4K44A

Auto-inhibition and phosphorylation-induced activation of plc-gamma isozymes
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
b'SQAESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase ga
publication title Autoinhibition and Phosphorylation-Induced Activation of Phospholipase C-gamma Isozymes.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 24
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2013-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4k44A00
2H46E 1O4GA 4F5BA 3PLFB 3HCKA 2Y1MA 1TZEE 4OHEA 3PJPA 2QMSA 2CIAA 2LNXA 1FU6A 1LUKA 5IBMA 1TCEA 1FU5A 3VRYA 3VGOA 5DF6A 5D0JA 1Z3KA 5DC9A 1A1BA 3OV1A 2LNWA 3EAZA 4EIHA 1Y57A 1JU5A 1BHHB 2K7AB 3S9KA 3QWXX 3S8OA 3CD3A 1UUSA 1OPLA 3M7FA 1JYUA 1A1EA 1AB2A 1D1ZA 2H5KA 5DC0B 1IJRA 3BUXB 3PS5A 2BBUA 1O4RA 2FO0A 1P13A 3GXXA 4LUEA 1AOUF 2C0IA 1LKKA 3VS2A 2K79B 3MAZA 4NWFA 1R1QA 1NZLA 1NZVA 1CSYA 1YVLA 1O4BA 4U17A 1O4DA 1BF5A 5HKWA 1WQUA 2RVFA 3PSKA 1ZFPE 5EEQA 2GSBA 1XA6A 1AYCA 1CSZA 5I6VA 3PFVA 1HCTB 4GWFA 2KNOA 2RORA 1IS0A 1OO4A 3BUNB 1BKLA 3N7YA 3CWGA 1RJAA 1O4CA 2Y1NA 1G83A 1O48A 1JYQA 1QCFA 2LQWA 2IUIA 1O4FA 5DC4A 3GXWA 1KC2A 1R1SA 1AOTF 2CI8A 1A81A 2ABLA 1BHFA 1NRVA 3IMDA 1LUMA 4D8KA 2AOBA 3IN7A 2FCIA 3IN8A 2ECDA 3T04A 1FMKA 2DX0A 4F5AA 4OHHA 4L1BB 1CWEA 1SPSA 3N8MA 4OHIA 3VS7A 2YU7A 3UYOA 3VRPA 4GL9E 2DVJA 2PTKA 2C9WA 5GJIA 2DM0A 4DGXA 3ZNIA 3VS0A 5BO4A 2AUGA 2SHPA 2YSXA 3PQZA 3VS3A 2C0OA 2DLZA 1O41A 4K45A 1O4AA 2PNAA 1R1PA 5EHPA 4XZ0A 3EACA 3OB2B 3OB1B 2JYQA 2PLEA 4TZIA 1SHDA 3IMJA 2ETZA 3OP0A 3S8NA 5HKYA 1O4KA 1A07A 2CR4A 2GE9A 2IZVA 2EOBA 2IUGA 3HIZB 3NHNA 3VRRA 4A4CA 4DGPA 5AXIA 1FYRA 2EYVA 4FL2A 1LCKA 2EYZA 1O4LA 3QWYA 1KA6A 1FHSA 1O46A 3BKBA 1BMBA 2HCKA 3GQIB 1BM2A 3PSJA 1A1CA 1RQQC 4H1OA 1A08A 3CXLA 1BLKA 1LKLA 1YVHA 3BUMB 1SHBA 1BFIA 2H8HA 2CS0A 1SPRA 3VRQA 1KSWA 4X6SA 5KAZA 1A09A 2C0TA 4P9ZA 2RSYA 3VS4A 2LCTA 1O4JA 1O45A 1O4OA 2EYYA 1LCJA 4A4BA 2IUHA 1O44A 1O49A 1O4QA 1BFJA 1X6CA 1O4PA 2L6KA 1B47A 4GPLB 2HUWA 1FBZA 4EY0A 3TKZA 2HMHA 3N84A 3UF4A 2Y3AB 1CWDL 4E93A 5IBSA 5GJHA 1O4MA 3KFJA 4LUDA 2HDVA 3BUWB 4E68A 2XP1A 1F1WA 2SRCA 2OZOA 4U1PA 2VIFA 2RMXA 2AOAA 2EO3A 1M61A 2B3OA 2EO6A 5J3XA 1MW4A 3BUOB 2EU0A 1O4EA 1BLJA 1AD5A 4FBNA 1O47A 5AULA 1CJ1A 4K11A 3MXCA 5CDWA 1O42A 1UURA 1O4NA 4XZ1A 2LQNA 4ROJA 1OPKA 1K9AA 1M27A 2MQIA 2EKXA 