 3QF9A 5BYZA 3MBLA 4QNAA 4IB3A 1H4LA 3QC4A 3O50A 2YZAA 5AX9A 4YJQA 4J96A 1GZOA 3AT4A 4AN2A 3P5KA 4EH4A 2L3TA 4ZTRA 1RQQA 4O0YA 3WARA 4P5QA 3KMUA 3LFDA 1ZYDA 4QMNA 5AR7A 5A4LA 2HZNA 3BGQA 3IW8A 3VS0A 2B54A 3E3BX 3R9RA 4KIKB 4X7QA 2BDJA 4BDKA 5BMSA 4FTLA 4WNMA 4JBVA 1MRVA 1PMNA 2H34A 4YTHA 3A4PA 5D41A 2QHNA 3FKLA 3DU8A 4ZSEA 2PVFA 4TY1A 3W33A 3EQDA 2QVSE 3UVRA 1Y6BA 3LM5A 2KK6A 1FVRA 2CI8A 4H1OA 4R3CA 4DT9A 4G3FA 4CLJA 2BBUA 3CTJA 4BDAA 4J71A 5CI7A 2R5TA 3SHEA 4JBOA 3R9HA 1YVHA 4AX8A 4MWHA 5HE3A 4AE6A 4DITA 2Y0AA 4RC2A 5IISA 5JZNA 4FZDB 1PXOA 3QL8A 3U4UA 1O4CA 3DFCB 4U7ZA 2ZAZA 1Z5MA 1PW2A 2QOFA 4BKJA 5FXSA 4GPLB 1WBOA 3ZDUA 4M8TA 3QCQA 5KKRB 4F0GA 4FKSA 3E88A 4M69B 3NYNA 3ORKA 4I4EA 3MIYA 4UEUA 4ZZOA 1ZFPE 2XIZA 3ZONA 2IUGA 3HV7A 1LEWA 2BIYA 3NNVA 4R6VA 1IRKA 3G90X 3WF7A 3FMDA 3ZSIA 4R8QA 5CT7A 4BIEA 5IA1A 3N9XA 4I5CA 4NW6A 5L6PA 4ROJA 3NEWA 4FIEA 5H8BA 2ZDUA 2LNWA 4AACA 1KC2A 2ZV8A 2VTMA 3HVCA 5E8YA 3DBQA 3HMNA 5H2UA 4APPA 2VTSA 3VUTA 4ZP5A 3UNZA 3OCTA 3OVVA 4ZJJA 3W8LA 3E7OA 4GG7A 2BUJA 2I6LA 2PYWA 5J5TA 3IN7A 5LMBA 4DF3A 4QYYA 5FWKK 4ERKA 2ETKA 5ACKA 3ZH8A 2FYSA 4YNOA 2UW9A 1CWEA 3NUXA 3T8OA 2W99B 1CMKE 3COMA 5TE0A 5IH6A 2VTOA 2CKQA 5M4CA 4BBFA 3VRPA 4ZIMA 2X4ZA 2WEVA 2XB7A 4EQUA 2MK2A 4OBOA 3DT1A 5K5NA 4L7SA 3RPRA 4EIHA 3P9JA 2YM3A 2OWBA 3HV3A 4JR3A 2F49A 2PTKA 3WI6A 4JIKA 5HIEA 2QLUA 1YI6A 3UO6A 4ZTSA 3VUGA 4ENXA 4EY0A 4KRCA 2R3PA 2Y7JA 4AQCA 4EOQA 1OUYA 4ZTHA 4MNFA 2P4IA 3SKCA 2Q0NA 3E87A 3UQCA 1J3HA 1QPJA 4WKQA 2JKQA 2QOHA 1CSNA 3L8SA 3NAYA 2XJ0A 5AUVA 4ZLZA 5KCVA 4EOSA 1OIYA 1OKYA 4U42A 1H08A 2CI9A 4FYOA 5CQUA 5CX9A 4R1YA 4DTAA 4O2PA 1TCEA 4BTJA 4FK6A 3CTQA 4F6UA 3JUHA 5FBOA 4AAAA 2DM0A 2GCDA 5TOZA 4JS8A 2MC1A 3OP5A 3V3VA 5GZ8A 2ETRA 4GYIA 4QMXA 2JFMA 4Y46A 2JAMA 4E5WA 2QOLA 3VC4A 2YWVA 3DBFA 4ONAA 2HW7A 1OO3A 5EHPA 4BDGA 1SZMA 3QRTA 3PIXA 5F95A 4W4XA 5AJQA 4EZ5A 1R1PA 3PUPA 4H3PA 2IZTA 4MYGA 3D14A 4EKKA 5AAEA 3EL8A 4GFGA 5HOAA 3SXFA 4KIKA 4Y95A 1H1WA 4JT3A 4WSQA 4O7VA 2VTNA 4ZS4A 5DIAA 3DKCA 4PY1A 3U6IA 3RP9A 4FT7A 2J7TA 5L8JA 3M2WA 5E4HA 5EQYA 3VUDA 4C3FA 4ZTLA 3LFSA 5FM2A 3LOKA 5AP5A 4WSYA 3VWAA 1YVJA 4R7IA 1FHSA 3RKBA 3NGAA 2X7GA 3OOGA 5CZHA 5H8EA 3QBNA 4G3EA 5DWRA 5B0XA 4N57A 3FC1X 4NCTA 5I3OA 2FSTX 1Q3DA 3QWKA 2QMSA 3LFNA 3DXNA 4MNEA 4F9BA 4F70A 5KBRA 1Y91A 2QI8A 3DBDA 5KBQA 3BUOB 2PZRA 4JDHA 2QG5A 5CLPA 3V5QA 4QP7A 4RIWB 5EK7A 2XP1A 2J51A 1BG1A 4L3LA 4PDSA 1F0QA 1YOLA 2ACXA 4BBMA 4M69A 2YLEA 3H0ZA 4DAWA 3JS2A 3DKGA 3GVUA 4LV5A 3O8PA 1UVRA 5JN2A 1O4BA 5E8WA 5I9UA 4WA9A 4BIBA 3QTUA 5AP2A 5IQDA 2CMWA 4J99A 2WMSA 3FY2A 3UJGA 5BVDA 4JI9A 2XCKA 3D2KA 3NUPA 3O8TA 4QTCA 2ITVA 4U0IA 4YZDA 4BCIA 4Z55A 4CTBA 1XH5A 3DKOA 5AP3A 5DLSA 4IZ7A 1O47A 3BU5A 4D9TA 3R6XA 3A7FA 3KRWA 4C35A 4U41A 5FEDA 4UYAA 4DH5A 4FTCA 4O21A 4BGQA 1Q41A 5FGKA 3DTCA 4AT3A 4CT1A 4RZWA 3EZRA 