2AOAA

Crystal structures of a high-affinity macrocyclic peptide mimetic in complex with the grb2 sh2 domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
b'HPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth factor receptor-bound protein 2
publication title Crystal Structures of a High-affinity Macrocyclic Peptide Mimetic in Complex with the Grb2 SH2 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 19
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2aoaA00
1O4HA 2GSBA 1O4BA 4H1OA 1KA6A 2EYYA 1O4EA 4WWQA 3K2MA 3N8MA 4NWGA 2IZVA 4OHEA 2CI8A 2EO6A 3GXWA 3VGOA 1UUSA 3C7IA 1F1WA 1TZEE 1H9OA 1O49A 4LUDA 4K45A 3VS7A 1OPLA 4FL2A 1O4PA 1Z3KA 1O41A 1JYQA 3VRQA 1JU5A 2ETZA 2K79B 3TKZA 1O47A 3N7YA 2PNAA 5D0JA 2EYZA 1SPSA 3VRNA 3QWYA 1AYCA 1O4LA 4K44A 5DC4A 2XP1A 2L4KA 2MQIA 2H5KA 4M4ZA 1BHHA 2DCRA 2YSXA 4JEGA 1JYRA 5AULA 5HKYA 1RJAA 2MC1A 4LUEA 1SKJA 5KAZA 1BHFA 3IMJA 1QCFA 3HHMB 1YVLA 5EEQA 5HKZA 4OHDA 4TZIA 4OHLA 2DVJA 2VIFA 4XZ0A 3GXXA 1LUMA 3UF4A 1JWOA 2RVFA 1MW4A 4D8KA 1BHHB 1ZFPE 4NWFA 3VROA 3KFJA 2LQWA 3PFVA 5GJHA 1FBVA 1O4RA 3BUOB 3S8OA 2EOBA 1O4MA 2C9WA 4JE4A 3OP0A 4P9ZA 1O4OA 1LCJA 1FHSA 1WQUA 3VS5A 4JGHA 1NZLA 4L1BB 2EKXA 2OQ1A 4F5BA 2MK2A 4QSYA 4OHIA 3EAZA 1GRIA 2DM0A 4A4BA 1A09A 3BUXB 3HCKA 3HIZB 2RORA 5HKWA 5BO4A 2C0OA 1LUNA 2LQNA 2CIAA 1D1ZA 3BKBA 1RPYA 5AXIA 4FBNA 3VS1A 1O4FA 1KC2A 3US4A 1BKMA 1Y57A 1AYAA 1Y1UA 1O48A 2C0TA 2MRKA 1B47A 2CR4A 2K7AB 2RSYA 2Y3AB 4GPLB 1O4KA 2HUWA 1X6CA 5CDWA 1MILA 1HCSB 2IUIA 1SPRA 2FO0A 1BLKA 2SHPA 5EHRA 3GQIB 1R1QA 1SHBA 3VRRA 1BF5A 1GHUA 5IBSA 1A1AA 1NZVA 2B3OA 1O4IA 1A07A 1O42A 4E93A 1A1BA 3BUNB 3PSJA 3MAZA 1RQQC 1IJRA 1I3ZA 1FYRA 4EY0A 1SHDA 2FCIA 4FL3A 2DLYA 1R1SA 2CRHA 1TCEA 2PTKA 1CSZA 1IS0A 5IBMA 1JYUA 2DX0A 2GE9A 2CI9A 3ZNIA 1OO3A 1BKLA 5DC0B 1O4NA 3QWXX 2PLEA 2PNBA 3CWGA 3VRYA 1LUIA 2HDXA 1BLJA 3VS0A 2IUHA 3T04A 1YVHA 3VS6A 1AYDA 1K9AA 1FBZA 1O44A 4DGXA 1BMBA 1HCTB 1LKKA 3PLFB 5GJIA 1FMKA 2EYVA 3M7FA 1M27A 4DGPA 5EHPA 3MXCA 3CD3A 3PQZA 2DLZA 1OO4A 1O4JA 1UURA 5J3XA 4E68A 1O4DA 4F5AA 3VS3A 2LCTA 2L6KA 1G83A 3TL0A 1O4QA 2C0IA 2CS0A 1CWEA 3VRPA 3MXYA 5EG3B 1XA6A 4A4CA 2EL8A 1BM2A 2QMSA 4X6SA 2JYQA 4F59A 2KNOA 3PSKA 1R1PA 4GL9E 3WA4A 2LNWA 2AOBA 3OV1A 4GWFA 3IN8A 2HDVA 1SHAA 1O4CA 4U17A 1O43A 5I6VA 1KSWA 2BBUA 4OHHA 3S9KA 1LKLA 5DF6A 3NHNA 2ABLA 2Y1MA 