2PLDA 4K2RA 1O43A 2MK2A 3TL0A 2HDXA 1X27A 1BG1A 1BKMA 1FBVA 3WA4A 2PNBA 5HKZA 1PICA 2EL8A 3VRZA 1GHUA 1OO3A 1LUNA 1O4HA 2DLYA 3US4A 4M4ZA 4K44A 1D4TA 1BHHA 3C7IA 1MILA 4JGHA 5EELA 3HHMB 2L4KA 1JYRA 1I3ZA 2CBLA 4F59A 2MC1A 2MRKA 2MRJA 1JWOA 1GRIA 2DCRA 4P9VA 5EHRA 1Y1UA 3VS5A 4NWGA 4QSYA 2CRHA 4OHLA 2OQ1A 1X0NA 1SKJA 2KK6A 1QG1E 1D4WA 3VS1A 3VROA 1RPYA 3OVEA 2CI9A 1HCSB 3VS6A 1A1AA 1LUIA 1SHAA 1AYBA 2L3TA 4OHDA 3CBLA 3MXYA 1F2FA 3VRNA 5EG3B 1H9OA 4H34A 4JE4A 1QADA 1AYAA 4FL3A 4JEGA 3K2MA 3S8LA 1KA7A 1AYDA 4WWQA 1O4IA
chains in the Genus database with same CATH superfamily
2H46E 1O4GA 4F5BA 3PLFB 3HCKA 2Y1MA 1TZEE 4OHEA 3PJPA 2QMSA 2CIAA 2LNXA 1FU6A 1LUKA 5IBMA 1TCEA 1FU5A 3VRYA 3VGOA 5DF6A 5D0JA 1Z3KA 5DC9A 1A1BA 3OV1A 3K2TA 2LNWA 3EAZA 4EIHA 1Y57A 1JU5A 1BHHB 2K7AB 3S9KA 3QWXX 3S8OA 3CD3A 1UUSA 1OPLA 3M7FA 1JYUA 1A1EA 1AB2A 1D1ZA 2H5KA 5DC0B 1IJRA 3BUXB 3PS5A 2BBUA 1O4RA 2FO0A 1P13A 3GXXA 4LUEA 1AOUF 2C0IA 1LKKA 3VS2A 2K79B 3MAZA 4NWFA 1R1QA 1NZLA 1NZVA 1CSYA 1YVLA 1O4BA 4U17A 1O4DA 1BF5A 5HKWA 1WQUA 2RVFA 3PSKA 1ZFPE 5EEQA 2GSBA 1XA6A 2LRAA 1AYCA 1CSZA 5I6VA 3PFVA 1HCTB 4GWFA 2KNOA 2RORA 1IS0A 1OO4A 3BUNB 1BKLA 3N7YA 3CWGA 1RJAA 1O4CA 2Y1NA 1G83A 1O48A 1JYQA 1QCFA 2LQWA 2IUIA 1O4FA 5DC4A 3GXWA 1KC2A 1R1SA 1AOTF 2CI8A 1A81A 2ABLA 1BHFA 1NRVA 3IMDA 1LUMA 4D8KA 2AOBA 3IN7A 2FCIA 3IN8A 2ECDA 3T04A 1FMKA 2DX0A 4F5AA 4OHHA 4L1BB 1CWEA 1SPSA 3N8MA 4OHIA 3VS7A 2YU7A 3UYOA 3VRPA 4GL9E 2DVJA 2PTKA 2C9WA 5GJIA 2DM0A 4DGXA 3ZNIA 3VS0A 5BO4A 2AUGA 2SHPA 2YSXA 3PQZA 3VS3A 2C0OA 2DLZA 1O41A 4K45A 1O4AA 2PNAA 1R1PA 5EHPA 4XZ0A 3EACA 3OB2B 3OB1B 2JYQA 2PLEA 4TZIA 1SHDA 3IMJA 2ETZA 3OP0A 3S8NA 5HKYA 1O4KA 3LYVA 1A07A 2CR4A 2GE9A 2IZVA 2EOBA 2IUGA 3HIZB 3NHNA 3VRRA 4A4CA 4DGPA 5AXIA 1FYRA 2EYVA 4FL2A 1LCKA 2EYZA 1O4LA 3QWYA 1KA6A 1FHSA 1O46A 3BKBA 1BMBA 2HCKA 3GQIB 1BM2A 3PSJA 1A1CA 1RQQC 4H1OA 1A08A 3CXLA 1BLKA 1LKLA 1YVHA 3BUMB 1SHBA 1BFIA 2H8HA 2CS0A 1SPRA 3VRQA 1KSWA 4X6SA 5KAZA 1A09A 2C0TA 4P9ZA 2RSYA 3VS4A 2LCTA 1O4JA 1O45A 1O4OA 2EYYA 1LCJA 4A4BA 2IUHA 1O44A 1O49A 1O4QA 1BFJA 1X6CA 1O4PA 2L6KA 1B47A 4GPLB 2HUWA 1FBZA 4EY0A 3TKZA 2HMHA 3N84A 3UF4A 2Y3AB 1CWDL 4E93A 5IBSA 5GJHA 1O4MA 3KFJA 4LUDA 2HDVA 3BUWB 4E68A 2XP1A 1F1WA 2SRCA 2OZOA 4U1PA 2VIFA 2RMXA 2AOAA 2EO3A 1M61A 2B3OA 2EO6A 5J3XA 1MW4A 3BUOB 2EU0A 2KGYA 1O4EA 1BLJA 