1J7UA 3SAYA 1DAYA 2OSCA 4A9SA 3BZ3A 1HCTB 4FV1A 3V8WA 4P4CA 4HVIA 3PY1A 3IOKA 1SVHA 3RHXA 3DTWA 4EHVA 4NYEA 1OGUA 3N7YA 2HOGA 2C6EA 3NUSA 5F4NA 4V01A 3VBTA 4D28A 4EQCA 5A4CA 3HUBA 3AC4A 3UG2A 3U55A 1D1ZA 5CSPA 2R3JA 3KXNA 4JQ8A 4OT6A 1IAJA 3AGLA 3F3VA 2B52A 4C2VA 2C68A 1P2AA 1M2RA 5DT3A 3EQPA 4I3ZA 2C0TA 1FMOE 3ZYAA 2X6EA 3ZS5A 1A1AA 2IW6A 3FC2A 5EHRA 3DK3A 3NPCA 3ETAA 4NK9A 1XBBA 3TZ8A 4EOLA 3CQUA 2JDSA 3AG9A 3W2QA 4K1BA 4TZRA 3WF6A 4ASEA 3O17A 4E93A 4XRLA 4CT2A 4OTFA 3DV3A 3G6HA 1A1BA 4IWDA 2UZUE 1XWSA 1YI3A 4UY9A 3FL5A 4F99A 4QTDA 1M52A 3VHKA 2W5BA 3BU3A 1KE9A 4JLCA 3NHNA 3R0TA 4TYIA 3GFWA 4AOTA 4CEGA 1U5RA 4QYGA 4OGRA 3OT3A 3BV3A 2X8DA 3ACJA 4YLJA 5DHJA 2GQRA 1X27A 3BHYA 1UA2A 3KGAA 4IZYA 4R78A 3QZHA 3MW1A 5JZJA 4BB4A 4FL1A 2P55A 4G5JA 5EM6A 3FKOA 5A3XA 4AZSA 2BIKB 4B8LA 4X3JA 3Q3BA 1WFCA 5M55A 4L44A 3TUBA 4O6LA 4FT0A 2WTJA 4EOPA 1CTPE 2JITA 5EDQA 1LCJA 2WEIA 3HMOA 2GDOA 2ZMCA 3GB2A 3VS6A 5HX6A 3FLZA 4G2FA 3KQ7A 3NDMA 1NXKA 4Q5EA 3KN6A 4GT5A 1XA6A 5M4UA 5JFVA 3R9OA 2AC5A 4TN6A 4TYHB 2H96A 3GQIB 4OLIA 4RJ3A 1LKLA 4O38A 1ZY5A 3KL8A 2OH4A 4DT8A 5JT2A 3C9WA 2PNAA 3WIGA 1JWHA 2C1AA 1F2FA 1E9HA 4LL5A 2L4KA 1BI7A 4GKHA 3A62A 4C62A 4RIWA 5KMKA 4XG8A 3DDQA 4YLKA 3BGZA 5BVOA 3AC2A 1Y6AA 3QQFA 4E1ZA 1E1XA 3BWJA 4DFZE 4DH3A 3ATSA 2IUIA 1OVEA 2ESMA 2WU7A 2OJIA 2H8HA 2W1DA 4J97A 3BHUA 1V0PA 4DCAA 3PRFA 3T04A 1UNHA 4YZBA 4BFMA 4GJ2A 1NRVA 4DG3E 3P7CA 1PKDA 3EQHA 4USDA 5DG5A 1O46A 4QP6A 4WUNA 3UTOA 2J5FA 2OGVA 4X6RA 5KAZA 1VZOA 5IDNA 4YC6A 4E6DA 3FI2A 2W1ZA 4C38A 3QU0A 3HAVA 3S8OA 4V05A 3QFVA 3TV4A 3PXQA 5JMSA 4DTKA 4ZMFA 4DN5A 2GTNA 5FTOA 2ITXA 5IH5A 3H10A 5AA9A 4BCQA 2XRWA 4U43A 4FICA 3RK5A 3VBVA 3W16A 2VO7A 3FSKA 3MJ1A 4HPTE 5EFQA 3ZXTA 1AOTF 3VULA 3OUKA 3D5VA 3BV2A 2A2AA 3QRJA 4MQ1A 4OTGA 5E8ZA 1J1CA 3CP9A 4RFYA 3MFTA 5AWMA 4DFLA 5CYIA 2PVRA 2VV9A 2XNGA 3LCDA 4UN0C 3TDVA 3S9KA 4R3PA 2F7EE 1MP8A 1JU5A 3QX2A 4G3CA 4X3FC 3KULB 5CEIA 3W8QA 2VWWA 2EWAA 1H24A 4BDEA 2OI4X 4L3PA 2P33A 2Q83A 3SDJA 1GAGA 3E7VA 3H9RA 2EYVA 1G8SA 2YCFA 3PA5A 2JDVA 5GJIA 1VYZA 5GIOE 1WBSA 4D4VA 3PTGA 3RPOA 3TM0A 1Q5KA 1UWJA 5L3AA 2X8IA 3CIKA 3ZO3A 1BLKA 2R3NA 4RIXB 3I5NA 2X39A 1H8FA 1B39A 3TZMA 2XVDA 2VTIA 3NYVA 3Q4CA 4MXZA 4NUSA 4BR3A 3E63A 4QP2A 3MFSA 4IWOA 4XLVA 3VF8A 1PYEA 4L43A 3CY2A 3OD6X 4P90A 3RINA 1LUFA 3ZO2A 3ZUTA 4EH8A 4GEOA 4FT3A 1FBZA 2WQOA 3AGMA 4PMMA 3GCPA 3UIXA 2YDKA 4Z16A 5IDPA 4OTHA 4AGCA 3QC9A 4ZMEA 2J2IB 2L6KA 2ITZA 1PRYA 3PA3A 3B8QA 1A81A 1RJAA 4DEGA 4WUAA 3NCZA 1OZ1A 4IVDA 3NYXA 3ZLWA 2JKKA 4K33A 2Z8CA 4F0IA 2F9GA 3PP1A 3EL7A 4JG6A 3PSJA 3FMKA 2OBJA 5CWZA 4EUUA 5CAOA 2R7BA 5LQFA 4F08A 3BPRA 3Q4TA 4YTCA 2MRJA 5IH4A 5HBJA 2QOIA 2E9PA 3BQRA 2W1FA 5CVFA 4F5AA 4UYNA 2CGUA 3PJ1A 2W9ZB 4C37A 4IBMA 3VIDA 1XH9A 4F9WA 4TYHA 2EYZA 3GQIA 3VJNA 4FEUA 2W1CA 3H0YA 5DPVA 4CFUA 3EN7A 5J1WA 5FRIA 