5EELA 3IN7A 1BFIA 3CXLA 3IMDA 3N84A 4U1PA 2H46E 2OZOA 2ECDA 1AYBA 1QG1E 2AUGA 1AOTF 1D4WA 1O4AA 1NRVA 1AD5A 1O45A 2IUGA 4K11A 5DC9A 3VRZA 1A81A 1FU5A 2L3TA 3BUWB 3OB2B 1BFJA 3VS2A 4EIHA 4K2RA 4XZ1A 3VS4A 1A1EA 2HCKA 1X0NA 4P9VA 3S8LA 1CSYA 1X27A 1O46A 3PJPA 2CBLA 2RMXA 1M61A 4ROJA 3OB1B 1A1CA 1AOUF 1FU6A 3PS5A 2PLDA 4H34A 1O4GA 1PICA 2Y1NA 1OPKA 1AB2A 1LCKA 2EO3A 1KA7A 1CJ1A 3UYOA 2MRJA 1QADA 1F2FA 2H8HA 2AOAA 2SRCA 1D4TA 2HMHA 1CWDL 3OVEA 1A08A 3BUMB 3CBLA 2YU7A 3EACA 1LUKA 1P13A 2EU0A 3S8NA 1BG1A 2LNXA 2KK6A
chains in the Genus database with same CATH superfamily
1O4HA 2GSBA 1O4BA 4H1OA 1KA6A 2EYYA 1O4EA 4WWQA 3K2MA 3N8MA 4NWGA 2IZVA 4OHEA 2CI8A 2EO6A 3GXWA 3VGOA 1UUSA 3C7IA 1F1WA 1TZEE 1H9OA 1O49A 4LUDA 4K45A 3VS7A 1OPLA 4FL2A 1O4PA 1Z3KA 1O41A 1JYQA 3VRQA 1JU5A 2ETZA 2K79B 3TKZA 1O47A 3N7YA 2PNAA 5D0JA 2EYZA 1SPSA 3VRNA 3QWYA 1AYCA 2KGYA 1O4LA 4K44A 5DC4A 2XP1A 2L4KA 2MQIA 2H5KA 4M4ZA 1BHHA 2DCRA 2YSXA 4JEGA 1JYRA 5AULA 5HKYA 1RJAA 2MC1A 4LUEA 1SKJA 5KAZA 1BHFA 3IMJA 1QCFA 3HHMB 1YVLA 5EEQA 5HKZA 4OHDA 4TZIA 4OHLA 2DVJA 2VIFA 4XZ0A 3GXXA 1LUMA 3UF4A 1JWOA 2RVFA 1MW4A 4D8KA 1BHHB 1ZFPE 4NWFA 3VROA 3KFJA 2LQWA 3PFVA 5GJHA 1FBVA 1O4RA 3BUOB 3S8OA 2EOBA 1O4MA 2C9WA 4JE4A 3OP0A 4P9ZA 1O4OA 1LCJA 1FHSA 1WQUA 3VS5A 4JGHA 1NZLA 4L1BB 2EKXA 2OQ1A 4F5BA 2MK2A 4QSYA 4OHIA 3EAZA 1GRIA 2DM0A 4A4BA 1A09A 3BUXB 3HCKA 3HIZB 2RORA 5HKWA 5BO4A 2C0OA 1LUNA 2LQNA 2CIAA 1D1ZA 3BKBA 1RPYA 5AXIA 4FBNA 3VS1A 1O4FA 1KC2A 3US4A 1BKMA 1Y57A 1AYAA 1Y1UA 1O48A 2C0TA 2MRKA 1B47A 2CR4A 2K7AB 2RSYA 2Y3AB 4GPLB 1O4KA 2HUWA 1X6CA 5CDWA 1MILA 1HCSB 2IUIA 1SPRA 2FO0A 1BLKA 2SHPA 5EHRA 3GQIB 1R1QA 1SHBA 3VRRA 1BF5A 1GHUA 5IBSA 1A1AA 1NZVA 2B3OA 1O4IA 1A07A 1O42A 4E93A 1A1BA 3BUNB 3PSJA 3MAZA 1RQQC 1IJRA 1I3ZA 1FYRA 4EY0A 1SHDA 2FCIA 4FL3A 2DLYA 1R1SA 2CRHA 1TCEA 2PTKA 1CSZA 1IS0A 5IBMA 1JYUA 2DX0A 2GE9A 2CI9A 3ZNIA 1OO3A 1BKLA 5DC0B 1O4NA 3QWXX 2PLEA 2PNBA 3CWGA 3VRYA 1LUIA 2HDXA 1BLJA 3VS0A 2IUHA 3T04A 1YVHA 3VS6A 1AYDA 1K9AA 1FBZA 1O44A 4DGXA 3K2TA 1BMBA 1HCTB 1LKKA 3PLFB 5GJIA 1FMKA 2EYVA 3M7FA 1M27A 4DGPA 5EHPA 3MXCA 3CD3A 3PQZA 2DLZA 1OO4A 1O4JA 1UURA 5J3XA 4E68A 1O4DA 4F5AA 3VS3A 2LCTA 2L6KA 1G83A 3TL0A 1O4QA 2C0IA 2CS0A 1CWEA 3VRPA 3MXYA 5EG3B 1XA6A 4A4CA 2EL8A 1BM2A 2QMSA 4X6SA 2JYQA 4F59A 2KNOA 3PSKA 1R1PA 4GL9E 3WA4A 2LNWA 2AOBA 3OV1A 