1AD5A 4FBNA 1O47A 5AULA 1CJ1A 4K11A 3MXCA 5CDWA 1O42A 1UURA 1O4NA 4XZ1A 2LQNA 4ROJA 1OPKA 1K9AA 1M27A 2MQIA 2EKXA 2PLDA 4K2RA 1O43A 2MK2A 3TL0A 2HDXA 1X27A 1BG1A 1BKMA 1FBVA 3WA4A 2PNBA 5HKZA 1PICA 2EL8A 3VRZA 1GHUA 1OO3A 1LUNA 1O4HA 2DLYA 3US4A 4M4ZA 4K44A 1D4TA 1BHHA 3C7IA 1MILA 4JGHA 5EELA 3HHMB 2L4KA 1JYRA 1I3ZA 2CBLA 4F59A 2MC1A 2MRKA 2MRJA 1JWOA 1GRIA 2DCRA 4P9VA 5EHRA 1Y1UA 3VS5A 4NWGA 4QSYA 2CRHA 4OHLA 2OQ1A 1X0NA 1SKJA 2KK6A 1QG1E 1D4WA 3VS1A 3VROA 1RPYA 3OVEA 2CI9A 1HCSB 3VS6A 1A1AA 1LUIA 1SHAA 1AYBA 2L3TA 4OHDA 3CBLA 3MXYA 1F2FA 3VRNA 5EG3B 1H9OA 4H34A 4JE4A 1QADA 1AYAA 4FL3A 4JEGA 3K2MA 3S8LA 1KA7A 1AYDA 4WWQA 1O4IA
chains in the Genus database with same CATH topology
2H46E 1O4GA 4F5BA 3PLFB 3HCKA 2Y1MA 1TZEE 4OHEA 3PJPA 2QMSA 2CIAA 2LNXA 1FU6A 1LUKA 5IBMA 1TCEA 1FU5A 3VRYA 3VGOA 5DF6A 5D0JA 1Z3KA 5DC9A 1A1BA 3OV1A 2LNWA 3EAZA 4EIHA 1Y57A 1JU5A 1BHHB 2K7AB 3S9KA 3QWXX 3S8OA 3CD3A 1UUSA 1OPLA 3M7FA 1JYUA 1A1EA 1AB2A 1D1ZA 2H5KA 5DC0B 1IJRA 3BUXB 3PS5A 2BBUA 1O4RA 2FO0A 1P13A 3GXXA 4LUEA 1AOUF 2C0IA 1LKKA 3VS2A 2K79B 3MAZA 4NWFA 1R1QA 1NZLA 1NZVA 1CSYA 1YVLA 1O4BA 4U17A 1O4DA 1BF5A 5HKWA 1WQUA 2RVFA 3PSKA 1ZFPE 5EEQA 2GSBA 1XA6A 1AYCA 1CSZA 5I6VA 3PFVA 1HCTB 4GWFA 2KNOA 2RORA 1IS0A 1OO4A 3BUNB 1BKLA 3N7YA 3CWGA 1RJAA 1O4CA 2Y1NA 1G83A 1O48A 1JYQA 1QCFA 2LQWA 2IUIA 1O4FA 5DC4A 3GXWA 1KC2A 1R1SA 1AOTF 2CI8A 1A81A 2ABLA 1BHFA 1NRVA 3IMDA 1LUMA 4D8KA 2AOBA 3IN7A 2FCIA 3IN8A 2ECDA 3T04A 1FMKA 2DX0A 4F5AA 4OHHA 4L1BB 1CWEA 1SPSA 3N8MA 4OHIA 3VS7A 2YU7A 3UYOA 3VRPA 4GL9E 2DVJA 2PTKA 2C9WA 5GJIA 2DM0A 4DGXA 3ZNIA 3VS0A 5BO4A 2AUGA 2SHPA 2YSXA 3PQZA 3VS3A 2C0OA 2DLZA 1O41A 4K45A 1O4AA 2PNAA 1R1PA 5EHPA 4XZ0A 3EACA 3OB2B 3OB1B 2JYQA 2PLEA 4TZIA 1SHDA 3IMJA 2ETZA 3OP0A 3S8NA 5HKYA 1O4KA 1A07A 2CR4A 2GE9A 2IZVA 2EOBA 2IUGA 3HIZB 3NHNA 3VRRA 4A4CA 4DGPA 5AXIA 1FYRA 2EYVA 4FL2A 1LCKA 2EYZA 1O4LA 3QWYA 1KA6A 1FHSA 1O46A 3BKBA 1BMBA 2HCKA 3GQIB 1BM2A 3PSJA 1A1CA 1RQQC 4H1OA 1A08A 3CXLA 1BLKA 1LKLA 1YVHA 3BUMB 1SHBA 1BFIA 2H8HA 2CS0A 1SPRA 3VRQA 1KSWA 4X6SA 5KAZA 1A09A 2C0TA 4P9ZA 2RSYA 3VS4A 2LCTA 1O4JA 1O45A 1O4OA 2EYYA 1LCJA 4A4BA 2IUHA 1O44A 1O49A 1O4QA 1BFJA 1X6CA 1O4PA 2L6KA 1B47A 4GPLB 2HUWA 1FBZA 4EY0A 3TKZA 2HMHA 3N84A 3UF4A 2Y3AB 1CWDL 4E93A 5IBSA 5GJHA 1O4MA 3KFJA 4LUDA 2HDVA 3BUWB 4E68A 2XP1A 1F1WA 2SRCA 