3RCJA 2C0IA 3KMMA 3MH1A 3TNPC 4H3QA 3VUMA 1Q97A 4I93A 3K3JA 3W2OA 3ORZA 1OKZA 2XUUA 3ATTA 1W0XC 3FMNA 4K2RA 5IQGA 4FSNA 4V04A 4DC2A 4FGRA 4YP8A 3UYSA 2VZ6A 4EH9A 4IB0A 1P14A 3F2AA 3QYZA 3P08A 4QPSA 3G6GA 3OWJA 3LFQA 4FVRA 4IFCA 3PLSA 3QXPA 3VHEA 4BCHA 4CRLA 3R01A 4E5BA 4WBBB 3JY0A 4MEDA 4A4XA 2NRYA 4MBIA 5DC0B 2PVJA 4MXCA 5HLWA 4JAIA 2BDFA 2P0CA 2WTCA 5AFVA 4MHAA 5J5SA 2B9IA 3DJ6A 5CQWA 5E92A 3KA0A 4FIIA 4HYUA 3UVPA 4BI2A 2YSXA 1IG1A 3CSVA 3CLYA 3QTIA 2XK4A 4A7CA 5M07A 4KINA 5EI2A 3G9LX 1A07A 4MD8E 4M84A 3W10A 3TI1A 4UMUA 2VN9A 4IEBA 3VN9A 3NUUA 2IVUA 1APME 3QQHA 3RBWA 4D2WA 4OAUC 4WG4A 1ZOEA 5KMJA 1JSVA 4F6SA 2J9MA 5A4QA 5EKNA 3NW5A 2GHMA 3KEXA 4WD5A 1H27A 2GFSA 3QHRA 1IR3A 2QU6A 3P79A 2GMXA 3GXLA 4C4FA 1XH6A 1PXMA 3MTFA 3UZTA 4FV3A 4FNXA 2JDTA 5L6WL 2WHBA 2W1GA 5LCJA 1O4PA 2A27A 4JDJA 3KULA 3V6SA 1H01A 2YM5A 5D10A 5EHLA 4DEDA 5AV1A 2VTRA 3P4KA 4FODA 4L3JA 3PVUA 4M14A 4D4SA 3K2MA 3KFJA 3OV1A 4ACGA 2PLDA 5BYYA 3FLSA 3IS5A 4G6LA 3D0EA 5KMIA 3ENMA 3CD3A 3OCBA 4LG4A 3TWJA 4U81A 4ZTQA 3TIZA 2BMCA 2QCSA 2VNWA 3LCOA 3OWPA 4YJRA 4Z3VA 2WTWA 5ANEA 4BYJA 3IW6A 4R5YA 4CV9A 2ZJWA 4KIPA 4CV8A 2EKXA 1BMKA 5KE0A 2AUGA 4CFWA 4BF2A 5DT0A 3AD4A 3LAUA 3LJ0A 4O6EA 1BM2A 1ZY4A 3AT3A 3TUCA 3MA3A 3LQ5A 3FI8A 3KFAA 2YU7A 4WNOA 5LWNA 2GNHA 5HD4A 5H3QA 1TZEE 2PVLA 2NO3A 2QODA 4IADA 4GS6A 3RGFA 4F59A 5DRDA 2YITA 1ZYLA 5LARA 4ANSA 4TYEA 3WZKA 1R0PA 3L8PA 2UZWE 3TNHA 3TL0A 4G5PA 3DZOA 4MVFA 4ERWA 5I9YA 2ONLC 4WHZA 2OJ9A 3F2NA 3R2BA 1ERKA 2XK9A 1GJOA 1WBVA 2EVAA 2BPMA 2FA2A 2UZTA 2XBAA 5JRSA 4FV9A 4WIHA 3DJ7A 1O9UA 5C26A 4AW5A 3EHAA 5IEXA 4BBEA 5G6VA 2BKKA 2HAKA 2UZOA 2ZM3A 2WIHA 3KCKA 5M51A 2PULA 3PJ2A 4EK6A 5DOSA 1RDQE 4JDIA 5GINE 2XYNA 4P7EA 2ETZA 1H28A 3R1SA 3BLQA 1ZMUA 4BCKA 2ZB1A 5DI1A 3ZLSA 4ZJVA 4FG8A 2C3KA 3QLGA 1F3MC 3JVSA 3OF0A 3R9NA 4F1MA 4JGHA 1A1CA 4D5KA 3RI1A 4A4BA 3PJ3A 3ID6C 4CRSA 5CU2A 2CGWA 5HE1A 2J0LA 4DGMA 3N4UA 5K3YA 4AT4A 5EYDA 1H07A 3EQIA 3G0EA 4FV5A 2KULA 2WMQA 2HXLA 3NYOA 4IX6A 2EB2A 1YHWA 1P5EA 4R3RA 5DC9A 4YO6A 3F3WA 2QO2A 3OHTA 2V55A 1LUMA 5CVHA 1S9IA 2JKOA 4H58A 4KAOA 3RALA 1ZXEA 4LFIA 1BHFA 2EU0A 5HKZA 3OEZA 1G83A 2DLZA 2Y4IC 4O0VA 1XH4A 4D2PA 3R7EA 4RRVA 4I5MA 4PP7A 4IHPA 4G9CA 5EEQA 3OXTA 4C4JA 3V01A 3C0GA 3SD0A 2UUEA 4Z7GA 2CNUA 1H00A 1YWVA 2X2MA 3EOCA 4O1PA 2B53A 3PWDA 4FEVA 1SPSA 2QLQA 4FIGA 3MVHA 3EFKA 4RWJA 3L9PA 4F6WA 3FMJA 3GT8A 4XP2A 2A4LA 4EBWA 3TT0A 2V62A 2W4JA 2WAJA 1XH8A 5IEVA 4E68A 1JNKA 2VWBA 1UU9A 4DLIA 1M7QA 5FM3A 2CKEA 4MXXA 5I9ZA 3UGCA 1KE5A 2XIKA 4BZOA 4IQ6A 5FUTA 3D5XA 3EQGA 5M53A 2JC6A 3SXRA 2O8YA 4X2GA 2WOUA 4WG3A 4ANNA 1D4WA 2C6LA 1YW2A 4XRJA 3TXOA 1H9OA 1PXKA 4E7WA 2ITYA 4M13A 5CAVA 3PIZA 4QQTA 4CGAA 3WE8A 3SA0A 4QQJA 4H3BA 4S34A 1K3AA 3KREA 5HEZA 3B2WA 4XZ1A 2BZHB 5C4KA 1M2PA 2YIWA 5JSMA 3L9NA 3OWKA 1AYAA 4OHIA 4CFMA 2BHHA 2PE1A 2JIUA 