4GWFA 3IN8A 2HDVA 1SHAA 1O4CA 4U17A 1O43A 2LRAA 5I6VA 1KSWA 2BBUA 4OHHA 3S9KA 1LKLA 5DF6A 3NHNA 2ABLA 2Y1MA 5EELA 3IN7A 1BFIA 3CXLA 3IMDA 3N84A 4U1PA 2H46E 2OZOA 2ECDA 1AYBA 1QG1E 2AUGA 1AOTF 1D4WA 1O4AA 1NRVA 1AD5A 1O45A 2IUGA 4K11A 5DC9A 3VRZA 1A81A 1FU5A 2L3TA 3BUWB 3OB2B 1BFJA 3VS2A 4EIHA 4K2RA 4XZ1A 3VS4A 1A1EA 2HCKA 1X0NA 4P9VA 3S8LA 1CSYA 1X27A 1O46A 3PJPA 2CBLA 2RMXA 1M61A 4ROJA 3OB1B 1A1CA 1AOUF 1FU6A 3PS5A 2PLDA 4H34A 1O4GA 1PICA 2Y1NA 1OPKA 1AB2A 1LCKA 2EO3A 1KA7A 1CJ1A 3UYOA 2MRJA 1QADA 1F2FA 2H8HA 2AOAA 2SRCA 1D4TA 3LYVA 2HMHA 1CWDL 3OVEA 1A08A 3BUMB 3CBLA 2YU7A 3EACA 1LUKA 1P13A 2EU0A 3S8NA 1BG1A 2LNXA 2KK6A
chains in the Genus database with same CATH topology
1O4HA 2GSBA 1O4BA 4H1OA 1KA6A 2EYYA 1O4EA 4WWQA 3K2MA 3N8MA 4NWGA 2IZVA 4OHEA 2CI8A 2EO6A 3GXWA 3VGOA 1UUSA 3C7IA 1F1WA 1TZEE 1H9OA 1O49A 4LUDA 4K45A 3VS7A 1OPLA 4FL2A 1O4PA 1Z3KA 1O41A 1JYQA 3VRQA 1JU5A 2ETZA 2K79B 3TKZA 1O47A 3N7YA 2PNAA 5D0JA 2EYZA 1SPSA 3VRNA 3QWYA 1AYCA 1O4LA 4K44A 5DC4A 2XP1A 2L4KA 2MQIA 2H5KA 4M4ZA 1BHHA 2DCRA 2YSXA 4JEGA 1JYRA 5AULA 5HKYA 1RJAA 2MC1A 4LUEA 1SKJA 5KAZA 1BHFA 3IMJA 1QCFA 3HHMB 1YVLA 5EEQA 5HKZA 4OHDA 4TZIA 4OHLA 2DVJA 2VIFA 4XZ0A 3GXXA 1LUMA 3UF4A 1JWOA 2RVFA 1MW4A 4D8KA 1BHHB 1ZFPE 4NWFA 3VROA 3KFJA 2LQWA 3PFVA 5GJHA 1FBVA 1O4RA 3BUOB 3S8OA 2EOBA 1O4MA 2C9WA 4JE4A 3OP0A 4P9ZA 1O4OA 1LCJA 1FHSA 1WQUA 3VS5A 4JGHA 1NZLA 4L1BB 2EKXA 2OQ1A 4F5BA 2MK2A 4QSYA 4OHIA 3EAZA 1GRIA 2DM0A 4A4BA 1A09A 3BUXB 3HCKA 3HIZB 2RORA 5HKWA 5BO4A 2C0OA 1LUNA 2LQNA 2CIAA 1D1ZA 3BKBA 1RPYA 5AXIA 4FBNA 3VS1A 1O4FA 1KC2A 3US4A 1BKMA 1Y57A 1AYAA 1Y1UA 1O48A 2C0TA 2MRKA 1B47A 2CR4A 2K7AB 2RSYA 2Y3AB 4GPLB 1O4KA 2HUWA 1X6CA 5CDWA 1MILA 1HCSB 2IUIA 1SPRA 2FO0A 1BLKA 2SHPA 5EHRA 3GQIB 1R1QA 1SHBA 3VRRA 1BF5A 1GHUA 5IBSA 1A1AA 1NZVA 2B3OA 1O4IA 1A07A 1O42A 4E93A 1A1BA 3BUNB 3PSJA 3MAZA 1RQQC 1IJRA 1I3ZA 1FYRA 4EY0A 1SHDA 2FCIA 4FL3A 2DLYA 1R1SA 2CRHA 1TCEA 2PTKA 1CSZA 1IS0A 5IBMA 1JYUA 2DX0A 2GE9A 2CI9A 3ZNIA 1OO3A 1BKLA 5DC0B 1O4NA 3QWXX 2PLEA 2PNBA 3CWGA 3VRYA 1LUIA 2HDXA 1BLJA 3VS0A 2IUHA 3T04A 1YVHA 3VS6A 1AYDA 1K9AA 1FBZA 1O44A 4DGXA 1BMBA 1HCTB 1LKKA 3PLFB 5GJIA 1FMKA 2EYVA 3M7FA 1M27A 4DGPA 5EHPA 3MXCA 3CD3A 3PQZA 2DLZA 1OO4A 1O4JA 1UURA 5J3XA 4E68A 1O4DA 4F5AA 3VS3A 2LCTA 2L6KA 1G83A 3TL0A 1O4QA 2C0IA 2CS0A 1CWEA 3VRPA 3MXYA 