2OZOA

Autoinhibited intact human zap-70
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
612
structure length
545
Chain Sequence
PDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPNMDTSVFESPFSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRNLAARNVLLVNRHYAKISDFGLSKALGPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGGSALEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Tyrosine-protein kinase ZAP-70
publication title Structural Basis for the Inhibition of Tyrosine Kinase Activity of ZAP-70.
pubmed doi rcsb
source organism Homo sapiens
total genus 150
structure length 545
sequence length 612
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ozoA05
1.10.930.10 Mainly Alpha Orthogonal Bundle Syk Kinase; Chain A, domain 2 Syk Kinase; Chain A, domain 2 2ozoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ozoA04
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2ozoA03
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2ozoA01
4APPA 3ORPA 3I0OA 2W9ZB 2YZAA 3VUKA 5I5ZA 2HOGA 2AC5A 4X3FA 3N84A 5BYZA 2HCKA 3CTQA 3DY7A 4GU9A 4A4BA 3F69A 3PSBA 2ZMDA 2PZIA 3QQFA 5CWZA 5M4UA 4F64A 5EHYA 1YOJA 3QBNA 5IEXA 2PVLA 3NIEA 4RT7A 2K79B 2GQGA 5CI6A 3T8OA 3FQEA 3S4QA 3DNDA 4QP2A 4E68A 3UNZA 5BMMA 4FOCA 2GNIA 3QXPA 4UALA 1R1SA 3D5UA 3FI8A 4UMRA 3ZFXA 2XNEA 4PY1A 4H1MA 2YM6A 5H9BA 3R8UA 4MHAA 4BC6A 3U6HA 3BHTA 2E9PA 2Z7SA 3UIXA 2XEYA 2J51A 4I0SA 1JVPP 4RJ4A 3C4ZA 2BALA 3HIZB 4YJRA 4IFCA 5IH5A 5C8NA 4V0GA 2YM4A 2QOBA 1IRKA 3HZTA 3ZBFA 1ZOGA 2Q83A 2X8DA 3D7ZA 3KMUA 2X7GA 4I41A 2PNBA 3B2TA 5GIPE 2QC6A 4BGHA 3MV5A 1BHHB 5J1VA 4PMSA 1CSYA 4X2KA 4OT6A 3ROYA 3HKOA 3UYTA 4U0IA 4JG6A 4XLVA 3WI6A 2VNYA 2PVHA 3TM0A 3HCKA 3VIDA 4CEGA 4F1MA 5HE1A 4JR7A 4CT2A 4FOBA 3R8ZA 2I7QA 4XX9A 2YCFA 3OCBA 4OW8A 4BCPA 4WRSA 3UC4A 5BUEA 4TYJA 2J4ZA 4B0GA 1BUHA 4Y5QA 2FCIA 2YIYA 3AG9A 3GC8A 4DBNA 1SVGA 2PVJA 3D2KA 3FXWA 3H0ZA 4LUDA 5EFQA 2XZSA 3WF9A 3OZ6A 4R7BA 2F57A 2I0VA 2AUGA 2FSOX 3RPOA 3OD6X 1ZMWA 3PY3A 4UBAA 1M61A 3LE6A 1S9JA 4IZ7A 1GOLA 3UOKA 4D4RA 1H4LA 1OPLA 1CSZA 5F95A 3CXWA 1B38A 2GHLA 3ZXTA 3UVRA 5A9UA 4OTWA 2IZVA 3PXFA 3PVWA 4ENYA 5HTIA 4LRJA 4BDAA 2XKFA 4L67A 4TNBA 5ANGA 3P79A 3UP2A 3ZONA 4CT1A 4RPVA 3RJCA 4K1BA 3L9PA 4F9YA 2MK2A 4A4LA 1LUFA 3EYHA 3FKNA 3QQHA 4H58A 4L68A 4NJDA 4NKAA 2GNFA 3Q6UA 2Y6MA 3SXFA 4RWJA 4DINA 4MAOA 3LQ3A 2CIAA 1NVQA 4RJ6A 3TL8A 3ZZWA 4CFXA 2QMSA 1YRPA 3D4QA 3RINA 1CWEA 3RCDA 5LMKA 3R21A 4FZDB 4W4XA 4FKPA 3RHKA 3CKWA 3EKNA 5CVFA 4K2RA 4TYHA 3HP2A 2UUEA 3VQUA 3FQSA 5EQYA 3VBYA 3AD5A 4KRDA 1GZNA 2ETRA 4J1RA 4C8BA 5DR2A 4XZ0A 3RP9A 4G6OA 4MD9E 1WBPA 3BE9A 2WTIA 3MGYA 3IMDA 4ZK5A 3FSKA 2QCSA 2VGPA 2ONLC 4J95A 5JQ8A 3AQVA 1UURA 1BLKA 1O4CA 2W1HA 5EYDA 5I9UA 3LMGA 1JPAA 4FZAB 3S95A 4C34A 4RJ3A 1O4MA 4FEUA 3VS2A 4FUXA 5DI1A 3PJ8A 1FINA 3KMMA 3QX2A 4AOTA 4JIKA 4QP1A 5CANA 4O7VA 2BRMA 2GNJA 4ANMA 4FV0A 4X2GA 4R1YA 3COHA 3VAPA 4ANSA 2FSLX 2GNHA 4RRVA 1WVWA 3TV6A 3ZO3A 3QCXA 3OTUA 4IDTA 4F9BA 5LQFA 2DWBA 1B47A 2ITXA 4F59A 3QZIA 3SDJA 5AUXA 3WYYA 1TKIA 3QA8A 5FXRA 3LOKA 5HVYA 2C3KA 2F49A 5JGDA 2B9FA 3FY0A 1YXUA 4Z55A 4BI2A 4FG7A 3ACJA 4XCUA 2ACXA 4TYGA 3QRTA 4AOIA 2OZOA 4IW0A 4UV0A 5AP1A 5CY3A 3PFVA 3CTJA 4XH6A 1J1CA 2WMWA 2XBJA 4MBIA 4GV1A 2F2UA 2JDOA 3D9VA 2OSCA 4YJUA 2V62A 3PA3A 3QUDA 3B8RA 5D7AA 5E8XA 5CEMA 4GUEA 2GNGA 2R3OA 3TNIA 1VYWA 1U54B 3P7CA 1A06A 1JSVA 4C3PA 4L46A 1HCLA 4EH2A 4GK2A 3VVHA 3QWXX 4ZS0A 5J3XA 3UGCA 1OGUA 4LFIA 2Q0NA 5CQWA 4N57A 1JKTA 5LOHA 4ITHA 2R0UA 3FMKA 4XV2A 4PP7A 4XMOA 4FNZA 3TNQB 3FI3A 2GTMA 1VEBA 4DC2A 2KTYA 4QRCA 4E3CA 3DDQA 3KL8A 2YU7A 3PTGA 4ZMFA 3V8WA 3QKKA 5D1JA 4DGPA 5H8EA 3L9NA 3PWYA 4E6DA 1MQ4A 2XB7A 3GB2A 3QYWA 4G1WA 4QMXA 4CNHA 3TZ8A 3FMMA 4GJ3A 4R7IA 1LP4A 5EW9A 3RKBA 3DJ5A 3FZPA 2EKXA 3CIKA 2MRKA 4EH4A 1NZVA 3I6WA 3V6RA 5E8SA 1OPJA 3PIYA 4U5JA 2VWUA 4LOPA 3QTQA 4FVRA 2Z60A 4WNOA 5CALA 1O4KA 4EY0A 1HCTB 3LCDA 4RC3A 2UW0A 3PE1A 4I6HA 4IFGA 4LM5A 3ZUUA 4F6SA 2AUHA 1YDTE 3LFEA 4PUZA 1JWOA 3F3TA 4O0SA 1UNLA 4MKCA 4FV1A 4F7JA 4FTJA 3GC0A 3Q9ZA 4OTHA 3POZA 3JXWA 1OI9A 3ZO2A 1KE5A 3F7WA 3GU5A 1UKHA 5BMSA 4G16A 4JGHA 4S2ZA 4O6EA 5D9HA 4FIIA 4FZFB 3OV1A 4QMUA 5BVDA 5EM6A 2PE2A 2YAAA 4YPDA 3CWGA 3PWDA 4PMTA 4DITA 5KMOA 3ULIA 4P9VA 5AXIA 5CS6A 3BHUA 3F3ZA 3FDNA 2W1FA 4BWPA 4EK3A 3QQGA 3DKGA 3PJ2A 4I94A 4YZMA 2YCRA 2CHLA 5AM6A 5HG5A 4AN2A 4Y46A 4EC9A 2BRHA 4KAOA 4FBNA 5FQDC 3F66A 1O4HA 5LVNA 1O47A 2JIVA 4BBFA 3BQCA 3LPBA 4GPLB 3PG3A 2JC6A 5CAVA 4KS7A 3MH1A 5LCKA 2IVSA 3ZUVA 5KKRB 5F1ZA 3F2AA 3G51A 2X8EA 3TNWA 2YLEA 2QHMA 3IGOA 2IVTA 4IBMA 3ITZA 4NSTA 2J7TA 2G01A 2RF9A 4EC8A 1O4AA 3PVGA 1M52A 2JDRA 5A4QA 5CXZA 4X6SA 3UO4A 4ASDA 3W55A 1WAKA 2GS7A 5C1QB 1ZWSA 1HCKA 4CCBA 4C4EA 3QL8A 4JQEA 3DBCA 4ACGA 3R7VA 1R0EA 4EOMA 2EXCX 3QCSA 1G8AA 2FH9A 5BQ0A 2ZAZA 2E9UA 5A4TA 4O7NA 3QQLA 4DH5A 4WIHA 1YI4A 3PZEA 4ZTSA 1YVHA 2BUJA 2UW4A 2Q0BA 4GH2A 5KHXA 1H9OA 2QKRA 3EQPA 1XH4A 4NWFA 4GSBA 5CF6A 3FZTA 3RZFA 2QU6A 2IVUA 5CXHA 3VS3A 2BDWA 3KXMA 3FEGA 1FMOE 3F7ZA 4UN0C 1PHKA 2DYLA 4O7SA 1IR3A 4QQ5A 4U3ZA 4C61A 1O42A 1S9IA 1UNGA 4QTDA 4CSVA 3OCTA 