3CKWA 4U17A 3LIJA 2H9VA 4FTKA 3OB2B 2O65A 2VTLA 2ITUA 2FSMX 1OMWA 3GP0A 1FGKA 2CR4A 3DGKA 1NZVA 3F3TA 3PJPA 5CSHA 2PK9A 2UZDA 4FL3A 5FBNC 5J9LA 4NJ3A 4JG8A 3GOPA 4EH5A 2EO3A 4GWFA 4NTTA 2C6OA 2BVAA 3HV5A 5AR8A 2SHPA 3VF9A 2YEXA 2VX1A 2XKDA 3V5PA 1IAHA 4A9YA 4ITJA 1AB2A 2BHEA 5EM8A 4X21A 1WCCA 2ZDTA 4KIQA 3SC1A 1M7NA 4UZHA 4NWGA 2C3IB 2WPAA 3F82A 3THBA 4BDCA 4YGAA 3QA0A 2ZM4A 4N0SA 3UQGA 1O45A 4IJPA 4X2JA 3LE6A 1D4TA 5DRBA 3UYOA 4CG9A 2A0CX 3PVWA 2W7XA 2XJ1A 4NIFA 5AV2A 1Z57A 2F4JA 3OY3A 1U54A 3ERKA 1O4FA 5DE2A 4TT7A 1RJBA 3T3VA 4ACHA 1KWPA 4YUQA 4FKJA 1L3RE 5J79A 4PDYA 5IA5A 4F09A 3DNEA 2HMHA 4WWQA 4LGDA 2BDWA 4M66A 4U79A 2YIXA 1IASA 2GSFA 3PA4A 3WZUA 5CEPA 5ANGA 5GNKA 4FSWA 1GY3A 1TKIA 5IUIA 1DAWA 4EQMA 5AADA 4CFNA 4RFZA 3CD8A 1PYXA 3FZ1A 4YJSA 5CNNA 5EELA 2GNGA 4AGUA 3GU4A 1BFJA 2C3JA 2JDOA 3WBLA 2KNOA 3TNQB 4AF3A 4K77A 3F7ZA 4YSMA 5GJGA 1LPUA 5JRQA 4H39A 2PPQA 5FXRA 4XV3A 2XF0A 3NRMA 5K4IA 2O2UA 5IG1A 3ZNIA 3QUDA 3ZC6A 4CCBA 3QCSA 4FV8A 4JR7A 4EWHA 3R2YA 3OOMA 3OEFX 2XS0A 1WBTA 3R8UA 2YLFA 3E92A 2YHVA 4C4IA 5IMEA 3UO5A 4QP4A 4FNWA 5AA8A 2DX0A 3M42A 4BKYA 1PMUA 5CALA 2ITNA 3C51A 4DH8A 1OIUA 2IZUA 1OPJA 1O49A 1RPYA 4YPDA 2EO6A 4NFMA 4S33A 2NRUA 4D2VA 3ZO4A 4FI1A 4TNDA 1ZZ2A 3DS6A 3I81A 2IZVA 5E8UA 3WF8A 4EHEA 3P78A 3UC4A 3OFMA 3CEKA 1ZLTA 4RFMA 5A46A 1W84A 3A99A 3ZU7A 5M56A 3SW4A 5K5XA 4FEWA 2PVYA 3S4QA 4C3PA 3V5WA 4BCMA 4FC0A 2VTPA 5HORA 4JIAA 1LEZA 3JYAA 2ITWA 5AUTA 4AGDA 4D9UA 4ALWA 4QMYA 1SYKA 1R3CA 1LUKA 4MNEB 4FOBA 4GU9A 1O4OA 1AYBA 3QZFA 1PXNA 5ANOA 4E4XA 3ZM4A 3UG1A 5CEOA 4TZIA 1ZYCA 3COKA 1U46A 5A6OA 2YAKA 3W1FA 1ZYSA 2XK7A 3O8UA 3OW4A 3SLSA 2F57A 3HEGA 4XBRA 3HL7A 2R3MA 3KF4A 3G9NA 3QTXA 4C36A 2YJRA 1O4IA 3QKKA 4ASXA 5JK3A 1SNUA 2OQ1A 4IVBA 5CVGA 3SQQA 3E8DA 4CZTA 2BRHA 3QKMA 1WVWA 2UVZA 3QHWA 3CCNA 1QL6A 4FIHA 4JVGA 3RNYA 4HVGA 3OY1A 4MK0A 2VO3A 4FTIA 3TTIA 4F7NA 3U54A 3HMIA 4FBNA 3UOJA 5CF5A 3EB0A 5L6OA 5EDPA 4H05A 3BEGA 1BKLA 2VTQA 2WTIA 4K18A 4U3ZA 4FL2A 4JG7A 4TRLA 4O84A 3FKNA 4UX9A 4FV0A 5IMXA 3CWGA 2BROA 2ERKA 5BUIA 4EH3A 1WZYA 2X7OA 5CF6A 4Q5HA 4QMVA 4OHDA 5CF8A 3PJ8A 3EFLA 2WNTA 4HVHA 4FMQA 4BRXA 5LMKC 2F2UA 3IKAA 4R7BA 4I5HA 3OB1B 2XNMA 3IW4A 3ANRA 5GJHA 3NW7A 2B55A 2GTMA 4BCGA 4UWCA 4D2SA 5KZIA 2WOTA 2NPQA 3F88A 4FSYA 1H1SA 4NKSA 4DGGA 2FO0A 2VO0A 3TKUA 1Y1UA 2AC3A 2BALA 3UP2A 1OBGA 4QD6A 3PLAE 3UF4A 3P1AA 3VJOA 3PVBA 3RCDA 5HG7A 4IE9A 5HG8A 4H1JA 2H5KA 4CFXA 2W96B 1Q8WA 2IVTA 2QOCA 4JX7A 3F5UA 3A2CA 4PF4A 4PPAA 5DEWA 5EHYA 4HCUA 2RFSA 3CGOA 3ZLYA 5BYLA 4IX5A 4KWPA 4PUZA 3ALOA 4EL9A 2Y6OA 3V5JA 5CNOA 5AX3A 5L2QA 5J7HA 4QMOA 5C27A 3MPAA 2XZSA 2BAJA 3DZQA 2H46E 1RW8A 5AV3A 5AR4A 4BDDA 2CBLA 3PSDA 1B6CB 1P4OA 2ITOA 1AGWA 4YC3A 3WZJA 1J7LA 4PRJA 4CMOA 2VWUA 2X7FA 3P86A 4LUDA 3QRUA 1REJA 2JIIA 3QGYA 4J98A 4D5HA 3GBZA 4NZWB 2W06A