2OZOA 4U1PA 2VIFA 2RMXA 2AOAA 2EO3A 1M61A 2B3OA 2EO6A 5J3XA 1MW4A 3BUOB 2EU0A 1O4EA 1BLJA 1AD5A 4FBNA 1O47A 5AULA 1CJ1A 4K11A 3MXCA 5CDWA 1O42A 1UURA 1O4NA 4XZ1A 2LQNA 4ROJA 1OPKA 1K9AA 1M27A 2MQIA 2EKXA 2PLDA 4K2RA 1O43A 2MK2A 3TL0A 2HDXA 1X27A 1BG1A 1BKMA 1FBVA 3WA4A 2PNBA 5HKZA 1PICA 2EL8A 3VRZA 1GHUA 1OO3A 1LUNA 1O4HA 2DLYA 3US4A 4M4ZA 4K44A 1D4TA 1BHHA 3C7IA 1MILA 4JGHA 5EELA 3HHMB 2L4KA 1JYRA 1I3ZA 2CBLA 4F59A 2MC1A 2MRKA 2MRJA 1JWOA 1GRIA 2DCRA 4P9VA 5EHRA 1Y1UA 3VS5A 4NWGA 4QSYA 2CRHA 4OHLA 2OQ1A 1X0NA 1SKJA 2KK6A 1QG1E 1D4WA 3VS1A 3VROA 1RPYA 3OVEA 2CI9A 1HCSB 3VS6A 1A1AA 1LUIA 1SHAA 1AYBA 2L3TA 4OHDA 3CBLA 3MXYA 1F2FA 3VRNA 5EG3B 1H9OA 4H34A 4JE4A 1QADA 1AYAA 4FL3A 4JEGA 3K2MA 3S8LA 1KA7A 1AYDA 4WWQA 1O4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H46 E;  1O4G A;  4F5B A;  3PLF B;  3HCK A;  2Y1M A;  1TZE E;  4OHE A;  3PJP A;  2QMS A;  2CIA A;  2LNX A;  1FU6 A;  1LUK A;  5IBM A;  1TCE A;  1FU5 A;  3VRY A;  3VGO A;  5DF6 A;  5D0J A;  1Z3K A;  5DC9 A;  1A1B A;  3OV1 A;  2LNW A;  3EAZ A;  4EIH A;  1Y57 A;  1JU5 A;  1BHH B;  2K7A B;  3S9K A;  3QWX X;  3S8O A;  3CD3 A;  1UUS A;  1OPL A;  3M7F A;  1JYU A;  1A1E A;  1AB2 A;  1D1Z A;  2H5K A;  5DC0 B;  1IJR A;  3BUX B;  3PS5 A;  2BBU A;  1O4R A;  2FO0 A;  1P13 A;  3GXX A;  4LUE A;  1AOU F;  2C0I A;  1LKK A;  3VS2 A;  2K79 B;  3MAZ A;  4NWF A;  1R1Q A;  1NZL A;  1NZV A;  1CSY A;  1YVL A;  1O4B A;  4U17 A;  1O4D A;  1BF5 A;  5HKW A;  1WQU A;  2RVF A;  3PSK A;  1ZFP E;  5EEQ A;  2GSB A;  1XA6 A;  1AYC A;  1CSZ A;  5I6V A;  3PFV A;  1HCT B;  4GWF A;  2KNO A;  2ROR A;  1IS0 A;  1OO4 A;  3BUN B;  1BKL A;  3N7Y A;  3CWG A;  1RJA A;  1O4C A;  2Y1N A;  1G83 A;  1O48 A;  1JYQ A;  1QCF A;  2LQW A;  2IUI A;  1O4F A;  5DC4 A;  3GXW A;  1KC2 A;  1R1S A;  1AOT F;  2CI8 A;  1A81 A;  2ABL A;  1BHF A;  1NRV A;  3IMD A;  1LUM A;  4D8K A;  2AOB A;  3IN7 A;  2FCI A;  3IN8 A;  2ECD A;  3T04 A;  1FMK A;  2DX0 A;  4F5A A;  4OHH A;  4L1B B;  1CWE A;  1SPS A;  3N8M A;  4OHI A;  3VS7 A;  2YU7 A;  3UYO A;  3VRP A;  4GL9 E;  2DVJ A;  2PTK A;  2C9W A;  5GJI A;  2DM0 A;  4DGX A;  3ZNI A;  3VS0 A;  5BO4 A;  2AUG A;  2SHP A;  2YSX A;  3PQZ A;  3VS3 A;  2C0O A;  2DLZ A;  1O41 A;  4K45 A;  1O4A A;  2PNA A;  1R1P A;  5EHP A;  4XZ0 A;  3EAC A;  3OB2 B;  3OB1 B;  2JYQ A;  2PLE A;  4TZI A;  