5CF8A 3G6HA 4L01A 4QPSA 3B2WA 5DOSA 5GJGA 1WQUA 3Q53A 4NFMA 3D7TB 2UW8A 3EN5A 4JQ8A 3FPQA 1A08A 2RL5A 4E8AA 1X8BA 1Y57A 2C5VA 4WUNA 4IADA 4ZTRA 5HE3A 1KE7A 5EDQA 5HNGA 3SQQA 4B4LA 1BL7A 4ZSGA 4KKHA 1OL7A 2EB3A 4U6RA 3FHIA 4CZTA 3OT8A 2PHKA 4BR3A 2XIKA 1KWPA 4YLJA 4GL9E 1URCA 4RX8A 4YSJA 1KOBA 2OIDA 4A06A 4H1JA 2PMIA 4EH8A 1WBTA 2VTIA 5EQEA 1RE8A 3SG9A 4X3JA 2QG5A 1CSNA 2VTLA 3RPSA 1LUMA 5D41A 3KXXA 1Q8TA 3EQRA 3QU0A 2WMXA 4AFEA 4ENXA 3UNKA 4M0YA 1MILA 4EHZA 2PZ5A 4XP2A 3KB7A 4USFA 4EHEA 2F2CB 3RVGA 2UW7A 4HNIA 4TY1A 3VS0A 2WMAA 2XIZA 2HUWA 3Q3BA 3F5GA 4CXAA 3BU3A 3R22A 3RI1A 4BVUA 5EKNA 2VWYA 2PUIA 3AMAA 2J9MA 4R5YA 3CD8A 2OIBA 2UZNA 3K3IA 1D4TA 2RSVA 4WO5A 2YLFA 4HOKA 4EOSA 3W2PA 3MIYA 5A6NA 4I0TA 4F9CA 4EYMA 2VWVA 2GNLA 2OZAB 2P0CA 2C3LA 3PYYA 3GQIB 4PX6A 1RQQC 1ZOEA 3O7LB 3LMIA 1BLXA 2V0DA 3MTLA 5K0XA 4QP6A 3VUIA 2BFXA 2XUUA 3I79A 3SGCA 4AN3A 3H30A 1YXSA 3I6UA 5DEWA 1PMVA 3UO6A 3QA0A 3CS9A 4N70A 4F9AA 4GYIA 1ZAOA 3KULB 2B0QA 3PLSA 4GS6A 4IZYA 5BVFA 4BDKA 5KBQA 3DPKA 2BHEA 5IDNA 2O65A 3BI6A 3MJ2A 2UZDA 5GJHA 4L42A 2XKCA 3DQXA 2ITNA 3E8DA 4OTIA 4FSRA 4OT5A 5EHOA 3WF7A 1SNXA 4F0IA 3UP7A 3HAVA 4AZVA 2YFXA 4AFJA 3PXQA 3RPYA 3QZHA 4CG9A 1KE8A 4BDGA 2IUHA 5CF4A 5FEDA 3R0TA 3KXZA 4CMOA 1V0BA 3C50A 5FWKK 3R7UA 1XBAA 3BELA 5IU2A 4W8DA 4I5MA 4EYJA 4WHZA 1KA7A 2HMHA 4EOQA 4G3GA 3C5IA 5C9CA 2VIFA 3HMIA 3OB2B 3OOMA 4J97A 2VU3A 3MPMA 3LXPA 3EZVA 3MH3A 4XV3A 2OH4A 1EH4A 5K5XA 2ETMA 3R7IA 5KNJA 2C69A 3UE4A 4ZZMA 2H96A 3NYVA 4ZSEA 5FDXA 1YDSE 2WQOA 4ZSLA 4L3LA 4C2VA 3C0IA 3G0EA 3QX4A 3W10A 4JAIA 4Q9SA 4F1OA 4ASEA 3EQFA 5IG1A 4RC4A 4UMPA 2FB8A 1JLUE 1PXNA 2W0JA 2PK9A 3U9CA 4EOKA 4XEYA 3F5PA 3PP1A 5IF1A 2XIXA 3VS1A 3TUCA 4NL0A 1Y6AA 1NZLA 5BUJA 3LCOA 5AADA 2C6MA 3QQJA 3OF0A 5AV2A 2ETZA 3OBGA 2B52A 4X3FC 4PF4A 3U6IA 4FTKA 3F2NA 4P4CA 4U17A 3ZSIA 1U5QA 3K3JA 5EW8A 3A2CA 5AR5A 4DCEA 3NS9A 4V05A 2CPKE 1CTPE 2FYSA 1H01A 3NUNA 1NRVA 1XBCA 2G15A 4FV8A 2WEVA 1U5RA 3NYOA 3Q04A 3W16A 4D1ZA 3VRZA 4FTAA 3VUGA 4O7TA 5IUHA 4CKIA 1PMUA 4YC3A 5HNBA 5DWRA 1ZOHA 4WD5A 3EZRA 1Z57A 3GCVA 4JS8A 2REIA 4Z16A 1PXPA 3QLFA 1O4JA 2WMQA 3V51A 3NX8A 4O0WA 1OVEA 3GVUA 1CWDL 4RWLA 3VWAA 4CGAA 2CRHA 2HDXA 4MD7E 1Q4LA 4YTIA 4QO9A 3H9FA 5CSXA 4FV3A 4I5CA 4KB8A 2JDSA 5D12A 3SD0A 4ANOA 4ZY5A 1NXKA 1Q24A 3GCPA 3HVCA 2PLDA 3OWLA 5E92A 4AGCA 3R9RA 4KINA 4IVBA 3VHKA 4LRMA 3A7IA 4CKRA 5FD2A 1AYCA 4OHEA 5LCJA 3LJ1A 2OIQA 4S32A 5I9VA 4O84A 1Z9XA 5CSPA 4BKJA 4C02A 2QG7A 1R0PA 4Q5HA 4IAAA 3NW5A 5CT0A 4ZXTA 3Q9WA 4LGDA 2G1TA 1PXJA 3BRBA 3QC9A 3UNJA 3ZLWA 1HOWA 4YTCA 4FSYA 4O22A 3U9NA 4PDYA 3P1AA 3LM5A 4PTGA 3F6XA 3SRVB 2WELA 5HE0A 2PVNA 1XH8A 3GQLA 4W9XA 4MVFA 2PMNX 2UVZA 3UYSA 1XQZA 3JY9A 3FZOA 1W8CA 2BVAA 2RFSA 2YJRA 4RFYA 3S2PA 2R3FA 3CGFA 3O96A 4GT3A 4AN9A 5K5NA 1F5QA 5IQIA 2XS0A 2XKEA 4BDJA 2GHMA 2HY81 1WVYA 4Y83A 2Z7QA 4EUTA 2FO0A 2OJGA 2WAJA 4RJ5A 4ZOGA 3V01A 5KMLA 1W84A 4FMQA 2H6DA 3MS9A 4EH7A 5E7RA 2PULA 4NWGA 2CDZA 1JAMA 4OGRA 2JFMA 2WNTA 4ZTHA 4HGTA 3FLWA 5KCVA 1XHAA 1LCJA 2OXDA 4K33A 4JAJA 1AD5A 1FQ1B 2EB2A 2C5XA 4M84A 5AV1A 4JE4A 3FL5A 4RX9A 2PZYA 4ARKA 4D0WA 4HVHA 5AA8A 5IZFA 3RAKA 2EO6A 4CKJA 4CZYB 3TDWA 4L1BB 3IN8A 4OAVB 3G5DA 2Y1NA 4CZUA 4GK3A 2JBOA 2QODA 2EU0A 1OKZA 4H05A 4FKGA 4IZ5A 4C3FA 2VZ6A 5HD7A 1ZZLA 5FRIA 3BUOB 1M7NA 3D14A 4KS8A 4YU2A 4C37A 4U45A 5BYYA 5DEYA 4ERWA 5E8UA 3HHMB 3DB8A 1GIJA 4FKVA 1DAYA 1YXXA 3Q9YA 4JBOA 3ZHPC 2CJMA 4F4PA 3FQHA 3Q4CA 1Q3DA 4E6CA 3TV7A 3BUXB 1KC2A 3GI3A 2QOKA 5CVGA 3NUUA 4QOXA 1YDRE 2F9GA 3CJFA 4MWIA 4YC8A 3ACKA 3PY0A 5FEEA 2NNWB 4EHVA 1QADA 4EQMA 5JSMA 3IOKA 5CI7A 5IMXA 1H25A 3EL8A 1IAJA 4FTLA 1A1BA 3QGYA 5HG9A 2YM8A 4YJNA 1AOUF 4NW6A 4U3YA 2GDOA 3QD2B 3R28A 5C27A 2JGZA 4Y8DA 4RA5A 3O23A 4BDEA 3UOJA 2L3TA 4BYJA 1L3RE 4IVAA 4FG8A 3VUDA 5CASA 4QQTA 2XJ0A 3UQCA 5EM5A 1O4LA 3NNUA 1YI6A 3QCYA 5I4NA 2VTPA 5EDRA 4RZWA 2W1GA 2C5NA 4S33A 3GQIA 3IKAA 4BCHA 4O27B 4ZTMA 4LV8A 1G8SA 5EQPA 4CG8A 2K7AB 2W1ZA 3GGFA 1LEZA 3MPAA 2XJ2A 4CFNA 4ZMEA 5FTQA 3VBTA 4BKZA 2BKZA 4IJPA 4DFZE 2WKMA 4N6ZA 4H3QA 2CNUA 3OWPA 4HGEA 2MRJA 3KY2A 3R2BA 4FKTA 3CTHA 4QPAA 4BDIA 3KULA 4A4XA 4YP8A 5HLNA 3D5XA 1FU5A 3L8SA 5AR7A 4QYHA 3BZ3A 4A9YA 3DBFA 1BX6A 4DT8A 5DT0A 2OI4X 2CSNA 1GAGA 4U9AA 1CKPA 2BCJA 2P55A 4JBQA 5E1SA 4AX8A 2Z7RA 5CU2A 3RM7A 3NW7A 3FXXA 3MTFA 4CRLA 4W9WA 4OTDA 3MB6A 2BIYA 4ZLOA 4MXYA 5IQCA 4OTRA 4X21A 2JKQA 2E9VA 1Q8WA 3GFWA 3N7YA 2R3GA 4LGHA 2PUUA 1UNHA 1JYUA 5KX8A 1Q3WA 2NPQA 4DHFA 3NVKI 3UYOA 4IQ6A 2J90A 3G90X 3I81A 3TL0A 2CI8A 4AU8A 4FKSA 4QMQA 2R3KA 3TN8A 1FPUA 4EH9A 1OL5A 3P23A 5DMZA 3FLZA 4I4FA 3DGKA 3LIJA 5EHPA 1A09A 4XG6A 3E64A 4DE4A 4NWMA 3DXQA 3LXKA 2CGUA 4LL5A 4UMUA 4JQ7A 1E1XA 5DC4A 5FP6A 2UZTA 4YNEA 3DK3A 4NK9A 4BCGA 1UU9A 3ZC6A 3UO5A 3BGPA 1J7IA 1BMBA 4MXAA 3UOHA 2WTKB 2GSBA 4OHIA 1OB3A 2JKKA 2UZLA 3EOCA 1X6CA 3BEGA 1J7UA 1P4OA 4L3JA 3R73A 4TTHB 5G6VA 3VF8A 1BKXA 5BYLA 4D0XA 4RFMA 5E8YA 5ITAA 5L8LA 3OB1B 4K18A 4X0MA 3RWPA 4AW2A 5DN3A 3ZU7A 3AC4A 4EBVA 5BVNA 3BKBA 5CSWA 4FIGA 3VGOA 4RIYA 4CQEA 4MK0A 3NCZA 4AZWA 1Z3KA 2Z8CA 3R71A 3W32A 4YZ9A 5LVMA 4P9ZA 4L45A 1KV2A 3JUHA 1WBWA 2GSFA 