chains in the Genus database with same CATH superfamily
4EH2A 4GG5A 3R7IA 3QA8A 5I9WA 3U6JA 1KUTA 3UNKA 3F3UA 2PUNA 1QADA 3NZ0A 1CM8A 4QRCA 4GJ3A 4A9RA 4XV2A 3IMDA 3LFBA 3DK6A 3K3IA 3PY0A 2R64A 4LMUA 5HNIX 2VTTA 1IA8A 4EUTA 4QP3A 4FNYA 2OZOA 3FEGA 4DDIA 1T45A 3CQWA 4AA0A 3KRXA 1OIRA 2G15A 4MKCA 1FVTA 4QMSA 3GCSA 4F7LA 4FV2A 2R3KA 3QX4A 4MCVA 4OUCA 3ZFXA 3BYUA 3ZBXA 4FEXA 1W98A 1TZDA 2BFXA 4CD0A 1O4GA 3Q4ZA 5HTIA 4O7ZA 3BGPA 4QMWA 2RSYA 4OTRA 4OHHA 1PXJA 1Y8YA 4FTQA 5EDRA 4UBAA 3R1NA 3VRQA 5C9CA 2RVFA 4IM3A 3NUAA 2Z60A 3TKIA 3A4OX 3MFUA 4XJ0A 1LR4A 4YJVA 4EK3A 3BHVA 3Q9YA 1A48A 2ETMA 3Q2MA 4QTAA 3U4WA 4AN9A 5ICPA 3MXYA 5CF4A 2IW9A 2NNWB 5CI6A 1NVRA 2WELA 3U9CA 4F7SA 2YJSA 5IPJA 4GKIA 3VQHA 4RWKA 5BVKA 2F7XE 2BRGA 1BLXA 2C4GA 2JBOA 4XOZA 5HNGA 4L00A 4EYMA 2F2CB 3C5IA 4QYHA 5IA3A 3RK9A 1OB3A 4FG9A 3FPQA 4PTGA 2P2HA 4FK3A 5HO8A 4C7TA 5LMKA 1UURA 1CKIA 4ANLA 4A4CA 3EQCA 2PVNA 5D7AA 2WTDA 1GHUA 1VEBA 1YXVA 4TWNA 3BLHA 1J1BA 4IW0A 1ATPE 4I1ZA 5HCZA 1REKA 3EQFA 4DGOA 1B47A 3L9LA 3Q9XA 3AC5A 4O2ZA 3FYKX 3IGGA 2GS7A 2PMIA 4E8AA 4ENYA 4GIIA 4I6HA 3AT2A 3BEAA 1KOBA 3R63A 1ZWSA 4LRJA 3TUDA 3QAME 4FSUA 1G5SA 3AOXA 3GCQA 5CU3A 4DEIA 4E4MA 3AKLA 3LHJA 2X0QA 3IW5A 4H36A 3QD4A 1FMKA 4DGNA 5KMOA 5IKWA 2I0VA 3MVLA 4HNFA 2OJGA 2VWZA 3OP0A 3FY0A 2GU8A 5LVPA 3TV7A 2I0YA 3LMHA 3FMMA 3POZA 3VS1A 2CSNA 4KS7A 1NZLA 2WFYA 3N4TA 4RLKA 3BLRA 4RC4A 3ZFMA 4M0YA 5EOBA 2Z7RA 3QYWA 4JQEA 2OXXA 4I23A 3BCEA 2DVJA 1UNLA 3MTLA 4V0GA 4L45A 2CNQA 4FSTA 1W83A 1XHAA 4ALUA 3PUFC 2R4BA 3FJQE 3RHKA 4O91A 4F9CA 1E1VA 2AQXA 5C1QB 2GPHA 2OJJA 1FBNA 5KNJA 3JVRA 3PE2A 3R83A 3MYGA 4LRMA 1M17A 4BY9E 4I0RA 3R02A 1XO2B 4A9TA 3TZ7A 4A4LA 5FTGA 2Z7QA 1H0VA 1OPLA 3LM0A 4S30A 2G2IA 5EOLA 2YABA 4MXYA 3WE4A 4A9UA 2OK1A 3FLNC 4AZVA 4G6NA 1SMHA 4APCA 3BUNB 2OW3A 3DAEA 3PXYA 2R3OA 3ZEWA 5B2KA 1LP4A 5JEBA 2IG7A 3IONA 4GUEA 1A1EA 2PUPA 2ZV7A 1NVQA 2WB8A 3V5LA 2E9UA 3BYOA 3C4EA 4RX5A 2LCTA 2YACA 4K11A 4EOOA 4XCUA 3FHIA 3JPVA 4O22A 2QURA 4PL3A 3PRIA 4O1OA 1YQJA 4EWQA 2J5EA 3SW7A 3SVVA 5IQEA 5GHVA 4J95A 3ITZA 4NWFA 4QPAA 4TNBA 3VBQA 2OICA 4A07A 4KIOA 4I0TA 1PKGA 2UVYA 2W0JA 3VBWA 4JOAA 1LKKA 1I3ZA 5AP4A 3BYVA 4U40A 5HE2A 5I4NA 4FTJA 4D58A 3LCSA 2BKZA 3VNTA 2W1HA 4GV1A 1O48A 3SRVA 3R71A 1OI9A 2W1EA 2C47A 4BJJB 1Q61A 2V22A 3PLFB 1Y8GA 4IM2A 3BX5A 5CDWA 3M11A 3Q4UA 1YWRA 1FQ1B 3MWUA 5M08A 2EXEA 3BYSA 4IVAA 3DLZA 4NSTA 2QNJA 3QQUA 4QNYA 5ETIA 1J7IA 4K9YA 3CXLA 2HZ0A 2EXCX 3COIA 1OKWA 3KXHA 3LXPA 2YIYA 3FI4A 1URWA 5IEYA 1F5QA 2J6MA 4RVKA 4C02A 2W4KA 5B7VA 3KF7A 3TV6A 3I0QA 2UZBA 5F1ZA 4H34A 5IA2A 3IOPA 3AC8A 4YLLA 4Y83A 3PQZA 4LQMA 3OS3A 1YXXA 2XNOA 4HOKA 3CY3A 1XR1A 4MAOA 4BWPA 4YBJA 1O4AA 4PMSA 1Q24A 5ITAA 3UDBA 2VWIA 4E6CA 4XP3A 4YU2A 3NVKI 1IS0A 3QTSA 2JAVA 1WVYA 3HUCA 1YKRA 4GU6A 3ZUUA 4F9AA 3N84A 3O51A 1O4MA 3FMLA 2JKMA 4FTTA 4QTEA 4OBPA 3TKZA 5E9EA 