1SHD A;  3IMJ A;  2ETZ A;  3OP0 A;  3S8N A;  5HKY A;  1O4K A;  1A07 A;  2CR4 A;  2GE9 A;  2IZV A;  2EOB A;  2IUG A;  3HIZ B;  3NHN A;  3VRR A;  4A4C A;  4DGP A;  5AXI A;  1FYR A;  2EYV A;  4FL2 A;  1LCK A;  2EYZ A;  1O4L A;  3QWY A;  1KA6 A;  1FHS A;  1O46 A;  3BKB A;  1BMB A;  2HCK A;  3GQI B;  1BM2 A;  3PSJ A;  1A1C A;  1RQQ C;  4H1O A;  1A08 A;  3CXL A;  1BLK A;  1LKL A;  1YVH A;  3BUM B;  1SHB A;  1BFI A;  2H8H A;  2CS0 A;  1SPR A;  3VRQ A;  1KSW A;  4X6S A;  5KAZ A;  1A09 A;  2C0T A;  4P9Z A;  2RSY A;  3VS4 A;  2LCT A;  1O4J A;  1O45 A;  1O4O A;  2EYY A;  1LCJ A;  4A4B A;  2IUH A;  1O44 A;  1O49 A;  1O4Q A;  1BFJ A;  1X6C A;  1O4P A;  2L6K A;  1B47 A;  4GPL B;  2HUW A;  1FBZ A;  4EY0 A;  3TKZ A;  2HMH A;  3N84 A;  3UF4 A;  2Y3A B;  1CWD L;  4E93 A;  5IBS A;  5GJH A;  1O4M A;  3KFJ A;  4LUD A;  2HDV A;  3BUW B;  4E68 A;  2XP1 A;  1F1W A;  2SRC A;  2OZO A;  4U1P A;  2VIF A;  2RMX A;  2AOA A;  2EO3 A;  1M61 A;  2B3O A;  2EO6 A;  5J3X A;  1MW4 A;  3BUO B;  2EU0 A;  1O4E A;  1BLJ A;  1AD5 A;  4FBN A;  1O47 A;  5AUL A;  1CJ1 A;  4K11 A;  3MXC A;  5CDW A;  1O42 A;  1UUR A;  1O4N A;  4XZ1 A;  2LQN A;  4ROJ A;  1OPK A;  1K9A A;  1M27 A;  2MQI A;  2EKX A;  2PLD A;  4K2R A;  1O43 A;  2MK2 A;  3TL0 A;  2HDX A;  1X27 A;  1BG1 A;  1BKM A;  1FBV A;  3WA4 A;  2PNB A;  5HKZ A;  1PIC A;  2EL8 A;  3VRZ A;  1GHU A;  1OO3 A;  1LUN A;  1O4H A;  2DLY A;  3US4 A;  4M4Z A;  4K44 A;  1D4T A;  1BHH A;  3C7I A;  1MIL A;  4JGH A;  5EEL A;  3HHM B;  2L4K A;  1JYR A;  1I3Z A;  2CBL A;  4F59 A;  2MC1 A;  2MRK A;  2MRJ A;  1JWO A;  1GRI A;  2DCR A;  4P9V A;  5EHR A;  1Y1U A;  3VS5 A;  4NWG A;  4QSY A;  2CRH A;  4OHL A;  2OQ1 A;  1X0N A;  1SKJ A;  2KK6 A;  1QG1 E;  1D4W A;  3VS1 A;  3VRO A;  1RPY A;  3OVE A;  2CI9 A;  1HCS B;  3VS6 A;  1A1A A;  1LUI A;  1SHA A;  1AYB A;  2L3T A;  4OHD A;  3CBL A;  3MXY A;  1F2F A;  3VRN A;  5EG3 B;  1H9O A;  4H34 A;  4JE4 A;  1QAD A;  1AYA A;  4FL3 A;  4JEG A;  3K2M A;  3S8L A;  1KA7 A;  1AYD A;  4WWQ A;  1O4I A; 
#chains in the Genus database with same CATH topology