2ZM3A 3PSCA 4KD1A 4NFNA 3UODA 2PYWA 4GKHA 5AP3A 3W2QA 2VV9A 3CGOA 3FLNC 1MQBA 3CCNA 4O86A 2A1AB 3AT4A 5FEQA 4PV0A 1F1WA 3TKZA 5B7VA 3A99A 3QAME 3QGWA 2XK9A 4YZDA 3MXYA 2VUWA 4ZS4A 5CYIA 1CKIA 3BV3A 3RNYA 2PZRA 3CQUA 1XH7A 3UG1A 3D2IA 2XNPA 4M8TA 2QKWB 4UWYA 3ZXZA 3D0EA 3OCGA 3D5WA 4OR5A 1FOTA 3BLRA 3AC8A 4QTCA 4QSYA 1K3AA 2C4GA 3BYUA 2IZSA 4DT9A 1REKA 2X4FA 2XK6A 1LKKA 3ORNA 2NRYA 2BAKA 4GFMA 4FT0A 5HG8A 5DLSA 1O4EA 4IAFA 2PTKA 5A4EA 1O44A 4O38A 3F9NA 4ANBA 4PDOA 5J79A 4MQ1A 3W8LA 4BDDA 4D1XA 3TKUA 4P90A 4PL3A 3ZRLA 1AOTF 2XNOA 4HPUE 4QP7A 3VJOA 4FKUA 2RG6A 3TIYA 5HEZA 3A61A 3V5PA 3W2CA 4CFWA 5HLWA 3COMA 5CU3A 2ZVAA 4JR3A 4KRCA 3BPRA 2WTDA 4MTAA 5IA2A 2JIUA 3PUPA 1G5SA 1Q97A 3F5XA 5M44A 4KIPA 4FTCA 2BRGA 1W0XC 2WQMA 3NNWA 3PG1A 4FL2A 2BZJA 3UDBA 4FTMA 4IM0A 5HIEA 3RALA 5H8GA 1FGIA 1Y8GA 2FSTX 3E87A 1KOAA 5EDPA 5KMJA 1O41A 3SRVA 1NW1A 2Z2WA 3EQBA 3U55A 3HMPA 4FTTA 1OMWA 4C4FA 4O82A 2ZV7A 4NYEA 3UPZA 3NHNA 3R9DA 1R1QA 1NY3A 3RAIA 3R1NA 3Q2MA 4ZLYA 4A9RA 1U46A 3VJNA 5HX6A 2V5QA 5KMNA 3C4XA 2E2BA 1BLJA 3PZHA 2B54A 3UPXA 2VO0A 2XVDA 3PE2A 4BTFA 2HK5A 1BL6A 4LMNA 3V6SA 3ZNIA 3UVQA 4EOLA 3OFMA 4EWHA 3DFCB 5DE2A 3LKMA 2JAMA 4UZDA 1Q41A 3EIDA 2OH0E 4W8EA 5DT3A 3NNXA 2QVSE 3F5UA 2YITA 2EUFB 4MNFA 4UY9A 2H5KA 5KHWA 4I5PA 4ANQA 3VRNA 3G9LX 3BBTB 4DN5A 3VROA 3C7QA 4R3RA 1TQMA 3OWJA 4XBRA 2O0UA 2UZUE 3C0GA 3SKCA 3NNVA 1NA7A 4F08A 2QOQA 2QO7A 3PPJA 3QTWA 3LFBA 4FVPA 4U97A 2C5OA 5JRQA 2O63A 3KEXA 2J2IB 4I6FA 3GC9A 4AE6A 2A4LA 1KV1A 3OCSA 4L44A 4O0TA 4H1OA 2AOBA 5HCXA 2ECDA 3WBLA 3IONA 3TIZA 3R8MA 3P78A 2QI8A 3NMUF 4BZOA 4GFOA 4XP0A 2W1DA 3ET7A 3RK7A 3R2YA 3TG1A 2ZM1A 4BL1A 4ZY6A 4AGDA 4J53A 3KXGA 1H1SA 1K9AA 1OZ1A 2UZEA 4DFXE 3A7GA 5F4NA 5T6KA 5IEYA 2R3IA 4JNWA 4ACDA 1O4OA 3QWKA 3UBDA 4XOZA 2VAGA 5L2SA 3BLQA 1URWA 2JKMA 3WZUA 3O8TA 3BBWA 3F82A 4WG4A 2ZB0A 1H24A 1KA6A 1FVVA 3S0OA 2ZJWA 3FSFA 3OW3A 4RVTA 3BCEA 1SHDA 3ZYAA 2CN5A 2R3LA 3KN6A 1PICA 5ANJA 2P2IA 4UYAA 3MVLA 3QALE 2ITTA 3VNTA 1ZFPE 2FUMA 3MPTA 5CZIA 4GEOA 3HUBA 1W7HA 2UZVA 3ZS5A 4U41A 5HOAA 4E5AX 5CAQA 4EQCA 1ZRZA 4BKYA 3WIGA 5DG5A 3ZSHA 2J6MA 3R1YA 5FG8A 3IDPA 4LMUA 1JU5A 4TWPA 4YZNA 1J91A 2V7OA 3G2FA 5KE0A 1WBSA 4YURA 5ICPA 2YJSA 3U4UA 4TN6A 3ZMMA 4FSWA 4NW5A 5FXQA 4G17A 4YJPA 2LNWA 5CT7A 4WG3A 3VS6A 2CCIA 2LQWA 2IZTA 4G9CA 2JIIA 3VS4A 1A07A 4IC7A 4YMJA 3VS7A 1BI8A 3AGLA 4FIJA 5CU4A 4JX7A 3CQEA 2DVJA 4IX6A 4I3ZA 4JI9A 2XIRA 4UYNA 4OLIA 3LAUA 2OLCA 4I20A 5JQ5A 1XJDA 4EZ3A 3QUPA 4B6LA 2OF4A 4RWIA 2GTNA 4I6QA 4D2PA 5HU9A 2OU7A 1PXIA 3KRRA 3UIMA 5LWNA 1OUKA 4IHPA 2UZWE 2PNAA 4U80A 3VN9A 1REJA 2JYQA 1H27A 2F7XE 4FYOA 3UIUA 3E63A 4YTFA 4FE2A 3LFNA 1H00A 2BR1A 2RORA 3CPBA 3E3BX 4L52A 4CV9A 4FTQA 4PDPA 5J5TA 1WCCA 3LFQA 3HDMA 5BVWA 5FLFA 4FVQA 3TZ7A 4FKRA 3N9XA 4M66A 3QTZA 2P33A 4HVSA 5JMSA 3GCUA 3PIZA 4YJVA 3OY3A 4HZRA 4RX5A 3FKLA 5HVKA 3WZJA 3HAMA 3JR1A 1SMHA 4IWQA 2IVVA 2PY3A 3I5NA 4QMVA 1O4PA 4MCVA 5AJQA 5J1WA 4FEXA 1M2RA 3AD6A 1M27A 1PMNA 3M2WA 2G2HA 2QD9A 3PJ3A 2EYZA 3EFWA 1KE9A 3BYOA 1Y8YA 5CEKA 1PMEA 3SW7A 4A7CA 4H3BA 3IQ7A 4CMUA 2I0YA 4XG7A 2X39A 2YCSA 5E8ZA 1OL2A 1R3CA 2GFCA 2ITWA 3BLHA 3DLSA 4M12A 4XG2A 3THBA 3QWYA 1AYAA 3OHTA 5B2KA 3LFDA 3O2MA 1DI8A 2Y3AB 2HW7A 1FVRA 3I7CA 2C0OA 3C4WA 1WVXA 5T68A 3IN7A 3LXNA 1I3ZA 2OWBA 1YHVA 3MH0A 5AUWA 2I40A 3ZBXA 2XM9A 4RVKA 4U40A 4CQGA 3F3UA 2A19B 3OUKA 2VWWA 4RLLA 5AV0A 1H07A 4BCIA 3MVHA 1GHUA 2R7BA 4O6LA 1GIHA 4W4WA 5ETFA 3S3IA 4YGAA 3LLAA 3WF6A 3TKIA 1OPKA 2IUGA 4CFFA 2Y8OA 5IA3A 2AYPA 4RBLA 3BEAA 5K0KA 5LJJA 3AD4A 2YERA 1STCE 3WF8A 2EU9A 3Q6WA 2LQNA 3WE8A 3H3CA 5EELA 1B39A 3FE3A 1U4DA 1QCFA 1WFCA 3R02A 4QTBA 4S30A 5KKRC 3VULA 4RC2A 4U1PA 2RSYA 4L3PA 3DAJA 4K9YA 2UZOA 2YM5A 4D2WA 2IPXA 1ZY5A 5IQGA 4ASXA 1V1KA 3VUTA 4U44A 2BDFA 5K9IA 5AA9A 1BKMA 2X7OA 1X0NA 3QYZA 4DH8A 3E3PA 4YHJA 4DFUA 1BF5A 4FTIA 4FC0A 5M4IA 2OO8X 2YIRA 3V5QA 1SVEA 2B1PA 2R3HA 5JN2A 4F5BA 3KFAA 3SW4A 4YSMA 4C59A 4CCUA 5JZJA 2UW5A 5JZNA 1FU6A 1FBVA 5TF9A 3NWWA 4RX7A 4DGLC 2P2HA 3KA0A 2XKDA 3U8WA 4ZTLA 5L2QA 2WB8A 2C68A 2OGVA 2I0HA 3HV4A 4O1PA 5D10A 2QLUA 2OJ9A 2IW9A 4IX4A 5C26A 4DF3A 4WSYA 5IISA 1GJOA 1R1WA 2ITOA 3AT3A 3HRCA 4IB1A 4Z3VA 4LV5A 3UOLA 2CS0A 3DS6A 4BWKA 1YHSA 3FL4A 2I0EA 4J71A 4D8KA 4JBVA 3OXZA 4IACA 3U87A 1MW4A 3EQCA 1IAHA 4XS2A 4GRBA 1O46A 2HDVA 2JEDA 5FP5A 1W83A 3P08A 3ANRA 2EXMA 5AP6A 1VR2A 4DEIA 3PJCA 2YZLA 4G9RA 5IQHA 4B9DA 4ZAUA 4QMYA 3DTWA 3HUCA 4MD8E 5I9XA 3MJ1A 5EI2A 5KAZA 3EN7A 2L4KA 4F1TA 3IK3A 5DA3A 5I9WA 3R6XA 4FTOA 5AULA 2J50A 3FY2A 2BBUA 5A4LA 3KRLA 4M97A 2JITA 2WFYA 2C0TA 4NU1A 3RBWA 4KIOA 4M15A 4A9UA 3MB7A 4EEVA 3FZRA 5BUIA 5M56A 1YWVA 3MY1A 2HY0A 5L2WA 2W9FB 2KNOA 4F65A 4IWPA 1PJKA 3WZKA 2LGCA 4FSZA 3NLBA 2XYNA 4UEUA 4H36A 3SC1A 3L8PA 5EYMA 4EBWA 5AM7A 4M0ZA 1Q8UA 2VTHA 2CN8A 2VTOA 3OC1A 1ZXEA 5DPVA 5E8WA 4F63A 4KKEA 1O4IA 1V0OA 2WHBA 4IE9A 2WIHA 3ALNA 3O0GA 3G15A 3O17A 1H26A 4ZTQA 5AWMA 2O64A 3F61A 5BVOA 3PA4A 2XK4A 4ITIA 2XF0A 2C6OA 4JDIA 3TZ9A 4HVGA 4M67A 3MXCA 3TUBA 3S9KA 1QMZA 3CLYA 5GIOE 1VZOA 3E88A 5H3QA 3ORTA 2VRXA 3MY5A 1XBBA 1WBNA 5HBEA 2CKQA 3CSVA 4DFBA 4U8ZA 2OQ1A 