5EG3B 1XA6A 4A4CA 2EL8A 1BM2A 2QMSA 4X6SA 2JYQA 4F59A 2KNOA 3PSKA 1R1PA 4GL9E 3WA4A 2LNWA 2AOBA 3OV1A 4GWFA 3IN8A 2HDVA 1SHAA 1O4CA 4U17A 1O43A 5I6VA 1KSWA 2BBUA 4OHHA 3S9KA 1LKLA 5DF6A 3NHNA 2ABLA 2Y1MA 5EELA 3IN7A 1BFIA 3CXLA 3IMDA 3N84A 4U1PA 2H46E 2OZOA 2ECDA 1AYBA 1QG1E 2AUGA 1AOTF 1D4WA 1O4AA 1NRVA 1AD5A 1O45A 2IUGA 4K11A 5DC9A 3VRZA 1A81A 1FU5A 2L3TA 3BUWB 3OB2B 1BFJA 3VS2A 4EIHA 4K2RA 4XZ1A 3VS4A 1A1EA 2HCKA 1X0NA 4P9VA 3S8LA 1CSYA 1X27A 1O46A 3PJPA 2CBLA 2RMXA 1M61A 4ROJA 3OB1B 1A1CA 1AOUF 1FU6A 3PS5A 2PLDA 4H34A 1O4GA 1PICA 2Y1NA 1OPKA 1AB2A 1LCKA 2EO3A 1KA7A 1CJ1A 3UYOA 2MRJA 1QADA 1F2FA 2H8HA 2AOAA 2SRCA 1D4TA 2HMHA 1CWDL 3OVEA 1A08A 3BUMB 3CBLA 2YU7A 3EACA 1LUKA 1P13A 2EU0A 3S8NA 1BG1A 2LNXA 2KK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O4H A;  2GSB A;  1O4B A;  4H1O A;  1KA6 A;  2EYY A;  1O4E A;  4WWQ A;  3K2M A;  3N8M A;  4NWG A;  2IZV A;  4OHE A;  2CI8 A;  2EO6 A;  3GXW A;  3VGO A;  1UUS A;  3C7I A;  1F1W A;  1TZE E;  1H9O A;  1O49 A;  4LUD A;  4K45 A;  3VS7 A;  1OPL A;  4FL2 A;  1O4P A;  1Z3K A;  1O41 A;  1JYQ A;  3VRQ A;  1JU5 A;  2ETZ A;  2K79 B;  3TKZ A;  1O47 A;  3N7Y A;  2PNA A;  5D0J A;  2EYZ A;  1SPS A;  3VRN A;  3QWY A;  1AYC A;  1O4L A;  4K44 A;  5DC4 A;  2XP1 A;  2L4K A;  2MQI A;  2H5K A;  4M4Z A;  1BHH A;  2DCR A;  2YSX A;  4JEG A;  1JYR A;  5AUL A;  5HKY A;  1RJA A;  2MC1 A;  4LUE A;  1SKJ A;  5KAZ A;  1BHF A;  3IMJ A;  1QCF A;  3HHM B;  1YVL A;  5EEQ A;  5HKZ A;  4OHD A;  4TZI A;  4OHL A;  2DVJ A;  2VIF A;  4XZ0 A;  3GXX A;  1LUM A;  3UF4 A;  1JWO A;  2RVF A;  1MW4 A;  4D8K A;  1BHH B;  1ZFP E;  4NWF A;  3VRO A;  3KFJ A;  2LQW A;  3PFV A;  5GJH A;  1FBV A;  1O4R A;  3BUO B;  3S8O A;  2EOB A;  1O4M A;  2C9W A;  4JE4 A;  3OP0 A;  4P9Z A;  1O4O A;  1LCJ A;  1FHS A;  1WQU A;  3VS5 A;  4JGH A;  1NZL A;  4L1B B;  2EKX A;  2OQ1 A;  4F5B A;  2MK2 A;  4QSY A;  4OHI A;  3EAZ A;  1GRI A;  2DM0 A;  4A4B A;  1A09 A;  3BUX B;  3HCK A;  3HIZ B;  2ROR A;  5HKW A;  5BO4 A;  2C0O A;  1LUN A;  2LQN A;  2CIA A;  1D1Z A;  3BKB A;  1RPY A;  5AXI A;  4FBN A;  3VS1 A;  1O4F A;  1KC2 A;  3US4 A;  1BKM A;  1Y57 A;  1AYA A;  1Y1U A;  1O48 A;  2C0T A;  2MRK A;  1B47 A;  2CR4 A;  2K7A B;  2RSY A;  2Y3A B;  4GPL B;  1O4K A;  2HUW A;  1X6C A;  5CDW A;  1MIL A;  1HCS B;  2IUI A;  1SPR A;  2FO0 A;  1BLK