 2H46 E;  1O4G A;  4F5B A;  3PLF B;  3HCK A;  2Y1M A;  1TZE E;  4OHE A;  3PJP A;  2QMS A;  2CIA A;  2LNX A;  1FU6 A;  1LUK A;  5IBM A;  1TCE A;  1FU5 A;  3VRY A;  3VGO A;  5DF6 A;  5D0J A;  1Z3K A;  5DC9 A;  1A1B A;  3OV1 A;  3K2T A;  2LNW A;  3EAZ A;  4EIH A;  1Y57 A;  1JU5 A;  1BHH B;  2K7A B;  3S9K A;  3QWX X;  3S8O A;  3CD3 A;  1UUS A;  1OPL A;  3M7F A;  1JYU A;  1A1E A;  1AB2 A;  1D1Z A;  2H5K A;  5DC0 B;  1IJR A;  3BUX B;  3PS5 A;  2BBU A;  1O4R A;  2FO0 A;  1P13 A;  3GXX A;  4LUE A;  1AOU F;  2C0I A;  1LKK A;  3VS2 A;  2K79 B;  3MAZ A;  4NWF A;  1R1Q A;  1NZL A;  1NZV A;  1CSY A;  1YVL A;  1O4B A;  4U17 A;  1O4D A;  1BF5 A;  5HKW A;  1WQU A;  2RVF A;  3PSK A;  1ZFP E;  5EEQ A;  2GSB A;  1XA6 A;  2LRA A;  1AYC A;  1CSZ A;  5I6V A;  3PFV A;  1HCT B;  4GWF A;  2KNO A;  2ROR A;  1IS0 A;  1OO4 A;  3BUN B;  1BKL A;  3N7Y A;  3CWG A;  1RJA A;  1O4C A;  2Y1N A;  1G83 A;  1O48 A;  1JYQ A;  1QCF A;  2LQW A;  2IUI A;  1O4F A;  5DC4 A;  3GXW A;  1KC2 A;  1R1S A;  1AOT F;  2CI8 A;  1A81 A;  2ABL A;  1BHF A;  1NRV A;  3IMD A;  1LUM A;  4D8K A;  2AOB A;  3IN7 A;  2FCI A;  3IN8 A;  2ECD A;  3T04 A;  1FMK A;  2DX0 A;  4F5A A;  4OHH A;  4L1B B;  1CWE A;  1SPS A;  3N8M A;  4OHI A;  3VS7 A;  2YU7 A;  3UYO A;  3VRP A;  4GL9 E;  2DVJ A;  2PTK A;  2C9W A;  5GJI A;  2DM0 A;  4DGX A;  3ZNI A;  3VS0 A;  5BO4 A;  2AUG A;  2SHP A;  2YSX A;  3PQZ A;  3VS3 A;  2C0O A;  2DLZ A;  1O41 A;  4K45 A;  1O4A A;  2PNA A;  1R1P A;  5EHP A;  4XZ0 A;  3EAC A;  3OB2 B;  3OB1 B;  2JYQ A;  2PLE A;  4TZI A;  1SHD A;  3IMJ A;  2ETZ A;  3OP0 A;  3S8N A;  5HKY A;  1O4K A;  3LYV A;  1A07 A;  2CR4 A;  2GE9 A;  2IZV A;  2EOB A;  2IUG A;  3HIZ B;  3NHN A;  3VRR A;  4A4C A;  4DGP A;  5AXI A;  1FYR A;  2EYV A;  4FL2 A;  1LCK A;  2EYZ A;  1O4L A;  3QWY A;  1KA6 A;  1FHS A;  1O46 A;  3BKB A;  1BMB A;  2HCK A;  3GQI B;  1BM2 A;  3PSJ A;  1A1C A;  1RQQ C;  4H1O A;  1A08 A;  3CXL A;  1BLK A;  1LKL A;  1YVH A;  3BUM B;  1SHB A;  1BFI A;  2H8H A;  2CS0 A;  1SPR A;  3VRQ A;  1KSW A;  4X6S A;  5KAZ A;  1A09 A;  2C0T A;  4P9Z A;  2RSY A;  3VS4 A;  2LCT A;  1O4J A;  1O45 A;  1O4O A;  2EYY A;  1LCJ A;  4A4B A;  2IUH A;  1O44 A;  1O49 A;  1O4Q A;  1BFJ A;  1X6C A;  1O4P A;  2L6K A;  1B47 A;  4GPL B;  2HUW A;  1FBZ A;  4EY0 A;  3TKZ A;  2HMH A;  3N84 A;  3UF4 A;  2Y3A B;  1CWD L;  4E93 A;  5IBS A;  5GJH A;  1O4M A;  3KFJ A;  4LUD A;  2HDV A;  3BUW B;  4E68 A;  2XP1 A;  1F1W A;  2SRC A;  2OZO A;  4U1P A;  2VIF A;  2RMX A;  2AOA A;  2EO3 A;  1M61 A;  2B3O A;  2EO6 A;  5J3X A;  1MW4 A;  3BUO B;  2EU0 A;  2KGY A;  1O4E