1YXVA 3HRBA 3MDYA 4NJ3A 2X6DA 4C4GA 4I1ZA 5CQUA 1IJRA 4WUAA 5E90A 3FBVA 3W33A 1H28A 4XRJA 4B99A 4F7NA 5IEVA 4OTFA 3OBJA 4DH3A 2B3OA 4F6WA 2OJFE 4CLIA 3A8WA 3DLZA 4TYEA 3NDMA 3FPMA 4GWFA 4MXXA 5AR2A 4OHLA 1KSWA 4NM5A 5AUZA 3NW6A 2X9EA 3IW7A 4I92A 4KWPA 2F4JA 5E8VA 5HD4A 5HNIX 2ESMA 4ITJA 5AP5A 5CU6A 4FV6A 4BIDA 2EYYA 4F0GA 5DR6A 4RIWA 1UA2A 3EFKA 4I0RA 3W2SA 4AUAA 4X6RA 4GG7A 4B8LA 3UIBA 4EOPA 2XRWA 1B6CB 3COKA 3EQDA 3GCSA 1PYEA 3MA3A 1GNGA 3NUSA 3QZGA 2O8YA 3ENHA 4PP9A 4FT9A 4R3CA 1YOMA 2CNVA 1A1CA 3HL7A 4JDHA 3IW4A 4JRNA 4RQVA 1M17A 1SPSA 5GJIA 3TKHA 3KMWA 5D7VA 1PKGA 4RIXB 4K6ZA 4WBOA 2WU6A 2RMXA 4O7ZA 3UMWA 2QOCA 3K5UA 4UX9A 4BCFA 5GZAA 3ID6C 1O4NA 1OUYA 5HHWA 1P5EA 3JVRA 4PPAA 2GPHA 3QCQA 5HVJA 4DA5A 4QTAA 5HICA 4JX3A 2XCKA 1OKYA 3R00A 5JGBA 1FHSA 3ORZA 4G5JA 1UU7A 2WQEA 2QONA 3KK8A 3CR0A 2IWIA 3K54A 3KXHA 4FV5A 3ZLYA 3FC1X 5I3OA 2ITYA 4LQMA 2ZV2A 3R8PA 1ZY4A 4RIYB 3LXLA 4JG7A 1O6LA 4I22A 3EFLA 3K5VA 4IIRA 1MRVA 3MFUA 2ITQA 2WOUA 3NYNA 4TPTA 4BRXA 5M4CA 1BHFA 5JH6A 3PXYA 4NEUA 4M68A 3QTIA 3A62A 1OM1A 5A3XA 5CU0A 2BIKB 2O2UA 4RA4A 4WG5A 1KE6A 4RSSA 4UMQA 4BGGA 5IMEA 2YACA 3QD4A 4FTRA 4RQKA 2ITPA 3V8SA 1A1AA 4BDCA 5DYJA 4IJ9A 3T3VA 5CSVA 3DKOA 3MA6A 5E91A 3GCQA 2VWZA 2ZV9A 4KIKB 2PL0A 1XR1A 3L8XA 2HWPA 2Z7LA 3OVVA 4JLCA 3EJ1A 3TJDA 3NZ0A 3Q52A 4NM3A 2WMSA 3OROA 2IO6A 2OFVA 2H8HA 5H8BA 3KCFA 1Q99A 1HCSB 3R1QA 5HO6A 2XH5A 3OMVA 2OJIA 1MP8A 2X1NA 5FUTA 2B53A 3HA6A 1IA8A 5C8MA 4AT3A 5KMMA 3AXWA 3I7BA 4QD6A 2YM3A 3QKLA 2C3JA 2LAVA 3D83A 4BWXA 2PE0A 4QP9A 4G3CA 1FBNA 1FBZA 4OTPA 2XNNA 3C51A 3DZOA 3F3WA 2J0KA 4J98A 5AP7A 1GY3A 2NRUA 5LVLA 5B2LA 4JT3A 1O6YA 2YAKA 3PIXA 1WBVA 1A48A 4FKIA 1AB2A 3VBVA 3DXNA 1BI7A 3Q96A 1YW2A 4S34A 3JPVA 5TE0A 3ZLSA 1X27A 3EHAA 3UMXA 2MC1A 2R4BA 2P3GX 2HZ0A 2W99B 2JDTA 1MRYA 4M3QA 3AC5A 1OIQA 4XLIA 5J87A 4DEDA 4EI4A 3DXPA 4IAIA 4FEWA 1XWSA 2OFUA 5HI2A 5DC9A 2A2AA 5AUYA 5A46A 3RZBA 2EXEA 4D5KA 3QUEA 1JOWB 3VBXA 3LW0A 4HYIA 2WO6A 4C0TA 3C0HA 5C4KA 1M7QA 3GP0A 4DH1A 4YJOA 2CKPA 1A81A 3ORLA 3DAEA 4CMTA 4QMNA 4R5SA 4FK6A 4DTKA 5HIDA 3N4VA 1UV5A 2OJJA 3QQKA 4J8NA 3EN9A 4UXLA 3V5TA 3A7HA 4J96A 3VRPA 3Q9XA 3IDCA 3I4BA 5DRBA 4GL9A 5EM8A 2Y4IB 3B8QA 5K3YA 2GFSA 3VRRA 3V04A 1H08A 2OXYA 3MWUA 4XG3A 1DAWA 2C6IA 4Z7GA 5BX0A 3KK9A 4L6QA 4YO6A 2HELA 2ZOQA 4APCA 3C13A 4YLLA 1FMKA 3ETAA 4CLJA 4Y72A 4KKGA 5AV3A 5FTGA 1E9HA 1A9UA 3HMMA 3K2MA 1ZYCA 2RFEA 2ITZA 4XV1A 3TCPA 3IGGA 4TZRA 4FGBA 4Z9LA 5LMKC 4X6QC 4NIFA 1Q61A 3ULZA 2GQRA 3M42A 5ACKA 4FT3A 4B7TA 1BMKA 3DK7A 4X2FA 3BHVA 1PXOA 5M55A 3LCSA 4BFMA 2RKUA 3C1XA 4PNKA 5KZIA 3E8EA 4ORKA 1PXKA 2JAVA 3EMGA 3G33A 4EK4A 1O43A 3I5ZA 3SAYA 2Y7JA 2BZIB 5I6VA 3KN5A 4MWHA 3UF4A 2A27A 2BMCA 4UZHA 5ANKA 4R78A 2CI9A 4E5WA 4OHHA 2CMWA 1UU8A 3ODYX 3ELJA 3V5LA 3ROCA 1XH6A 3KXNA 5BNJA 5DHJA 3CXLA 2VX1A 4F70A 2G2FA 5EW3A 1ZMVA 3Q4ZA 3ZDUA 3FMNA 4BI0A 2ETKA 4AA0A 3EACA 3RMFA 1BG1A 3DK6A 4FL1A 2GS6A 3QKMA 2WEIA 3OG7A 4WBBB 3ZLXA 4BTJA 4EH3A 3VUHA 4BTMA 3DBDA 3C4EA 4BY9E 4FG9A 1PKDA 2FGIA 2XK7A 4EONA 1LUKA 3TZMA 1OO4A 4JOAA 3HX4A 5AP0A 2HENA 3W2RA 3BGQA 2VD5A 3BWFA 3NUPA 5AR4A 5IBSA 2EL8A 3II5A 4NCTA 4TWNA 4EZ5A 4RVLA 3HV5A 2J5EA 2BAQA 4YNOA 4PDSA 2HZNA 2PLEA 4QQJA 4N6YA 4ERKA 4HGLA 4EHGA 3NAXA 4JJRA 4USEA 4I5HA 3PXZA 4WT6A 5D0JA 1I09A 5GJDA 1J1BA 2L6KA 3QHRA 2IW6A 5IA1A 4HCUA 2CGXA 2OBJA 2VTTA 2UVYA 2PMLX 4OAUC 4DCAA 1GIIA 5TO8A 2CBLA 2J0MB 4NZWB 3RPVA 5GJFA 4PL4A 4ACCA 3VUMA 4OBQA 3HV7A 1D1ZA 2IUIA 4BTKA 5DC0B 2VWBA 3KRJA 5ANOA 5LXMA 4U81A 5JRSA 5M57A 3VBWA 2V22A 2PVFA 5HESA 2CGWA 2WTKC 1VJYA 4DGNA 1RQQA 4DLJA 4PNIA 4AZEA 3FLQA 3HA8A 4RIXA 2YIWA 4FSUA 3WARA 4BIBA 5HORA 3CD3A 3JVSA 4L9IA 5KO1A 5TKDA 1PRYA 3DKCA 3OP5A 1K2PA 2I1MA 3VC4A 1TQPA 2R5TA 2WU7A 1WZYA 3LLTA 4IM2A 4W4YA 2PSQA 4M13A 5CVHA 2VTAA 4ANLA 3R7OA 2CR4A 1PF8A 4D2VA 2BKKA 4YZBA 4HCTA 5EHLA 5CAPA 2E9NA 3FYKX 3MAZA 1H1PA 3C5UA 3LFSA 2QU5A 3PVUA 4DGXA 3LQ8A 2YWVA 4IX5A 5HTCA 1LPUA 4WKQA 5L2TA 4O7YA 2QOOA 2ZM4A 4FKWA 3RGFA 3S8OA 5IUGA 4E4NA 5I9YA 2PUNA 2UW9A 3R7GA 4FIHA 4YHTA 2H9VA 2PVMA 3CEKA 4AZTA 3SOAA 4ZSJA 3EB0A 5L8KA 4Q9ZA 1JKLA 3PVBA 3HNGA 3IPHA 4AP7A 4DGOA 5ACBC 3N4UA 5CEPA 4F0FA 5HX8A 3HP5A 4D5HA 4WNKA 4ZTNA 4GW8A 5AUUA 4F5AA 4D2SA 3BYMA 3KFJA 4KIKA 5CX9A 5KZ0A 4O91A 3W2OA 4EORA 1M2QA 5BO4A 2WMRA 4IB3A 3MFRA 2NP8A 2QHNA 3MN3A 3S00A 3NEWA 3E5AA 4MEDA 4FICA 2WXVA 3KVWA 3QC4A 5IH6A 2R9SA 3JS2A 3R30A 4CYJA 3OP0A 4JVGA 4KUJA 2UV2A 3FV8A 2WZJA 4ZZOA 1APME 4I21A 4IZAA 2EYVA 2V55A 3OS3A 3G0FA 3HLLA 5EYCA 4ZP5A 2JDVA 4MQ2A 1O49A 4ZJIA 1YVLA 2GS2A 4QMZA 4YBKA 2WMUA 3BE2A 4AGWA 3R9HA 4DEHA 2R3PA 2ZV8A 5ANIA 4EZ7A 5CEOA 4WNPA 4E5BA 3DQWA 4O0YA 4BBMA 5J5SA 3U6JA 4C4IA 4BDFA 4V04A 4DTAA 3ZSGA 4MXZA 2X2LA 4G34A 2W4OA 2X2KA 4BF2A 5CDWA 4YZCA 4BYIA 2R3NA 3AT2A 3GOKA 4UMTA 4K11A 3GENA 2W5BA 3QD0A 4IEBA 3IS5A 2UVXA 4K44A 4I4EA 1XA6A 3EL7A 4IWOA 4IMYA 4TL0A 4J7BA 1O45A 4L00A 1CJ1A 5IKWA 1Z5MA 4O0UA 5CEQA 4TW9A 4FNWA 4A9SA 3E8CA 3NIZA 3ZRKA 3WZEA 4BZNA 5M07A 4UB7A 2B9HA 2VWXA 4DGMA 2UZBA 1H8FA 2PVKA 1NVRA 2QO9A 3OW4A 4D1SA 4CTBA 4EL9A 5JGAA 2A0CX 4FF8A 1JSUA 3LCTA 2WTVA 4XOYA 4AZFA 3ZC5A 