A;  2SHP A;  5EHR A;  3GQI B;  1R1Q A;  1SHB A;  3VRR A;  1BF5 A;  1GHU A;  5IBS A;  1A1A A;  1NZV A;  2B3O A;  1O4I A;  1A07 A;  1O42 A;  4E93 A;  1A1B A;  3BUN B;  3PSJ A;  3MAZ A;  1RQQ C;  1IJR A;  1I3Z A;  1FYR A;  4EY0 A;  1SHD A;  2FCI A;  4FL3 A;  2DLY A;  1R1S A;  2CRH A;  1TCE A;  2PTK A;  1CSZ A;  1IS0 A;  5IBM A;  1JYU A;  2DX0 A;  2GE9 A;  2CI9 A;  3ZNI A;  1OO3 A;  1BKL A;  5DC0 B;  1O4N A;  3QWX X;  2PLE A;  2PNB A;  3CWG A;  3VRY A;  1LUI A;  2HDX A;  1BLJ A;  3VS0 A;  2IUH A;  3T04 A;  1YVH A;  3VS6 A;  1AYD A;  1K9A A;  1FBZ A;  1O44 A;  4DGX A;  1BMB A;  1HCT B;  1LKK A;  3PLF B;  5GJI A;  1FMK A;  2EYV A;  3M7F A;  1M27 A;  4DGP A;  5EHP A;  3MXC A;  3CD3 A;  3PQZ A;  2DLZ A;  1OO4 A;  1O4J A;  1UUR A;  5J3X A;  4E68 A;  1O4D A;  4F5A A;  3VS3 A;  2LCT A;  2L6K A;  1G83 A;  3TL0 A;  1O4Q A;  2C0I A;  2CS0 A;  1CWE A;  3VRP A;  3MXY A;  5EG3 B;  1XA6 A;  4A4C A;  2EL8 A;  1BM2 A;  2QMS A;  4X6S A;  2JYQ A;  4F59 A;  2KNO A;  3PSK A;  1R1P A;  4GL9 E;  3WA4 A;  2LNW A;  2AOB A;  3OV1 A;  4GWF A;  3IN8 A;  2HDV A;  1SHA A;  1O4C A;  4U17 A;  1O43 A;  5I6V A;  1KSW A;  2BBU A;  4OHH A;  3S9K A;  1LKL A;  5DF6 A;  3NHN A;  2ABL A;  2Y1M A;  5EEL A;  3IN7 A;  1BFI A;  3CXL A;  3IMD A;  3N84 A;  4U1P A;  2H46 E;  2OZO A;  2ECD A;  1AYB A;  1QG1 E;  2AUG A;  1AOT F;  1D4W A;  1O4A A;  1NRV A;  1AD5 A;  1O45 A;  2IUG A;  4K11 A;  5DC9 A;  3VRZ A;  1A81 A;  1FU5 A;  2L3T A;  3BUW B;  3OB2 B;  1BFJ A;  3VS2 A;  4EIH A;  4K2R A;  4XZ1 A;  3VS4 A;  1A1E A;  2HCK A;  1X0N A;  4P9V A;  3S8L A;  1CSY A;  1X27 A;  1O46 A;  3PJP A;  2CBL A;  2RMX A;  1M61 A;  4ROJ A;  3OB1 B;  1A1C A;  1AOU F;  1FU6 A;  3PS5 A;  2PLD A;  4H34 A;  1O4G A;  1PIC A;  2Y1N A;  1OPK A;  1AB2 A;  1LCK A;  2EO3 A;  1KA7 A;  1CJ1 A;  3UYO A;  2MRJ A;  1QAD A;  1F2F A;  2H8H A;  2AOA A;  2SRC A;  1D4T A;  2HMH A;  1CWD L;  3OVE A;  1A08 A;  3BUM B;  3CBL A;  2YU7 A;  3EAC A;  1LUK A;  1P13 A;  2EU0 A;  3S8N A;  1BG1 A;  2LNX A;  2KK6 A; 
#chains in the Genus database with same CATH topology