A;  1BLJ A;  1AD5 A;  4FBN A;  1O47 A;  5AUL A;  1CJ1 A;  4K11 A;  3MXC A;  5CDW A;  1O42 A;  1UUR A;  1O4N A;  4XZ1 A;  2LQN A;  4ROJ A;  1OPK A;  1K9A A;  1M27 A;  2MQI A;  2EKX A;  2PLD A;  4K2R A;  1O43 A;  2MK2 A;  3TL0 A;  2HDX A;  1X27 A;  1BG1 A;  1BKM A;  1FBV A;  3WA4 A;  2PNB A;  5HKZ A;  1PIC A;  2EL8 A;  3VRZ A;  1GHU A;  1OO3 A;  1LUN A;  1O4H A;  2DLY A;  3US4 A;  4M4Z A;  4K44 A;  1D4T A;  1BHH A;  3C7I A;  1MIL A;  4JGH A;  5EEL A;  3HHM B;  2L4K A;  1JYR A;  1I3Z A;  2CBL A;  4F59 A;  2MC1 A;  2MRK A;  2MRJ A;  1JWO A;  1GRI A;  2DCR A;  4P9V A;  5EHR A;  1Y1U A;  3VS5 A;  4NWG A;  4QSY A;  2CRH A;  4OHL A;  2OQ1 A;  1X0N A;  1SKJ A;  2KK6 A;  1QG1 E;  1D4W A;  3VS1 A;  3VRO A;  1RPY A;  3OVE A;  2CI9 A;  1HCS B;  3VS6 A;  1A1A A;  1LUI A;  1SHA A;  1AYB A;  2L3T A;  4OHD A;  3CBL A;  3MXY A;  1F2F A;  3VRN A;  5EG3 B;  1H9O A;  4H34 A;  4JE4 A;  1QAD A;  1AYA A;  4FL3 A;  4JEG A;  3K2M A;  3S8L A;  1KA7 A;  1AYD A;  4WWQ A;  1O4I A; 
#chains in the Genus database with same CATH homology
 2H46 E;  1O4G A;  4F5B A;  3PLF B;  3HCK A;  2Y1M A;  1TZE E;  4OHE A;  3PJP A;  2QMS A;  2CIA A;  2LNX A;  1FU6 A;  1LUK A;  5IBM A;  1TCE A;  1FU5 A;  3VRY A;  3VGO A;  5DF6 A;  5D0J A;  1Z3K A;  5DC9 A;  1A1B A;  3OV1 A;  2LNW A;  3EAZ A;  4EIH A;  1Y57 A;  1JU5 A;  1BHH B;  2K7A B;  3S9K A;  3QWX X;  3S8O A;  3CD3 A;  1UUS A;  1OPL A;  3M7F A;  1JYU A;  1A1E A;  1AB2 A;  1D1Z A;  2H5K A;  5DC0 B;  1IJR A;  3BUX B;  3PS5 A;  2BBU A;  1O4R A;  2FO0 A;  1P13 A;  3GXX A;  4LUE A;  1AOU F;  2C0I A;  1LKK A;  3VS2 A;  2K79 B;  3MAZ A;  4NWF A;  1R1Q A;  1NZL A;  1NZV A;  1CSY A;  1YVL A;  1O4B A;  4U17 A;  1O4D A;  1BF5 A;  5HKW A;  1WQU A;  2RVF A;  3PSK A;  1ZFP E;  5EEQ A;  2GSB A;  1XA6 A;  1AYC A;  1CSZ A;  5I6V A;  3PFV A;  1HCT B;  4GWF A;  2KNO A;  2ROR A;  1IS0 A;  1OO4 A;  3BUN B;  1BKL A;  3N7Y A;  3CWG A;  1RJA A;  1O4C A;  2Y1N A;  1G83 A;  1O48 A;  1JYQ A;  1QCF A;  2LQW A;  2IUI A;  1O4F A;  5DC4 A;  3GXW A;  1KC2 A;  1R1S A;  1AOT F;  2CI8 A;  1A81 A;  2ABL A;  1BHF A;  1NRV A;  3IMD A;  1LUM A;  4D8K A;  2AOB A;  3IN7 A;  2FCI A;  3IN8 A;  2ECD A;  3T04 A;  1FMK A;  2DX0 A;  4F5A A;  4OHH A;  4L1B B;  1CWE A;  1SPS A;  3N8M A;  4OHI A;  3VS7 A;  2YU7 A;  3UYO A;  3VRP A;  4GL9 E;  2DVJ A;  2PTK