4YR8A 2H46E 4PPCA 5E9EA 2PVYA 4AACA 4QMSA 4AZSA 1DI9A 1GZKA 4JBPA 3O8UA 2WMVA 5CTPA 4XV9A 5FBNC 2HW6A 4JIAA 3R9OA 2EVAA 2HXLA 4C36A 2XK8A 3BV2A 5IQAA 4E93A 5E4HA 2HZIA 4GFGA 2YIQA 4EKLA 2YDKA 4L7SA 3PXKA 4IXPA 3COIA 4HYUA 3FXZA 5CEIA 3VW8A 3ZCLA 4ACMA 4E6AA 3P7AA 4G3EA 5I9ZA 2VGOA 3NVMB 1UWHA 1F2FA 5M51A 3TI1A 1UU3A 2ZB1A 5L8JA 3A7JA 3R9NA 2W4JA 4K8AA 1Q8YA 3H9RA 3VBQA 3ZFMA 4MNEB 1GRIA 4CD0A 3M7FA 2DX0A 3JY0A 1YWNA 4XG4A 2WIPA 4LRKA 4QQCA 1SKJA 1Y1UA 4CFMA 3LFFA 4XYFA 4G3DA 4AT5A 4C57A 3L8VA 4CFVA 3PXRA 3QTSA 4AQCA 4D28A 4EK8A 3T04A 2JBPA 2AC3A 3D5VA 3R01A 4FR4A 2GCDA 2BFYA 4E4MA 1JBPE 5A54A 3FWQA 3PJ1A 4AW0A 2VX0A 5IA4A 3BYVA 2R3MA 4FV4A 3L9LA 3ZH8A 4ZEGA 1RJAA 1I44A 5HO8A 3KQ7A 4KNBA 2BDJA 1FVTA 2XYUA 5C4LA 3GUBA 2WMTA 3P86A 3PPKA 1UKIA 4I93A 4QYEA 4M69A 3BX5A 4FBXA 4HGSA 4MF0A 3FYJX 3FLYA 5HBHA 4YC6A 2R3QA 2DLZA 5KMKA 4DFYA 3NUXA 2GE9A 2YHVA 2YABA 1SZMA 4J8MA 3UZTA 4O2ZA 4PMPA 4PMMA 1H1WA 4I24A 4JDJA 2X8IA 5AP2A 4QTEA 2YDIA 4FSNA 4WNMA 4FA2A 3PDTA 3DFAA 1O48A 2ZDUA 3R83A 5F20A 2C6DA 4XRLA 4CFUA 4C35A 4GVAA 4FSTA 4O7LA 4FT7A 3BGZA 3GXXA 3SXSA 2BTSA 4IVCA 4BIEA 4RGJA 3I0QA 3CE3A 4J99A 2AOAA 3VF9A 3BHHA 4ZJJA 4EUUA 1R1PA 3MW1A 2X81A 3QLGA 3QXOA 4NKSA 2VTSA 4FZ7A 2CCHA 3E62A 4E4LA 4M7IA 5JEBA 4TYIA 4O7WA 3PSJA 4L43A 1CM8A 2RG5A 4L8MA 4R77A 2C47A 3WZDA 4ALVA 4N4SA 2CKOA 4RIWB 3UVPA 2R2PA 4E26A 4QP8A 3ZZEA 2X2MA 1O4RA 1IG1A 2OG8A 1QPJA 4BCKA 4EWQA 3ANQA 3HMOA 3OEZA 4HVIA 5AFVA 3TDVA 3S8NA 2W05A 3KRXA 1MRUA 3A7FA 3BUNB 4EOOA 4AE9A 3EWHA 2BZKB 4OUCA 4QMTA 4LYNA 3RM6A 4ZZNA 2VX3A 4IB0A 1PXMA 1LEWA 3P0MA 1O4DA 4EJ7A 3V5JA 2YDJA 1XO2B 4EH6A 5CZHA 5CAOA 3CQWA 4YBJA 2VTMA 4LI5A 3KF7A 5EG3A 4QMPA 2LNXA 4EK6A 3QD3A 3F3VA 4G6LA 4C38A 5FGKA 4K77A 3M1SA 4U42A 3TTJA 3PJPA 1SYKA 1AYDA 3QRKA 3MI9A 4IX3A 3SXRA 4FKJA 1SHBA 3NUYA 3UZPA 3FKOA 3A60A 2DS1A 1IEPA 4FIFA 5DT4A 1OIUA 4HVDA 1M14A 4NM0A 2ZDTA 4I23A 3G9NA 4UWCA 3ORIA 3REPA 4FNXA 5ETIA 5J8IA 4K0YA 2ABLA 3CP9A 4AG8A 4B8MA 3SLSA 3TNPC 3ERKA 5IA0A 2XM8A 3M11A 5EK7A 3KU2A 3LZBA 3PA5A 2VTNA 2Y0AA 4D4YA 4EOJA 3N4TA 4AF3A 3EQIA 4TKSA 4V01A 3NRMA 4RMZA 3TJCA 4BB4A 4DEAA 4EH5A 5L6OA 1W98A 3Q32A 4JEGA 3ATSA 2C1AA 3NYXA 1JKSA 1OKWA 3PRIA 4RJ7A 5H2UA 3U4WA 4IDVA 4KSQA 2W1EA 4NTSA 5EOLA 3S1HA 4IC8A 3FZ1A 4D4VA 5J7BA 4O81A 2O5KA 3WOWA 3BHYA 5LMAA 4DEEA 3R8VA 5AAGA 3GU7A 1RW8A 3ORKA 1T46A 5AUTA 4R7HA 4Y85A 1TCEA 4OTGA 1SNUA 4HYSA 1JYRA 4H3PA 4P5ZA 2HAKA 3KVXA 5AIKA 4FKLA 5I3RA 4Y95A 3RHXA 4U7ZA 2YA9A 4AW1A 4E20A 5IA5A 3ORMA 4NM7A 5G1XA 3TV4A 3UC3A 1YVJA 2RGPA 3Q5ZA 2PU8A 4C3RA 2W06A 2OICA 4BHNA 2BHHA 4PRJA 3KREA 3HRFA 5GZ8A 4E4XA 1Q62A 5TT7A 2YCQA 4KSPA 4L53A 3EFJA 1RDQE 2XCHA 3LQ5A 5B0XA 2C3IB 1U59A 2W1CA 3W8QA 3PSKA 4P7EA 4CV8A 5DH3A 5IPJA 2X7FA 5AP4A 2EO3A 1SVHA 1R39A 2CLXA 2I6LA 4GIHA 4O21A 3DBQA 4PQNA 1AQ1A 1JSTA 5LARA 4BICA 2PVRA 4FNYA 2H34A 4KBCA 5BVEA 4AGUA 1OBDA 4QYGA 4X2NA 1XH9A 5DNRA 3BU5A 3QHWA 4FSQA 5ETAA 4EK5A 4HYHA 2PMOX 2W96B 1YOLA 1M2PA 3KF4A 3LJ0A 3PQZA 3IO7A 4IB5A 4AOJA 3GEQA 4IWDA 3OUNB 3T9IA 3US4A 3FHRA 2XNBA 1WMKA 5EM7A 3RTPA 3SOCA 4FL3A 3N51A 3GBZA 5IH4A 5BVKA 3OEFX 4FUYA 4G31A 2OW3A 2QOLA 4O83A 4C33A 5A6OA 1BFJA 5DBXA 4OBPA 3WE4A 3DOGA 2C0IA 3T9TA 4FK3A 1Y6BA 2XNGA 5L6PA 1E1VA 4GCJA 3H0YA 5E1EA 3H10A 5HE2A 5J9LA 1UVRA 2XEZA 4H39A 5CAUA 5KBRA 3KC3A 5C01A 3WYXA 5TR6A 3MIAA 1H1QA 3VW6A 3FJQE 2VO7A 4GK4A 4DEGA 3MFTA 4J52A 4O0RA 3L1SA 1BHHA 2C6LA 1NT2A 3QZFA 1CDKA 1G3NA 2BILB 4NIFB 4PWNA 1SHAA 3UQFA 3OTVA 4AS0A 4ZY4A 5CSHA 5L2IA 5EI8A 3HEGA 4MXOA 1WBOA 4GT4A 4MF1A 4TXCA 5CENA 4RFZA 5L6WL 3TEIA 4CYIA 4DH7A 3UZRA 1P13A 4NUSA 2J0LA 3RK9A 2DQ7X 3LVPA 5JFXA 4ACHA 1J7LA 3R63A 5DIAA 3PS5A 2VO3A 3P5KA 2C1BA 5DRDA 3O50A 2XP1A 4PL5A 3DKFA 4MNEA 1OECA 4FV7A 4ASZA 3DJ7A 3QFVA 4O1OA 2W5HA 5AAEA 4A07A 4OBOA 4E73A 4EIHA 4QPMA 1Q8ZA 3JYAA 5EI6A 2W7XA 4KBKA 3A8XA 2WMBA 2WTCA 3E8NA 2QURA 1JQHA 3P9JA 4BDBA 4D58A 4F7SA 4Q2AA 1AYBA 3WIKA 5HU3A 3ZUTA 4Y73A 4RWKA 3LHJA 1DM2A 4PTEA 4N0SA 3U54A 4MX9A 4LOQA 3HDNA 4OTQA 3OVEA 4MYGA 1IS0A 4NCTC 2YIXA 3SVVA 5LMBA 1LCKA 2R3JA 2KK6A 4PPBA 2B4SB 2C5YA 4RG0A 2ERKA 4WOVA 4DG0E 5JFWA 3VO3A 3V3VA 4A9TA 2P4IA 3PPZA 5F94A 4C2WA 3QTRA 1YI3A 4XUFA 3OWKA 3ZEPA 1TVOA 4IAKA 4TT7A 4WRGA 4X7QA 2UW3A 3LFAA 1P14A 5AR8A 2DCRA 2F7ZE 3R04A 4BDHA 2YWPA 4KIQA 4ZIMA 3AMYA 4BCNA 4BI1A 5DF6A 2B9JA 5CLPA 5FXSA 4IH8A 3DCVA 2WGJA 3E7VA 1BYGA 5HO7A 4E7WA 2IW8A 4DGGA 2GMXA 1QG1E 3QQUA 3MFSA 3PRFA 2B9IA 3PSDA 3UTOA 2PUPA 2WPAA 1OBGA 3S8LA 3C4CA 5DR9A 4G2FA 3RCJA 2XJ1A 2B55A 2CKEA 4QMMA 3AMBA 2V7AA 4MXCA 5DVRA 4D2TA 4F7LA 2FSMX 3VRYA 5AX3A 4BBEA 3NSZA 2PZPA 4O0VA 4XP3A 5L3AA 2QLQA 3DJ6A 3FMJA 5ETCA 3SA0A 4LUEA 3CJGA 2BPMA 3QRJA 4GVJA 1XKKA 1H0VA 4TWOA 5EYKA 5LWMA 4H34A 2QOIA 3IW5A 3Q60A 2PE1A 2WTJA 2FVDA 4HPTE 1YXTA 4YJQA 2QO2A 3A4OX 2JFLA 4JL9A 2ONLA 4IANA 2MQIA 4BCMA 3L9MA 5E8TA 4FODA 4WSQA 3K2LA 1JKKA 3C9WA 2XP2A 3PY1A 4F99A 1F0QA 3A4PA 5HKZA 5J95A 2C9WA 3HMNA 4CVAA 5M53A 2IN6A 3SV0A 2G2IA 4BN1A 3CC6A 3BQRA 4RIOA 3GNIB 4KABA 5HTBA 5IQBA 3C4FA 3DA6A 3EH9A 5GHVA 5JK3A 2Y1MA 3SHEA 2W17A 4GJ2A 4QYYA 4O7RA 2GU8A 2KULA 2VTQA 1LR4A 3PP0A 1ATPE 