 1O4H A;  2GSB A;  1O4B A;  4H1O A;  1KA6 A;  2EYY A;  1O4E A;  4WWQ A;  3K2M A;  3N8M A;  4NWG A;  2IZV A;  4OHE A;  2CI8 A;  2EO6 A;  3GXW A;  3VGO A;  1UUS A;  3C7I A;  1F1W A;  1TZE E;  1H9O A;  1O49 A;  4LUD A;  4K45 A;  3VS7 A;  1OPL A;  4FL2 A;  1O4P A;  1Z3K A;  1O41 A;  1JYQ A;  3VRQ A;  1JU5 A;  2ETZ A;  2K79 B;  3TKZ A;  1O47 A;  3N7Y A;  2PNA A;  5D0J A;  2EYZ A;  1SPS A;  3VRN A;  3QWY A;  1AYC A;  2KGY A;  1O4L A;  4K44 A;  5DC4 A;  2XP1 A;  2L4K A;  2MQI A;  2H5K A;  4M4Z A;  1BHH A;  2DCR A;  2YSX A;  4JEG A;  1JYR A;  5AUL A;  5HKY A;  1RJA A;  2MC1 A;  4LUE A;  1SKJ A;  5KAZ A;  1BHF A;  3IMJ A;  1QCF A;  3HHM B;  1YVL A;  5EEQ A;  5HKZ A;  4OHD A;  4TZI A;  4OHL A;  2DVJ A;  2VIF A;  4XZ0 A;  3GXX A;  1LUM A;  3UF4 A;  1JWO A;  2RVF A;  1MW4 A;  4D8K A;  1BHH B;  1ZFP E;  4NWF A;  3VRO A;  3KFJ A;  2LQW A;  3PFV A;  5GJH A;  1FBV A;  1O4R A;  3BUO B;  3S8O A;  2EOB A;  1O4M A;  2C9W A;  4JE4 A;  3OP0 A;  4P9Z A;  1O4O A;  1LCJ A;  1FHS A;  1WQU A;  3VS5 A;  4JGH A;  1NZL A;  4L1B B;  2EKX A;  2OQ1 A;  4F5B A;  2MK2 A;  4QSY A;  4OHI A;  3EAZ A;  1GRI A;  2DM0 A;  4A4B A;  1A09 A;  3BUX B;  3HCK A;  3HIZ B;  2ROR A;  5HKW A;  5BO4 A;  2C0O A;  1LUN A;  2LQN A;  2CIA A;  1D1Z A;  3BKB A;  1RPY A;  5AXI A;  4FBN A;  3VS1 A;  1O4F A;  1KC2 A;  3US4 A;  1BKM A;  1Y57 A;  1AYA A;  1Y1U A;  1O48 A;  2C0T A;  2MRK A;  1B47 A;  2CR4 A;  2K7A B;  2RSY A;  2Y3A B;  4GPL B;  1O4K A;  2HUW A;  1X6C A;  5CDW A;  1MIL A;  1HCS B;  2IUI A;  1SPR A;  2FO0 A;  1BLK A;  2SHP A;  5EHR A;  3GQI B;  1R1Q A;  1SHB A;  3VRR A;  1BF5 A;  1GHU A;  5IBS A;  1A1A A;  1NZV A;  2B3O A;  1O4I A;  1A07 A;  1O42 A;  4E93 A;  1A1B A;  3BUN B;  3PSJ A;  3MAZ A;  1RQQ C;  1IJR A;  1I3Z A;  1FYR A;  4EY0 A;  1SHD A;  2FCI A;  4FL3 A;  2DLY A;  1R1S A;  2CRH A;  1TCE A;  2PTK A;  1CSZ A;  1IS0 A;  5IBM A;  1JYU A;  2DX0 A;  2GE9 A;  2CI9 A;  3ZNI A;  1OO3 A;  1BKL A;  5DC0 B;  1O4N A;  3QWX X;  2PLE A;  2PNB A;  3CWG A;  3VRY A;  1LUI A;  2HDX A;  1BLJ A;  3VS0 A;  2IUH A;  3T04 A;  1YVH A;  3VS6 A;  1AYD A;  1K9A A;  1FBZ A;  1O44 A;  4DGX A;  3K2T A;  1BMB A;  1HCT B;  1LKK A;  3PLF B;  5GJI A;  1FMK A;  2EYV A;  3M7F A;  1M27 A;  4DGP A;  5EHP A;  3MXC A;  3CD3 A;  3PQZ A;  2DLZ A;  1OO4 A;  1O4J A;  1UUR A;  5J3X A;  4E68 A;  1O4D A;  4F5A A;  3VS3 A;  2LCT A;  2L6K A;  1G83 A;  3TL0 A;  1O4Q A;  2C0I A;  2CS0 A;  1CWE A;  3VRP A;  3MXY A;  5EG3 B;  1XA6 A;  4A4C A;  2EL8 A;  1BM2 A;  2QMS A;  4X6S A;  2JYQ A;  4F59 A;  2KNO A;  3PSK A;  1R1P A;  4GL9 E;  3WA4 A;  2LNW