A;  2C9W A;  5GJI A;  2DM0 A;  4DGX A;  3ZNI A;  3VS0 A;  5BO4 A;  2AUG A;  2SHP A;  2YSX A;  3PQZ A;  3VS3 A;  2C0O A;  2DLZ A;  1O41 A;  4K45 A;  1O4A A;  2PNA A;  1R1P A;  5EHP A;  4XZ0 A;  3EAC A;  3OB2 B;  3OB1 B;  2JYQ A;  2PLE A;  4TZI A;  1SHD A;  3IMJ A;  2ETZ A;  3OP0 A;  3S8N A;  5HKY A;  1O4K A;  1A07 A;  2CR4 A;  2GE9 A;  2IZV A;  2EOB A;  2IUG A;  3HIZ B;  3NHN A;  3VRR A;  4A4C A;  4DGP A;  5AXI A;  1FYR A;  2EYV A;  4FL2 A;  1LCK A;  2EYZ A;  1O4L A;  3QWY A;  1KA6 A;  1FHS A;  1O46 A;  3BKB A;  1BMB A;  2HCK A;  3GQI B;  1BM2 A;  3PSJ A;  1A1C A;  1RQQ C;  4H1O A;  1A08 A;  3CXL A;  1BLK A;  1LKL A;  1YVH A;  3BUM B;  1SHB A;  1BFI A;  2H8H A;  2CS0 A;  1SPR A;  3VRQ A;  1KSW A;  4X6S A;  5KAZ A;  1A09 A;  2C0T A;  4P9Z A;  2RSY A;  3VS4 A;  2LCT A;  1O4J A;  1O45 A;  1O4O A;  2EYY A;  1LCJ A;  4A4B A;  2IUH A;  1O44 A;  1O49 A;  1O4Q A;  1BFJ A;  1X6C A;  1O4P A;  2L6K A;  1B47 A;  4GPL B;  2HUW A;  1FBZ A;  4EY0 A;  3TKZ A;  2HMH A;  3N84 A;  3UF4 A;  2Y3A B;  1CWD L;  4E93 A;  5IBS A;  5GJH A;  1O4M A;  3KFJ A;  4LUD A;  2HDV A;  3BUW B;  4E68 A;  2XP1 A;  1F1W A;  2SRC A;  2OZO A;  4U1P A;  2VIF A;  2RMX A;  2AOA A;  2EO3 A;  1M61 A;  2B3O A;  2EO6 A;  5J3X A;  1MW4 A;  3BUO B;  2EU0 A;  1O4E A;  1BLJ A;  1AD5 A;  4FBN A;  1O47 A;  5AUL A;  1CJ1 A;  4K11 A;  3MXC A;  5CDW A;  1O42 A;  1UUR A;  1O4N A;  4XZ1 A;  2LQN A;  4ROJ A;  1OPK A;  1K9A A;  1M27 A;  2MQI A;  2EKX A;  2PLD A;  4K2R A;  1O43 A;  2MK2 A;  3TL0 A;  2HDX A;  1X27 A;  1BG1 A;  1BKM A;  1FBV A;  3WA4 A;  2PNB A;  5HKZ A;  1PIC A;  2EL8 A;  3VRZ A;  1GHU A;  1OO3 A;  1LUN A;  1O4H A;  2DLY A;  3US4 A;  4M4Z A;  4K44 A;  1D4T A;  1BHH A;  3C7I A;  1MIL A;  4JGH A;  5EEL A;  3HHM B;  2L4K A;  1JYR A;  1I3Z A;  2CBL A;  4F59 A;  2MC1 A;  2MRK A;  2MRJ A;  1JWO A;  1GRI A;  2DCR A;  4P9V A;  5EHR A;  1Y1U A;  3VS5 A;  4NWG A;  4QSY A;  2CRH A;  4OHL A;  2OQ1 A;  1X0N A;  1SKJ A;  2KK6 A;  1QG1 E;  1D4W A;  3VS1 A;  3VRO A;  1RPY A;  3OVE A;  2CI9 A;  1HCS B;  3VS6 A;  1A1A A;  1LUI A;  1SHA A;  1AYB A;  2L3T A;  4OHD A;  3CBL A;  3MXY A;  1F2F A;  3VRN A;  5EG3 B;  1H9O A;  4H34 A;  4JE4 A;  1QAD A;  1AYA A;  4FL3 A;  4JEG A;  3K2M A;  3S8L A;  1KA7 A;  1AYD A;  4WWQ A;  1O4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...