1JSTA 3QTRA 2GS6A 1FVVA 1O4LA 2VX0A 4JRVA 3RAHA 5M06A 3FXZA 5GIPE 3E62A 2IO6A 3EN9A 1KE6A 2KTYA 4WNPA 1GOLA 3ORPA 4EK5A 4DHIB 1KSWA 2G1TA 3W2CA 4EKLA 4EHZA 5JFXA 4J7BA 4QQ5A 4BI1A 3WZDA 2OLCA 4D1ZA 2GSBA 4BI0A 3GC9A 2FH9A 5C8NA 2OG8A 2VO6A 3ORLA 2Y3AB 2YDJA 1Q99A 4U1PA 4ASDA 3GGFA 2CGXA 2G9XA 3L8VA 5CEMA 3BBTB 2UW7A 3NNUA 4II5A 3UE4A 3RNIA 4AA5A 1FYRA 4TXCA 3NW6A 4QQCA 3RM6A 2BRNA 4PP9A 4ZK5A 4L52A 4GVJA 4B0GA 1W8CA 2GNIA 3P7AA 4HNIA 3RVGA 4LOPA 1TQPA 3S2PA 3MA6A 3FE3A 3R7UA 5A9UA 3M1SA 1FOTA 5EQPA 1SHAA 3IMJA 5IZFA 1OO4A 2XNNA 3I1AA 4G6OA 4XYFA 1JAMA 2WTVA 1UWHA 2HUWA 4AZEA 2JIVA 2VIFA 3PPKA 5ETFA 3ACKA 2JYQA 3CS9A 3HP5A 3N51A 4EK4A 4C4EA 5AAFA 5EG3A 4F1TA 1MUOA 3A60A 1O6KA 2VX3A 3UDTA 3EFJA 2UW5A 4NTSA 4MD7E 1EH4A 4WBOA 3WYYA 1JOWB 2R2PA 3S95A 3R04A 5D0JA 4OHEA 3ORIA 4U3YA 3GC8A 4ZTMA 3LMIA 4FYNA 5CT0A 3R7YA 1JYUA 5K4JA 1A08A 5DMZA 3O5AA 5KMMA 2XM8A 2EL8A 2YM8A 5TT7A 3AD6A 5I6VA 1ZZLA 1Q62A 3EN4A 4BTFA 3LXKA 3HRBA 1UKHA 4HPUE 3T3UA 1IEPA 4B6LA 2FCIA 3MXCA 3KVWA 4QPMA 1TQIA 2GHGA 4RPVA 5CSWA 2PE2A 4XUFA 3TNIA 2CLXA 2PVHA 3PXZA 5FTQA 2HDVA 4DEBA 4UMPA 3ORNA 4BKZA 3RAIA 3FQEA 1PXIA 5HIBA 4PX6A 3S0OA 1SVEA 4BJJA 4DDGA 2C6TA 2RGPA 5DVRA 4MUQA 5HVYA 1NY3A 3R9DA 1CSZA 1SNXA 1OIQA 2PZ5A 3F6XA 3WF9A 4ZLYA 1SPRA 3ANQA 4F64A 3ULIA 4CNHA 3E3PA 2XALA 2JEDA 3F61A 1XKKA 3K5VA 4I41A 3QD3A 5IA0A 1BMBA 1AYCA 5JKGA 1CWDL 1FBVA 5FEQA 3NVMB 5E1SA 4FKGA 1W2FA 4AGWA 4QMLA 4QYFA 4NW5A 4YZCA 3NNWA 4X2FA 2AOBA 5GZ9A 3MGYA 2JGZA 5A4EA 3FMHA 1JBPE 2X9FA 2XYUA 4XG7A 4DEEA 4I20A 2OZAA 3RWPA 2ITQA 4EORA 1OL6A 2R3GA 4NM0A 1VJYA 4EBVA 4PNKA 2G01A 3Q9ZA 4FT9A 4FZ6A 3A61A 2A1AB 3E93A 5D1JA 3BQCA 4IAIA 5EQEA 4LYNA 2YIRA 4UV0A 4X3FA 4QT1A 4C4HA 2OFVA 3MY5A 3OUNB 1V0OA 4AG8A 1OBDA 2EB3A 3FQSA 2PZIA 3EN5A 5BVEA 2FSLX 2CN8A 4HGEA 4YC8A 4XG9A 5HESA 1GRIA 3VUHA 3QLFA 3EACA 3O7LB 4J53A 5JH6A 4OBQA 2WMBA 5IQIA 3OXZA 2C1BA 3CGFA 4F9YA 4O82A 2YM4A 3WILA 3IDCA 3N8MA 1CDKA 1A09A 5IQBA 1NA7A 2WMUA 4DFUA 3S8NA 3E8CA 3AMYA 2ERZE 4W9XA 5D11A 4QOXA 4AU8A 5AUYA 4NL0A 5F20A 4RA5A 1UU8A 2QKWB 4IB1A 4FTRA 2C6MA 2VTHA 3ZUVA 2R0IA 4AXAA 2YM7A 2ZV2A 1BX6A 2C69A 3D2IA 3KY2A 2E2BA 4TW9A 4RC3A 4XV9A 3ZFYA 2O3PA 3G33A 2C0OA 2UZEA 4DLJA 2YWPA 2A19B 3K54A 4FF8A 4W8EA 2B9FA 5C8MA 5K9IA 1LCKA 2A98A 3A7JA 3C5UA 2X4FA 1P4FA 3SG9A 3F69A 5LJJA 3NLBA 4C3RA 2GNLA 3I0OA 4AXDA 3GEQA 3UPZA 1SKJA 4LOQA 4EOJA 2Y1MA 3VGOA 4FEQA 4YTIA 4AUAA 4ANBA 2AUHA 1OITA 1O4JA 4I24A 4DCEA 5JFSA 4NIFB 3MH2A 4C58A 1VR2A 2O0UA 1U54B 4G34A 3F5PA 3UOKA 3ZZWA 3R73A 1YWNA 2XA4A 4O0WA 3QD2B 5LMAA 4FA2A 5TR6A 3CKXA 3RTPA 3QWJA 4FZFB 4RSSA 2VTJA 2R3RA 2RSVA 3UP7A 4HW7A 2E9VA 1YDSE 2J4ZA 3VO3A 3SOCA 3VUIA 4QDEA 3VRNA 3HMMA 2PZPA 2BTRA 4XEYA 4IAFA 3GENA 3U9NA 3PFYA 3ZO1A 3FI3A 4DEHA 4DINA 3ZCLA 1TVOA 4FTMA 4AOJA 2Y4IB 4JEGA 4Q2AA 4IC7A 3L1SA 5HO7A 1Q8YA 2WMVA 5IQCA 