A;  2AOB A;  3OV1 A;  4GWF A;  3IN8 A;  2HDV A;  1SHA A;  1O4C A;  4U17 A;  1O43 A;  2LRA A;  5I6V A;  1KSW A;  2BBU A;  4OHH A;  3S9K A;  1LKL A;  5DF6 A;  3NHN A;  2ABL A;  2Y1M A;  5EEL A;  3IN7 A;  1BFI A;  3CXL A;  3IMD A;  3N84 A;  4U1P A;  2H46 E;  2OZO A;  2ECD A;  1AYB A;  1QG1 E;  2AUG A;  1AOT F;  1D4W A;  1O4A A;  1NRV A;  1AD5 A;  1O45 A;  2IUG A;  4K11 A;  5DC9 A;  3VRZ A;  1A81 A;  1FU5 A;  2L3T A;  3BUW B;  3OB2 B;  1BFJ A;  3VS2 A;  4EIH A;  4K2R A;  4XZ1 A;  3VS4 A;  1A1E A;  2HCK A;  1X0N A;  4P9V A;  3S8L A;  1CSY A;  1X27 A;  1O46 A;  3PJP A;  2CBL A;  2RMX A;  1M61 A;  4ROJ A;  3OB1 B;  1A1C A;  1AOU F;  1FU6 A;  3PS5 A;  2PLD A;  4H34 A;  1O4G A;  1PIC A;  2Y1N A;  1OPK A;  1AB2 A;  1LCK A;  2EO3 A;  1KA7 A;  1CJ1 A;  3UYO A;  2MRJ A;  1QAD A;  1F2F A;  2H8H A;  2AOA A;  2SRC A;  1D4T A;  3LYV A;  2HMH A;  1CWD L;  3OVE A;  1A08 A;  3BUM B;  3CBL A;  2YU7 A;  3EAC A;  1LUK A;  1P13 A;  2EU0 A;  3S8N A;  1BG1 A;  2LNX A;  2KK6 A; 
#chains in the Genus database with same CATH homology
 1O4H A;  2GSB A;  1O4B A;  4H1O A;  1KA6 A;  2EYY A;  1O4E A;  4WWQ A;  3K2M A;  3N8M A;  4NWG A;  2IZV A;  4OHE A;  2CI8 A;  2EO6 A;  3GXW A;  3VGO A;  1UUS A;  3C7I A;  1F1W A;  1TZE E;  1H9O A;  1O49 A;  4LUD A;  4K45 A;  3VS7 A;  1OPL A;  4FL2 A;  1O4P A;  1Z3K A;  1O41 A;  1JYQ A;  3VRQ A;  1JU5 A;  2ETZ A;  2K79 B;  3TKZ A;  1O47 A;  3N7Y A;  2PNA A;  5D0J A;  2EYZ A;  1SPS A;  3VRN A;  3QWY A;  1AYC A;  1O4L A;  4K44 A;  5DC4 A;  2XP1 A;  2L4K A;  2MQI A;  2H5K A;  4M4Z A;  1BHH A;  2DCR A;  2YSX A;  4JEG A;  1JYR A;  5AUL A;  5HKY A;  1RJA A;  2MC1 A;  4LUE A;  1SKJ A;  5KAZ A;  1BHF A;  3IMJ A;  1QCF A;  3HHM B;  1YVL A;  5EEQ A;  5HKZ A;  4OHD A;  4TZI A;  4OHL A;  2DVJ A;  2VIF A;  4XZ0 A;  3GXX A;  1LUM A;  3UF4 A;  1JWO A;  2RVF A;  1MW4 A;  4D8K A;  1BHH B;  1ZFP E;  4NWF A;  3VRO A;  3KFJ A;  2LQW A;  3PFV A;  5GJH A;  1FBV A;  1O4R A;  3BUO B;  3S8O A;  2EOB A;  1O4M A;  2C9W A;  4JE4 A;  3OP0 A;  4P9Z A;  1O4O A;  1LCJ A;  1FHS A;  1WQU A;  3VS5 A;  4JGH A;  1NZL A;  4L1B B;  2EKX A;  2OQ1 A;  4F5B A;  2MK2 A;  4QSY A;  4OHI A;  3EAZ A;  1GRI A;  2DM0 A;  4A4B A;  1A09 A;  3BUX B;  3HCK A;  3HIZ B;  2ROR A;  5HKW A;  5BO4 A;  2C0O A;  1LUN A;  2LQN A;  2CIA A;  1D1Z A;  3BKB A;  1RPY A;  5AXI