4FEVA 2BTRA 3DB6A 1Y91A 3RAHA 4JDKA 1KUTA 2FA2A 4C62A 3R7EA 5J9ZA 5GNKA 1FYRA 1DS5A 1H1RA 3EYGA 4JRVA 4Q5EA 3AC1A 4R1VA 1GZOA 1U54A 2F7EE 4FIEA 2VTJA 3GXWA 1OIYA 2QR8A 3BUMB 3NCGA 4MBJA 1ZYSA 4TNDA 5EKOA 5EHRA 3OXIA 2ZYBA 1J3HA 3VS5A 2DLYA 5TOZA 4FYNA 2W1IA 3QTXA 1QPCA 5EEQA 3NGAA 3OT3A 1XH5A 3CY2A 4FKOA 2QOFA 2XBAA 3TNHA 2EWAA 3IECA 2JKOA 3OXTA 3TACA 3F2RA 4TZIA 3GU8A 3QRUA 3W1FA 4DFLA 1CMKE 2HYYA 5T3QA 4F6UA 1ZYLA 4RZVA 3MVMA 2X6EA 3NAYA 4C7TA 1OL6A 4DLIA 5M09A 4WWQA 4O2PA 4IAZA 1O6KA 2SHPA 5HGIA 4BCOA 2IJMA 4ALUA 3MBLA 3QF9A 1UUSA 3U51A 2RFDA 1VYZA 3ODZX 3RWQA 3WILA 1ERKA 3GC7A 4OHDA 5HKYA 4FV2A 4XG8A 3NR9A 5IQEA 2SRCA 2J5FA 3ORXA 4JXFA 4YLKA 2JLDA 3AC2A 3AOXA 4FTNA 2J0JA 4YTHA 3ZO1A 5JFSA 3MSSA 1D4WA 4X3FB 1ZZ2A 3DDPA 4F09A 2YSXA 2CLQA 3VHEA 3GT8A 3P4KA 2C6EA 5EH0A 1IA9A 5DGZA 3W18A 4GG5A 4QNAA 3E7OA 3CPCA 3HGKA 5JFVA 4ONAA 1YWRA 4A4OA 1OITA 4DAWA 4DFNA 5JKGA 3HV6A 4DBXA 2LCTA 1GZ8A 3G6GA 5J7HA 5M08A 3N8MA 5AX9A 3DT1A 4ALWA 2ERZE 2WOTA 3PFQA 2IZUA 5IQFA 4QNYA 4FI1A 5AAFA 3Q5IA 1QL6A 4EOIA 4D55A 2C30A 4G3FA 2IG7A 4RJ8A 4R6VA 2ITVA 4C4JA 3ZO4A 4BCQA 1L8TA 2PWLA 3Q4UA 5EOBA 4E6QA 5M06A 1O4QA 2Y4IC 4U79A 4KA3A 4AA5A 1JYQA 2BROA 4FEQA 2R7IA 2BAJA 2XK3A 4D2RA 2WQNA 5FM2A 2XMYA 1T45A 4I6BA 1TQIA 2YM7A 4V0GB 2CGVA 3R8LA 5GINE 4K45A 1O4BA 3MVJA 4FT5A 4QYFA 3ZFYA 2R0IA 5GZ9A 5K4IA 2X0GA 2PPQA 4ID7A 3RK5A 2Z02A 2WD1A 4CTCA 3QWJA 3RPRA 4RVMA 4USDA 2VN9A 5FTOA 2OXXA 3ZM4A 4IAYA 1Q5KA 2E9OA 1BM2A 3ZM9A 3FAAA 1O4FA 3FI4A 4C58A 4HCVA 2VWIA 3HYHA 1V0PA 4XBUA 3IW6A 4DTBA 1ZMUA 3FZSA 3AGMA 4ZJVA 4DEBA 4GKIA 3FMLA 2C6KA 3DAKA 3QTUA 4QP4A 3I1AA 3WF5A 3GOPA 3FMEA 2VTRA 3QRIA 4EQUA 3IOPA 5HCYA 3TUDA 1BFIA 1OIRA 3MESA 4U43A 4TWCA 5HZNA 4FV9A 4HZSA 2O3PA 1YKRA 1F3MC 3CY3A 4FKQA 5AR3A 4YUQA 3GFEA 4Z7HA 4A4CA 3EN4A 2W4KA 4QT1A 3ALOA 4FTUA 3ZOSA 5CNOA 3V5WA 4IVDA 4NH1A 3HV3A 1OKVA 2BRBA 5F9EA 3WA4A 4DYMA 1LUNA 5AV4A 4W4VA 3ATTA 3BWJA 4WA9A 4NTTA 3D7TA 3DTCA 3AC3A 3OY1A 2QNJA 1W82A 4GT5A 5FM3A 5BPYA 1RPYA 5CNNA 5C8KA 4AWIA 4L7FA 3F88A 3Q4TA 4YO4A 4DG3E 5FBOA 1TZEE 4M69B 2OK1A 4LOOA 2Y4PA 3RNIA 3E93A 4R8QA 5AIRA 1MUOA 2QOHA 3D15A 4CRSA 5HG7A 3ZDIA 3EN6A 3FLSA 4BHZA 4KBAA 3FUPA 3MY0A 2X4ZA 3PLAE 4EJNA 1IASA 1G83A 3IDBA 3ZEWA 5A4CA 1AGWA 4NT4A 3TT0A 3TWJA 4P2KA 4QMOA 2XA4A 4TYHB 3KRWA 3VQHA 4DG2E 3O7LD 3FC2A 4HJOA 4UWBA 5C03A 3LM0A 2B7AA 4JG8A 5L4QA 4ROJA 3KGAA 3EQHA 1RJBA 1ZYDA 1ZARA 2G9XA 1OO3A 3DZQA 1FGKA 4QMWA 4YJTA 4AXAA 4F9WA 5ANEA 3TTIA 4MH7A 3DBEA 3OOGA 3O71A 4XJ0A 5HIBA 2J0IA 2C6TA 4YJSA 3IW8A 5HCZA 3FI2A 1PXLA 3H4JA 4UXQA 3IG7A 3FMHA 4ZSAA 1LKLA 2QQ7A 3H9OA 3BUWB 3MH2A 4LGGA 2GHGA 4AA4A 2Y9QA 4D9UA 3IMJA 3UJGA 2QR7A 2OZAA 2R64A 2RFNA 4D9TA 1BKLA 3ENMA 3EKKA 5CF5A 1H0WA 5IDPA 5JT2A 3EQGA 3BU6A 1O9UA 3E92A 2RVFA 2XRUA 4GU6A 4R3PA 5HLPA 3SX9A 4BGQA 2VNWA 5AUVA 4D4SA 3KKVA 5IBMA 4XNEA 4Y5HA 4M14A 4ZLZA 2YISA 1CKJA 4XHKB 1SM2A 1PYXA 5IUIA 3EAZA 2VO6A 5EG3B 3BYSA 4XG9A 4AW5A 5ANDA 5IQDA 5M4FA 5HKMA 4O0XA 2OKRA 3FMDA 3CKXA 1QPDA 4RLKA 4X2JA 4YPSA 1PY5A 2YN8A 3Q2JA 3PLFB 3MYGA 3NUAA 3LCKA 4O96A 2RIOA 3GU6A 1NVSA 4LL0A 4QMLA 3O51A 3RAWA 4E1ZA 3LFCA 3O8PA 2CNQA 4QP3A 4PTCA 1JNKA 3V8TA 2HWOA 2ZMCA 3GU4A 2YEXA 4GYGA 1PW2A 5DFPA 2IZRA 5J9YA 4S31A 1A1EA 2DM0A 3UQGA 4GMYA 5I0BA 1UWJA 1YQJA 2X9FA 2HZ4A 4II5A 5AMNA 2BZHB 4BCJA 4HW7A 3SG8A 2XIYA 5K4JA 1JWHA 1P4FA 3UG2A 3KCKA 3DNEA 4ANNA 5KMIA 2EOBA 1P2AA 2R3RA 2ITUA 2Y6OA 5HKWA 3DV3A 3HECA 4GIIA 3C7IA 3NPCA 1ZYJA 4FSMA 4MBLA 2DUVA 3CBLA 5HBJA 1SPRA 2HXQA 4HNFA 2UW6A 3P7BA 4GUBA 2WTWA 4G5PA 4IM3A 4M4ZA 3ZRMA 1ND4A 1OL1A 4FX3A 5FDPA 5LVPA 5HQ0A 4FGRA 1R78A 2WQBA 3POOA 3R7YA 2NO3A 3DU8A 4LG4A 3T3UA 5A14A 5AEPA 4XZ1A 2BRNA 2W5AA 4FZ6A 1QPEA 4G6NA 2GQSA 3VRQA 3GXLA 2XNMA 5D11A 1O4GA 2HIWA 4YHFA 2OF2A 4AAAA 1ZLTA 4EKKA 5B2MA 3LMHA 5LVOA 3I60A 3ZTXA 5KUPA 4AT4A 4C4HA 4P5QA 3R1SA 4BZDA 3BIZA 3D94A 4TRLA 3LJ2A 1LUIA 3TXOA 1YHWA 2JD5A
chains in the Genus database with same CATH superfamily
4APPA 3ORPA 3I0OA 2W9ZB 2YZAA 3VUKA 5I5ZA 2HOGA 2AC5A 4X3FA 3N84A 5BYZA 2HCKA 3CTQA 3DY7A 4GU9A 4A4BA 3F69A 3PSBA 2ZMDA 2PZIA 3QQFA 5CWZA 5M4UA 4F64A 5EHYA 1YOJA 3QBNA 5IEXA 2PVLA 3NIEA 4RT7A 2K79B 2GQGA 5CI6A 3T8OA 3FQEA 3S4QA 3DNDA 4QP2A 4E68A 3UNZA 5BMMA 4FOCA 2GNIA 3QXPA 4UALA 1R1SA 4F78A 3D5UA 3FI8A 4UMRA 3ZFXA 2XNEA 4PY1A 4H1MA 2YM6A 5H9BA 3R8UA 4MHAA 4BC6A 3U6HA 3BHTA 2E9PA 2Z7SA 3UIXA 2XEYA 2J51A 4I0SA 1JVPP 4RJ4A 3C4ZA 2BALA 3HIZB 4YJRA 4IFCA 5IH5A 5C8NA 4V0GA 2YM4A 2QOBA 1IRKA 3HZTA 3ZBFA 1ZOGA 2Q83A 2X8DA 3D7ZA 3KMUA 2X7GA 4I41A 2PNBA 3B2TA 5GIPE 2QC6A 4BGHA 3MV5A 1BHHB 5J1VA 4PMSA 1CSYA 4X2KA 4OT6A 3ROYA 3HKOA 3UYTA 4U0IA 4JG6A 4XLVA 3WI6A 2VNYA 2PVHA 3TM0A 3HCKA 3VIDA 4CEGA 4F1MA 5HE1A 4JR7A 4CT2A 4FOBA 3R8ZA 2I7QA 3NFGB 4XX9A 2YCFA 3OCBA 4OW8A 4BCPA 4WRSA 3UC4A 5BUEA 4TYJA 2J4ZA 4B0GA 1BUHA 4Y5QA 2FCIA 2YIYA 3AG9A 3GC8A 4DBNA 1SVGA 2PVJA 3D2KA 3FXWA 3H0ZA 4LUDA 5EFQA 2XZSA 3WF9A 3OZ6A 4R7BA 2F57A 2I0VA 2AUGA 2FSOX 3RPOA 3OD6X 1ZMWA 3PY3A 4UBAA 1M61A 3LE6A 1S9JA 4IZ7A 1GOLA 3UOKA 4D4RA 1H4LA 1OPLA 1CSZA 5F95A 3CXWA 1B38A 2GHLA 3ZXTA 3UVRA 5A9UA 4OTWA 2IZVA 3PXFA 