1JYQA 1QPDA 5CTPA 1W2DA 1FU5A 4JAJA 4ZXTA 3UOHA 4UXLA 4DGLC 1OL5A 3L8XA 3NS9A 4KD1A 3QZIA 3SXSA 3FXXA 4PMPA 3I5ZA 3KN5A 4DGXA 3HECA 2WGJA 3NSZA 4MWIA 4W8DA 2YM6A 3UMWA 3QTZA 5HKMA 3CR0A 4C59A 1JWOA 2DQ7X 4XG4A 1YVLA 2VAGA 5BQ0A 5HVJA 2PNBA 4O7LA 3V6RA 3U8WA 3CQEA 2B4SB 3OW3A 5DBXA 4IC8A 3ZC5A 2HY81 5TF9A 2E9NA 4RT7A 4DHZA 1PMEA 1MILA 4NT4A 3PPZA 3QRIA 2HWOA 2UZNA 2EUFB 2OF2A 3MB7A 2BZKB 4XG2A 4W9WA 3DA6A 5LCKA 4O0SA 2XCHA 2YA9A 3FZPA 2UW3A 3R21A 4FKQA 5E8VA 4FV6A 3W18A 5JGAA 1XH7A 4ZOGA 3MESA 4E26A 4FTUA 3MVJA 4D0XA 4NJDA 3NMUF 4B9DA 3DXPA 4BTMA 4AXCA 3ENHA 3DCVA 4JMQA 4C8BA 3BBWA 3AC3A 5E91A 4J1RA 4KSPA 1YRPA 5BMMA 4PMTA 2WTKC 3DDPA 3EYHA 2FVDA 1PICA 4YHTA 4UMQA 4KA3A 1WMKA 4FKIA 4E6QA 5C4LA 1CJ1A 2UW4A 3D9VA 1QPCA 2C5VA 3R1YA 5EI8A 4FE2A 4M3QA 4U6RA 5GJFA 3CE3A 4IAZA 3REPA 4CTCA 2RORA 4GFOA 1BFIA 2CRHA 4NM5A 1O4DA 1DI8A 3G2FA 3O23A 4NEUA 1GZ8A 1W82A 4G31A 2ONLA 5A54A 4G1WA 4EJ7A 4YJNA 4O0RA 3CTHA 2OXYA 3ORMA 3QWXX 3W2RA 3ODYX 4BTKA 3NIZA 2X2KA 3FXWA 4CKRA 3PE1A 4RIOA 1JKSA 4DH1A 3HAMA 4LI5A 3ROYA 3GU6A 3ZSHA 3GUBA 4FKOA 1V0BA 2HWPA 4M67A 3Q5IA 3RWQA 3TACA 4IAYA 4QEBA 4IB5A 3ZEPA 4IWQA 2IVVA 4LL0A 3LCTA 3PZHA 5AM6A 3MFRA 1YOJA 3PSBA 1AD5A 2WD1A 4YMJA 3VROA 4EC9A 3LCKA 3QCXA 1MRUA 3VW6A 1BYGA 3RAKA 5KHXA 4IACA 4ZSJA 2E9OA 3DKFA 5CASA 3BUXB 4TYJA 3RM7A 4QMMA 1U59A 3LMGA 4JX3A 1BL6A 4EHGA 3S1HA 1CSYA 3TJCA 3ZRKA 4QO9A 5A4TA 1TQMA 1GZKA 3F9NA 4XBUA 3UYTA 5I0BA 1HCKA 3R7VA 3CBLA 5AMNA 5AV4A 5CXHA 2CGVA 4DFYA 5FG8A 4FKPA 5FP5A 4G3DA 4JJRA 4AW2A 4G17A 4FTAA 5HNBA 4CLIA 3NAXA 4KABA 4U9AA 5M4IA 3DXQA 3PDTA 2C6DA 3BIZA 4JL9A 3Q32A 4UMTA 3I79A 4R77A 5T68A 4QTBA 3ULZA 4B7TA 4CMTA 3NX8A 4BDIA 4D55A 3IPHA 5FD2A 1JKLA 2XMYA 3I6UA 3KRJA 3UIMA 4BHZA 4EONA 3D7TA 2PUUA 3VW8A 1M14A 4N4SA 4O7WA 4ZY5A 3QRKA 4ZSLA 3ROCA 3OG7A 4FX3A 5HU9A 5I3RA 4HJOA 2R3FA 4XHKB 3Q6WA 5HG9A 4KBAA 4UZDA 5J9ZA 2UV2A 4M68A 4FV7A 3TDWA 1KOAA 4HGLA 4IZAA 4U45A 4E73A 5K0KA 2MQIA 2PSQA 4NM3A 3FYJX 3MJ2A 4ZSAA 4YHFA 1O4KA 1WVXA 4J8NA 4JQ7A 1XBAA 3LJ2A 4LUEA 4Z7HA 5L8LA 5JQ8A 2LRAA 5HBEA 2V0DA 4G9RA 1R39A 2J90A 4WT6A 4E4NA 3OBGA 2CLQA 2HZ4A 3O71A 4L53A 4ZTNA 3T9TA 5BPYA 5HTBA 3ZXZA 3O96A 1I44A 3IECA 4EC8A 1SHDA 1FINA 3US4A 1JQHA 4XLIA 3C50A 4LMNA 5CXZA 3KC3A 5FDXA 3UODA 2RG5A 4I92A 4LGGA 4XG3A 3ZOSA 2C30A 4I6LA 1GNGA 3EKNA 2QONA 2H6DA 4AZWA 1O4RA 4IANA 3WF5A 3MN3A 3W2SA 3UNJA 5G1XA 3VS7A 3EN6A 5CAUA 2XAOA 3S00A 3WOWA 2JD5A 4IXPA 2I1MA 4QP9A 3N4VA 1FU6A 3PXRA 4KKHA 2RMXA 4BCPA 4R7HA 4RZVA 3SGCA 3MB6A 1XBCA 4EZ3A 3U51A 1BL7A 2UZLA 4KBCA 4BDFA 4LRKA 4CG8A 4PL4A 5HO6A 1UU7A 2B9JA 4K0YA 5HIDA 4JXFA 3FHRA 2PZYA 2YZLA 2AYPA 4FIJA 3PG1A 3UIBA 4AW1A 3COHA 1ZMVA 5ETAA 4R5SA 5JQ5A 4C61A 4MH7A 2HY0A 1PF8A 2OF4A 3EKKA 3VVHA 2VGPA 4E4LA 5AUWA 3V8TA 3BE9A 4DE4A 5EW9A 5AAGA 4FVQA 3NUNA 1R0EA 4RVTA 4W4YA 5AR3A 4DHFA 4YR8A 4FKRA 