A;  4FBN A;  3VS1 A;  1O4F A;  1KC2 A;  3US4 A;  1BKM A;  1Y57 A;  1AYA A;  1Y1U A;  1O48 A;  2C0T A;  2MRK A;  1B47 A;  2CR4 A;  2K7A B;  2RSY A;  2Y3A B;  4GPL B;  1O4K A;  2HUW A;  1X6C A;  5CDW A;  1MIL A;  1HCS B;  2IUI A;  1SPR A;  2FO0 A;  1BLK A;  2SHP A;  5EHR A;  3GQI B;  1R1Q A;  1SHB A;  3VRR A;  1BF5 A;  1GHU A;  5IBS A;  1A1A A;  1NZV A;  2B3O A;  1O4I A;  1A07 A;  1O42 A;  4E93 A;  1A1B A;  3BUN B;  3PSJ A;  3MAZ A;  1RQQ C;  1IJR A;  1I3Z A;  1FYR A;  4EY0 A;  1SHD A;  2FCI A;  4FL3 A;  2DLY A;  1R1S A;  2CRH A;  1TCE A;  2PTK A;  1CSZ A;  1IS0 A;  5IBM A;  1JYU A;  2DX0 A;  2GE9 A;  2CI9 A;  3ZNI A;  1OO3 A;  1BKL A;  5DC0 B;  1O4N A;  3QWX X;  2PLE A;  2PNB A;  3CWG A;  3VRY A;  1LUI A;  2HDX A;  1BLJ A;  3VS0 A;  2IUH A;  3T04 A;  1YVH A;  3VS6 A;  1AYD A;  1K9A A;  1FBZ A;  1O44 A;  4DGX A;  1BMB A;  1HCT B;  1LKK A;  3PLF B;  5GJI A;  1FMK A;  2EYV A;  3M7F A;  1M27 A;  4DGP A;  5EHP A;  3MXC A;  3CD3 A;  3PQZ A;  2DLZ A;  1OO4 A;  1O4J A;  1UUR A;  5J3X A;  4E68 A;  1O4D A;  4F5A A;  3VS3 A;  2LCT A;  2L6K A;  1G83 A;  3TL0 A;  1O4Q A;  2C0I A;  2CS0 A;  1CWE A;  3VRP A;  3MXY A;  5EG3 B;  1XA6 A;  4A4C A;  2EL8 A;  1BM2 A;  2QMS A;  4X6S A;  2JYQ A;  4F59 A;  2KNO A;  3PSK A;  1R1P A;  4GL9 E;  3WA4 A;  2LNW A;  2AOB A;  3OV1 A;  4GWF A;  3IN8 A;  2HDV A;  1SHA A;  1O4C A;  4U17 A;  1O43 A;  5I6V A;  1KSW A;  2BBU A;  4OHH A;  3S9K A;  1LKL A;  5DF6 A;  3NHN A;  2ABL A;  2Y1M A;  5EEL A;  3IN7 A;  1BFI A;  3CXL A;  3IMD A;  3N84 A;  4U1P A;  2H46 E;  2OZO A;  2ECD A;  1AYB A;  1QG1 E;  2AUG A;  1AOT F;  1D4W A;  1O4A A;  1NRV A;  1AD5 A;  1O45 A;  2IUG A;  4K11 A;  5DC9 A;  3VRZ A;  1A81 A;  1FU5 A;  2L3T A;  3BUW B;  3OB2 B;  1BFJ A;  3VS2 A;  4EIH A;  4K2R A;  4XZ1 A;  3VS4 A;  1A1E A;  2HCK A;  1X0N A;  4P9V A;  3S8L A;  1CSY A;  1X27 A;  1O46 A;  3PJP A;  2CBL A;  2RMX A;  1M61 A;  4ROJ A;  3OB1 B;  1A1C A;  1AOU F;  1FU6 A;  3PS5 A;  2PLD A;  4H34 A;  1O4G A;  1PIC A;  2Y1N A;  1OPK A;  1AB2 A;  1LCK A;  2EO3 A;  1KA7 A;  1CJ1 A;  3UYO A;  2MRJ A;  1QAD A;  1F2F A;  2H8H A;  2AOA A;  2SRC A;  1D4T A;  2HMH A;  1CWD L;  3OVE A;  1A08 A;  3BUM B;  3CBL A;  2YU7 A;  3EAC A;  1LUK A;  1P13 A;  2EU0 A;  3S8N A;  1BG1 A;  2LNX A;  2KK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...