2IEWA 3PVWA 4ENYA 5HTIA 4LRJA 4BDAA 2XKFA 4L67A 4TNBA 5ANGA 3P79A 3UP2A 3ZONA 4CT1A 4RPVA 3RJCA 4K1BA 3L9PA 4F9YA 2MK2A 4A4LA 1LUFA 3EYHA 3FKNA 3QQHA 4H58A 4L68A 4NJDA 4NKAA 2GNFA 3Q6UA 2Y6MA 3SXFA 4RWJA 4DINA 4MAOA 3LQ3A 2CIAA 1NVQA 4RJ6A 3TL8A 3ZZWA 4CFXA 2QMSA 1YRPA 3D4QA 3RINA 1CWEA 3RCDA 5LMKA 3R21A 4FZDB 4W4XA 4FKPA 3RHKA 3CKWA 3EKNA 5CVFA 4K2RA 4TYHA 3HP2A 2UUEA 3VQUA 3FQSA 5EQYA 3VBYA 3AD5A 4KRDA 1GZNA 2ETRA 4J1RA 4C8BA 5DR2A 4XZ0A 3RP9A 4G6OA 4MD9E 2XAMA 1WBPA 3BE9A 2WTIA 3MGYA 3IMDA 4ZK5A 3FSKA 2QCSA 2VGPA 2ONLC 4J95A 5JQ8A 3AQVA 1UURA 1BLKA 1O4CA 2W1HA 5EYDA 5I9UA 3LMGA 1JPAA 4FZAB 3S95A 4C34A 4RJ3A 1O4MA 4FEUA 3VS2A 4FUXA 5DI1A 3PJ8A 1FINA 3KMMA 3QX2A 4AOTA 4JIKA 4QP1A 5CANA 4O7VA 2BRMA 2GNJA 4ANMA 4FV0A 4X2GA 4R1YA 3COHA 3VAPA 4ANSA 2FSLX 2GNHA 4RRVA 1WVWA 3TV6A 3ZO3A 3QCXA 3OTUA 4IDTA 4F9BA 5LQFA 2DWBA 1B47A 2ITXA 4F59A 3QZIA 3SDJA 5AUXA 3WYYA 1TKIA 3QA8A 5FXRA 3LOKA 5HVYA 2C3KA 2F49A 5JGDA 2B9FA 3FY0A 1YXUA 4Z55A 4BI2A 4FG7A 3ACJA 4O4EA 4XCUA 2ACXA 4TYGA 3QRTA 4AOIA 2OZOA 4IW0A 4UV0A 5AP1A 5CY3A 3PFVA 3CTJA 4XH6A 1J1CA 2WMWA 2XBJA 4MBIA 4GV1A 2F2UA 2JDOA 3D9VA 2OSCA 4YJUA 2V62A 3PA3A 3QUDA 3B8RA 5D7AA 5E8XA 5CEMA 4GUEA 2GNGA 2R3OA 3TNIA 1VYWA 1U54B 3P7CA 1A06A 1JSVA 4C3PA 4L46A 1HCLA 4EH2A 4GK2A 3VVHA 3QWXX 4ZS0A 3O5AA 3UGCA 5J3XA 1OGUA 4LFIA 2Q0NA 5CQWA 4N57A 1JKTA 5LOHA 4ITHA 2R0UA 3FMKA 4XV2A 4PP7A 4XMOA 4FNZA 3TNQB 3FI3A 2GTMA 1VEBA 4DC2A 2KTYA 4QRCA 4E3CA 3DDQA 3KL8A 2YU7A 3PTGA 4ZMFA 3V8WA 3QKKA 5D1JA 4DGPA 5H8EA 3L9NA 3PWYA 4E6DA 1MQ4A 2XB7A 3GB2A 3QYWA 4G1WA 4QMXA 4CNHA 3TZ8A 3FMMA 4GJ3A 4R7IA 1LP4A 5EW9A 3RKBA 3DJ5A 3FZPA 2EKXA 3CIKA 2MRKA 4EH4A 1NZVA 3I6WA 3V6RA 5E8SA 1OPJA 3PIYA 4U5JA 2VWUA 4LOPA 3QTQA 4FVRA 2Z60A 4WNOA 5CALA 1O4KA 4EY0A 1HCTB 3LCDA 4RC3A 2UW0A 3PE1A 4I6HA 4IFGA 4LM5A 3ZUUA 4F6SA 2AUHA 1YDTE 3LFEA 4PUZA 1JWOA 3F3TA 4O0SA 1UNLA 4MKCA 4FV1A 4F7JA 4FTJA 3GC0A 3Q9ZA 4OTHA 3POZA 3JXWA 1OI9A 3ZO2A 1KE5A 3F7WA 3GU5A 1UKHA 5BMSA 4G16A 4JGHA 4S2ZA 4O6EA 5D9HA 4FIIA 4FZFB 3OV1A 4QMUA 5BVDA 5EM6A 2PE2A 2YAAA 4YPDA 3CWGA 3PWDA 4PMTA 4DITA 5KMOA 3ULIA 2AEGA 4P9VA 5AXIA 5CS6A 3BHUA 3F3ZA 3FDNA 2W1FA 4BWPA 4EK3A 3QQGA 3DKGA 3PJ2A 4I94A 4YZMA 2YCRA 2CHLA 5AM6A 5HG5A 4AN2A 4Y46A 4EC9A 2BRHA 4KAOA 3LYVA 4FBNA 5FQDC 3F66A 1W2DA 5LVNA 1O4HA 1O47A 2JIVA 4BBFA 3BQCA 3LPBA 4GPLB 3PG3A 2JC6A 5CAVA 4KS7A 3MH1A 5LCKA 2IVSA 3ZUVA 5KKRB 5F1ZA 3F2AA 3G51A 2X8EA 3TNWA 2YLEA 2QHMA 3IGOA 2IVTA 4IBMA 3ITZA 4NSTA 2J7TA 4AXFA 2G01A 2RF9A 4EC8A 1O4AA 3PVGA 1M52A 2JDRA 1TZDA 5A4QA 5CXZA 3UO4A 4ASDA 3AKLA 4X6SA 3W55A 1WAKA 2GS7A 5C1QB 1ZWSA 1HCKA 4CCBA 4C4EA 3QL8A 4JQEA 3DBCA 4ACGA 3R7VA 1R0EA 4EOMA 2EXCX 3QCSA 1G8AA 2FH9A 5BQ0A 2ZAZA 2E9UA 5A4TA 4O7NA 3QQLA 4DH5A 4WIHA 1YI4A 3PZEA 4ZTSA 1YVHA 2BUJA 2UW4A 2Q0BA 4GH2A 5KHXA 1H9OA 2QKRA 2ZFYA 3EQPA 1XH4A 4NWFA 4GSBA 4AXCA 5CF6A 3FZTA 3RZFA 2QU6A 2IVUA 5CXHA 3VS3A 4BJJA 2BDWA 3KXMA 3FEGA 1FMOE 3F7ZA 4UN0C 1PHKA 2DYLA 4O7SA 1IR3A 4QQ5A 4U3ZA 4C61A 1O42A 1S9IA 1UNGA 4QTDA 4CSVA 3OCTA 5CF8A 3G6HA 4L01A 4QPSA 3B2WA 5DOSA 5GJGA 1WQUA 3Q53A 4NFMA 3D7TB 2UW8A 3EN5A 4JQ8A 3FPQA 1A08A 2RL5A 4E8AA 1X8BA 1Y57A 2C5VA 4WUNA 4IADA 4ZTRA 5HE3A 1KE7A 5EDQA 5HNGA 3SQQA 4B4LA 1BL7A 1XMLA 4ZSGA 4KKHA 1OL7A 2EB3A 4U6RA 3FHIA 4CZTA 3OT8A 2PHKA 4BR3A 2XIKA 1KWPA 4YLJA 4GL9E 1URCA 4RX8A 4YSJA 1KOBA 2OIDA 4A06A 4H1JA 2PMIA 4EH8A 1WBTA 2VTIA 5EQEA 1RE8A 3SG9A 4X3JA 2QG5A 1CSNA 2VTLA 3RPSA 1LUMA 5D41A 3KXXA 1Q8TA 3EQRA 3QU0A 2WMXA 4AFEA 4ENXA 3UNKA 4M0YA 1MILA 4EHZA 2PZ5A 4XP2A 3KB7A 4USFA 4EHEA 2F2CB 3RVGA 2UW7A 4HNIA 4TY1A 3VS0A 2WMAA 2XIZA 2HUWA 3Q3BA 3F5GA 4CXAA 3BU3A 3R22A 3RI1A 4BVUA 5EKNA 2VWYA 2PUIA 3AMAA 2J9MA 4R5YA 3CD8A 2OIBA 2UZNA 3K3IA 1D4TA 2RSVA 4WO5A 2YLFA 4HOKA 4EOSA 3W2PA 3MIYA 5A6NA 4I0TA 4F9CA 4EYMA 4QDVA 2VWVA 2GNLA 2OZAB 2P0CA 2C3LA 3PYYA 3W0NA 3GQIB 4PX6A 1RQQC 1ZOEA 3O7LB 3LMIA 1BLXA 2V0DA 3MTLA 5K0XA 4QP6A 3VUIA 2BFXA 2XUUA 3I79A 3SGCA 4AN3A 3H30A 1YXSA 3I6UA 5DEWA 1PMVA 3UO6A 3QA0A 3CS9A 4N70A 4O4FA 4F9AA 4GYIA 1ZAOA 3KULB 2B0QA 3PLSA 4GS6A 4IZYA 5BVFA 4BDKA 5KBQA 3DPKA 2BHEA 5IDNA 2O65A 3BI6A 3MJ2A 2UZDA 2XANA 5GJHA 4L42A 2XKCA 3DQXA 2ITNA 3E8DA 4OTIA 4FSRA 4OT5A 5EHOA 3WF7A 1SNXA 4F0IA 4DDGA 3UP7A 3HAVA 4AZVA 2YFXA 4AFJA 3PXQA 3RPYA 3QZHA 4CG9A 1KE8A 4BDGA 2IUHA 5CF4A 5FEDA 3R0TA 3KXZA 4CMOA 1V0BA 3C50A 5FWKK 3R7UA 1XBAA 3BELA 5IU2A 4W8DA 4I5MA 4EYJA 4WHZA 1KA7A 2HMHA 3BL9A 4EOQA 4G3GA 3C5IA 5C9CA 2VIFA 3HMIA 3OB2B 3OOMA 4J97A 2VU3A 3MPMA 3LXPA 3EZVA 3MH3A 4XV3A 2OH4A 1EH4A 5K5XA 2ETMA 3R7IA 5KNJA 2C69A 3UE4A 4ZZMA 2H96A 3NYVA 4ZSEA 5FDXA 1YDSE 2WQOA 4ZSLA 4L3LA 4C2VA 1G8JA 1OGYA 3C0IA 3G0EA 3QX4A 3W10A 4JAIA 4Q9SA 4F1OA 4ASEA 3EQFA 5IG1A 4RC4A 4UMPA 2FB8A 1JLUE 1PXNA 2W0JA 2PK9A 3U9CA 4EOKA 4XEYA 3F5PA 3PP1A 5IF1A 2XIXA 3VS1A 3TUCA 4NL0A 1Y6AA 1NZLA 5BUJA 3LCOA 5AADA 2C6MA 3QQJA 3OF0A 5AV2A 2ETZA 3OBGA 2B52A 4X3FC 4PF4A 3U6IA 4FTKA 3F2NA 4P4CA 4U17A 3ZSIA 1U5QA 3K3JA 5EW8A 3A2CA 5AR5A 4DCEA 3NS9A 4V05A 2CPKE 1CTPE 2FYSA 1H01A 3NUNA 4DHJA 1XBCA 1NRVA 2G15A 4FV8A 2WEVA 1U5RA 3NYOA 3Q04A 3W16A 4D1ZA 3VRZA 4FTAA 3VUGA 