1O41A 4NCTC 2QOOA 2J50A 1GIIA 3QKLA 2BAKA 4BZNA 2YN8A 4L7FA 1L8TA 3JR1A 4QP1A 1HCLA 4M97A 4QDVA 4YJUA 1O44A 3PFQA 3F7WA 1YDRE 3E64A 5B2LA 5EW3A 5KKRC 3VAPA 4L8MA 5FDPA 5EM7A 2X8EA 4UWBA 4EH6A 3A7GA 1OGYA 2ABLA 4U8ZA 4MBLA 4PNIA 1OL1A 3OC1A 5FXQA 5IBMA 2Q0BA 2YCSA 3I4BA 3A8WA 4ZJIA 2WZJA 3WIKA 1B38A 1BHHB 3QCYA 3QQGA 1MRYA 2XIYA 3NFFB 3IG7A 5HCXA 4RJ7A 3BHHA 4GFMA 3HCKA 2W1IA 2B7AA 4F1OA 5AR2A 4FKLA 3P0MA 3DB8A 3CC6A 3MSSA 4FZ7A 4MXOA 4AN3A 3PP0A 4P2KA 4RWIA 2ECDA 3C1XA 4CQGA 3RPSA 3BUWB 4KB8A 2VWVA 2V5QA 4V0GB 4D1SA 4M15A 4MF1A 2GQGA 2PWLA 2WO6A 5F9EA 4BC6A 5AUUA 2PL0A 5EYCA 3W0OA 4XOYA 3LXNA 3Q04A 1OPKA 1ZAOA 1HOWA 2XM9A 4PTCA 3D4QA 4RX8A 3SOAA 4IX4A 3DNDA 4B4LA 2HELA 2HXQA 4D4YA 1UU3A 4M0ZA 2XK3A 4O83A 1OL2A 4XP0A 3UO4A 3V51A 3HZTA 3V5TA 3PFVA 2VRXA 5J7BA 2IJMA 5HGIA 4L68A 5CAPA 4OTWA 4FUXA 2CPKE 2CCIA 2OIQA 2GQSA 3UPXA 2F7ZE 5AP1A 2GNFA 3K5UA 3PIYA 4GSBA 3TTJA 4AZTA 3HV4A 4GT4A 2YIQA 4YPSA 4USEA 3H30A 4RMZA 4RJ8A 3GQLA 5GJDA 1H1PA 3OCSA 3IDPA 3FL4A 1P13A 3A7HA 2FGIA 4DEAA 2IZSA 4EI4A 3MIAA 2OKRA 3GU5A 3QQLA 3D94A 4UB7A 2ZOQA 2BILB 4YZMA 4BWXA 5DC4A 4E6AA 3D5UA 3ALNA 2X1NA 3DOGA 4BGHA 3R8ZA 4ZEGA 4Y8DA 2EU9A 5DT4A 1H1QA 4EOKA 4OAVB 1H26A 4IH8A 2PMNX 4FKTA 4IIRA 4O4DA 3RZFA 3ZMMA 4X6QC 2B3OA 5D7VA 5EKOA 4IDTA 3FLYA 2DUVA 3BLAA 3F5XA 5L4QA 4CZYB 3AXWA 4PTEA 4WRGA 4CFVA 4ALVA 5E7RA 4FSQA 1NT2A 3SRVB 3V04A 5B2MA 3CPCA 5E8TA 4HGSA 4HZSA 4RJ6A 4Y5QA 1W2CA 5TKDA 5IU2A 4TWOA 2QG7A 5DGZA 3RJCA 3C4XA 4F78A 1Z3KA 5BO4A 4FGBA 5FLFA 4YZNA 3ZHPC 4F7JA 3SG8A 2XJ2A 3RPYA 5HI2A 4QMUA 2XNBA 3TJDA 2Y4PA 4I22A 2W05A 3II5A 3OT8A 4J8MA 5K0XA 4M4ZA 3IDBA 5CS6A 2XEZA 5IA4A 1G3NA 1PXLA 1YHSA 2BFYA 2Z7SA 4FTOA 4FVPA 4ZSGA 5H9BA 5EI6A 5JFWA 3TL8A 5HKWA 3OTVA 4ZY4A 2HIWA 1RE8A 2Y6MA 4L01A 5C01A 3TN8A 3FAAA 3SX9A 2HW6A 5DYJA 5ETCA 4AOIA 3PSKA 3AD5A 1U5QA 4C33A 4K8AA 2XKCA 3QGWA 2PVKA 5KHWA 3AMAA 2RF9A 3FBVA 3KB7A 4RGJA 2XBJA 4YO4A 3R1QA 4O7NA 3DFAA 3GU8A 2YCRA 4MBJA 3Q9WA 4TTHB 2P2IA 3SV0A 2WMAA 4HYSA 3UDSA 4J52A 3A8XA 3GC0A 4BCFA 1UV5A 5KZ0A 4FRFA 3K2TA 3MH0A 3DAKA 2ZM1A 5CU4A 3QQKA 4BGGA 1BHHA 1MQ4A 4QP8A 4IX3A 5DR6A 4FKUA 4QSYA 2P3GX 5AR5A 4L67A 1YOMA 4JBPA 2XP2A 4CKJA 4IAKA 1T46A 2CDZA 3VS3A 1F1WA 3HRFA 4BVUA 3ZZEA 4FTNA 4ZLOA 4Y85A 4MTAA 1I09A 3EFWA 3QXOA 3S8LA 3K2LA 2VGOA 2G2FA 4D4RA 4FT5A 1KV1A 5DR9A 3VRZA 4IVCA 1ZYJA 2YERA 3FMEA 4ACCA 3MVMA 5L2SA 3TCPA 4HVDA 5DEYA 3KIOC 2R9SA 3OMVA 4GMYA 4BZDA 4Y72A 3AC1A 3FZOA 3U6HA 3BL9A 1PJKA 1CKJA 2GHLA 5DA3A 3QWYA 3LFFA 3NWWA 5HVKA 3Q53A 2WU6A 2V7OA 2XEYA 2ZB0A 2VTAA 3DQWA 2RFDA 3OZ6A 4RG0A 3UDZA 4GUBA 2OO8X 5F94A 5EG3B 2BAQA 2OIBA 4I94A 3PXKA 4WRSA 1H25A 3LQ8A 4NWMA 5L2WA 4FV4A 4BDHA 4IM0A 5I5ZA 3C4FA 5LVNA 4FKVA 1UKIA 5I9XA 2VWYA 2XK8A 4N6ZA 4YJOA 3TNWA 4TWCA 3DLSA 4DGPA 1SVGA 2DWBA 4L42A 3UVQA 4AWIA 5BVNA 3QTWA 3LZBA 4PPBA 2XANA 3EWHA 4P9ZA