4O7TA 5IUHA 4CKIA 1PMUA 4YC3A 5HNBA 5DWRA 1ZOHA 4WD5A 3EZRA 1Z57A 3GCVA 4JS8A 2REIA 4Z16A 1PXPA 3QLFA 1O4JA 2WMQA 3V51A 3NX8A 4O0WA 1OVEA 3GVUA 1CWDL 4RWLA 3VWAA 4CGAA 2CRHA 2HDXA 4MD7E 1Q4LA 4YTIA 4QO9A 3H9FA 5CSXA 4FV3A 4I5CA 4KB8A 2JDSA 5D12A 3SD0A 4ANOA 4ZY5A 1NXKA 1Q24A 3GCPA 3HVCA 2PLDA 3OWLA 5E92A 4AGCA 3R9RA 4KINA 4IVBA 3VHKA 4LRMA 3A7IA 4CKRA 5FD2A 1AYCA 4OHEA 5LCJA 3LJ1A 2OIQA 4S32A 5I9VA 4O84A 1Z9XA 2X0QA 4BKJA 4C02A 5CSPA 2QG7A 1R0PA 4Q5HA 4IAAA 3NW5A 5CT0A 4ZXTA 3Q9WA 4LGDA 2G1TA 1PXJA 3BRBA 3QC9A 3UNJA 3ZLWA 1HOWA 4YTCA 4FSYA 4O22A 3U9NA 4PDYA 3P1AA 3LM5A 2X0OA 4PTGA 3F6XA 3SRVB 3KIOC 2WELA 5HE0A 2PVNA 1XH8A 3GQLA 4W9XA 4MVFA 2PMNX 2UVZA 3UYSA 1XQZA 3JY9A 3FZOA 1W8CA 2BVAA 2RFSA 2YJRA 4RFYA 3S2PA 2R3FA 3CGFA 3O96A 4GT3A 4AN9A 5K5NA 1F5QA 5IQIA 2XS0A 2XKEA 4BDJA 2GHMA 2HY81 1WVYA 4Y83A 4I6LA 2KGYA 2Z7QA 4EUTA 2FO0A 2OJGA 2WAJA 4RJ5A 4ZOGA 3V01A 5KMLA 1W84A 4FMQA 2H6DA 3MS9A 4EH7A 3PUFC 2AQXA 5E7RA 2PULA 4NWGA 2CDZA 1JAMA 4OGRA 2JFMA 2WNTA 4ZTHA 4HGTA 3FLWA 5KCVA 1XHAA 1LCJA 2OXDA 4K33A 4JAJA 1AD5A 1FQ1B 2EB2A 2C5XA 4M84A 5AV1A 4JE4A 3FL5A 4RX9A 2PZYA 4ARKA 4D0WA 4HVHA 5AA8A 5IZFA 3RAKA 2EO6A 4CKJA 4CZYB 3TDWA 4L1BB 3IN8A 4OAVB 3G5DA 2Y1NA 4CZUA 4GK3A 2JBOA 2QODA 2EU0A 1OKZA 4H05A 4FKGA 4IZ5A 4C3FA 2VZ6A 5HD7A 1ZZLA 5FRIA 3BUOB 1M7NA 3D14A 4KS8A 4YU2A 4C37A 4U45A 5BYYA 5DEYA 4ERWA 5E8UA 3HHMB 3DB8A 1GIJA 4FKVA 1DAYA 1YXXA 3Q9YA 4JBOA 3ZHPC 2CJMA 4F4PA 3FQHA 3Q4CA 1Q3DA 4E6CA 3TV7A 2XARA 3BUXB 1KC2A 3GI3A 2QOKA 5CVGA 3NUUA 4QOXA 1YDRE 2F9GA 3CJFA 4MWIA 4YC8A 3ACKA 3PY0A 5FEEA 2NNWB 4EHVA 1QADA 4EQMA 5JSMA 3IOKA 5CI7A 5IMXA 1H25A 3EL8A 1IAJA 4FTLA 1A1BA 3QGYA 5HG9A 2YM8A 4YJNA 1AOUF 4NW6A 4U3YA 2GDOA 3QD2B 3R28A 5C27A 2JGZA 4Y8DA 4RA5A 3O23A 4BDEA 3UOJA 2L3TA 4BYJA 1L3RE 4IVAA 4FG8A 3VUDA 5CASA 4QQTA 2XJ0A 3UQCA 5EM5A 1O4LA 3NNUA 1YI6A 3QCYA 5I4NA 2VTPA 5EDRA 4RZWA 2W1GA 2C5NA 4S33A 3GQIA 3IKAA 4BCHA 4O27B 4ZTMA 4LV8A 1G8SA 5EQPA 4CG8A 2K7AB 2W1ZA 3GGFA 1LEZA 3MPAA 2XJ2A 4CFNA 4ZMEA 5FTQA 3VBTA 4BKZA 2BKZA 4IJPA 4DFZE 4QEBA 2WKMA 4N6ZA 4H3QA 2CNUA 3OWPA 4HGEA 2MRJA 3KY2A 3R2BA 4FKTA 3CTHA 4QPAA 4BDIA 3KULA 4A4XA 4YP8A 5HLNA 3D5XA 1FU5A 3L8SA 5AR7A 4QYHA 3BZ3A 4A9YA 3DBFA 1BX6A 4DT8A 5DT0A 2OI4X 2CSNA 1GAGA 4U9AA 1CKPA 2BCJA 2P55A 4JBQA 5E1SA 4AX8A 2Z7RA 5CU2A 3RM7A 3NW7A 3FXXA 3MTFA 4CRLA 4W9WA 4OTDA 3MB6A 2BIYA 4ZLOA 4MXYA 5IQCA 4OTRA 4X21A 2JKQA 2E9VA 1Q8WA 3GFWA 3N7YA 2R3GA 4LGHA 2PUUA 1UNHA 1JYUA 5KX8A 1Q3WA 2NPQA 4DHFA 3NVKI 3UYOA 4IQ6A 2J90A 3G90X 3I81A 3TL0A 2CI8A 4AU8A 4FKSA 4QMQA 2R3KA 3TN8A 1FPUA 4EH9A 1OL5A 3P23A 5DMZA 3FLZA 4I4FA 3DGKA 3LIJA 5EHPA 1A09A 4XG6A 3E64A 4DE4A 4NWMA 3DXQA 3LXKA 2CGUA 4LL5A 4UMUA 4JQ7A 4LDTA 1E1XA 5DC4A 5FP6A 2UZTA 4YNEA 3DK3A 4NK9A 4BCGA 1UU9A 3ZC6A 3UO5A 3BGPA 1J7IA 1BMBA 4MXAA 3UOHA 2WTKB 2GSBA 4OHIA 1OB3A 2JKKA 2UZLA 3EOCA 1X6CA 3BEGA 1J7UA 1P4OA 4L3JA 3R73A 4TTHB 5G6VA 3VF8A 1BKXA 5BYLA 4D0XA 4RFMA 5E8YA 5ITAA 5L8LA 3OB1B 4K18A 4X0MA 3RWPA 4AW2A 5DN3A 3ZU7A 3AC4A 4EBVA 5BVNA 3BKBA 5CSWA 4FIGA 3VGOA 4RIYA 4CQEA 4MK0A 3NCZA 4AZWA 1Z3KA 2Z8CA 3R71A 3W32A 4YZ9A 5LVMA 4P9ZA 4L45A 1KV2A 3JUHA 1WBWA 2GSFA 2ZM3A 3PSCA 4KD1A 4NFNA 4O4CA 3UODA 1G8KA 2PYWA 4GKHA 5AP3A 3W2QA 4AAYA 2VV9A 3CGOA 3FLNC 4FJVA 1MQBA 3CCNA 4O86A 2A1AB 3AT4A 5FEQA 4PV0A 1F1WA 3TKZA 5B7VA 3A99A 3QAME 3QGWA 2XK9A 4YZDA 3MXYA 2VUWA 4ZS4A 5CYIA 1CKIA 3BV3A 3RNYA 2PZRA 3CQUA 1XH7A 3UG1A 3D2IA 2XNPA 4M8TA 2QKWB 4UWYA 3ZXZA 3D0EA 3OCGA 3D5WA 4OR5A 1FOTA 3BLRA 3AC8A 4QTCA 4QSYA 1K3AA 2C4GA 3BYUA 2IZSA 4DT9A 1REKA 2X4FA 2XK6A 1LKKA 3ORNA 2NRYA 2BAKA 4GFMA 4FT0A 5HG8A 5DLSA 1O4EA 4IAFA 2PTKA 5A4EA 1O44A 2X0PA 4O38A 3F9NA 4ANBA 4PDOA 5J79A 4MQ1A 3W8LA 4BDDA 4D1XA 3TKUA 4P90A 4PL3A 3ZRLA 1AOTF 2XNOA 4HPUE 4QP7A 3VJOA 4FKUA 2RG6A 3TIYA 5HEZA 3A61A 3V5PA 3W2CA 4CFWA 5HLWA 3COMA 5CU3A 2ZVAA 4JR3A 4KRCA 3BPRA 2WTDA 4MTAA 5IA2A 2JIUA 3PUPA 1G5SA 1Q97A 3F5XA 5M44A 4KIPA 4FTCA 2BRGA 1W0XC 2WQMA 3NNWA 3PG1A 4FL2A 2BZJA 3UDBA 4FTMA 4IM0A 5HIEA 3RALA 5H8GA 1FGIA 1Y8GA 2FSTX 3E87A 1KOAA 5EDPA 5KMJA 1O41A 3SRVA 1NW1A 2Z2WA 3EQBA 3U55A 3W0RA 3HMPA 4FTTA 1OMWA 4C4FA 4O82A 2ZV7A 4NYEA 3UPZA 3NHNA 3R9DA 1R1QA 1NY3A 3RAIA 3R1NA 3Q2MA 4ZLYA 4A9RA 1U46A 3VJNA 5HX6A 2V5QA 5KMNA 3C4XA 2E2BA 1BLJA 3PZHA 2B54A 3UPXA 2VO0A 2XVDA 3PE2A 4BTFA 2HK5A 1BL6A 4LMNA 3V6SA 3UDSA 4BJJB 3ZNIA 3UVQA 4EOLA 3OFMA 4EWHA 3DFCB 5DE2A 3LKMA 2JAMA 4UZDA 1Q41A 3EIDA 2OH0E 4W8EA 5DT3A 3NNXA 2QVSE 3F5UA 2YITA 2EUFB 4MNFA 4UY9A 2H5KA 5KHWA 4I5PA 4ANQA 3VRNA 3G9LX 3BBTB 4DN5A 3VROA 3C7QA 4R3RA 1TQMA 3OWJA 4XBRA 2O0UA 2UZUE 3C0GA 3SKCA 3NNVA 1NA7A 4F08A 2QOQA 2QO7A 3PPJA 3QTWA 3LFBA 4FVPA 4U97A 2C5OA 5JRQA 2O63A 3KEXA 2J2IB 4I6FA 3GC9A 4AE6A 2A4LA 1KV1A 3OCSA 4L44A 4O0TA 4H1OA 2AOBA 5HCXA 2ECDA 3WBLA 3IONA 3TIZA 3R8MA 3P78A 2QI8A 3NMUF 4BZOA 4GFOA 4XP0A 2W1DA 3ET7A 3RK7A 3R2YA 3TG1A 2ZM1A 4BL1A 4ZY6A 4AGDA 4J53A 3KXGA 1H1SA 1K9AA 1OZ1A 2UZEA 4DFXE 3A7GA 5F4NA 5T6KA 5IEYA 2R3IA 4JNWA 4ACDA 1O4OA 3QWKA 3UBDA 4XOZA 2VAGA 5L2SA 3BLQA 1URWA 2JKMA 3WZUA 3O8TA 3BBWA 3F82A 4WG4A 2ZB0A 1H24A 2XALA 1KA6A 1FVVA 3S0OA 2ZJWA