2KK6A

Solution structure of sh2 domain of proto-oncogene tyrosine-protein kinase fer from homo sapiens, northeast structural genomics consortium (nesg) target hr3461d
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
116
structure length
116
Chain Sequence
MGHHHHHHSHMKPLAEQDWYHGAIPRIEAQELLKKQGDFLVRESHGKPGEYVLSVYSDGQRRHFIIQYVDNMYRFEGTGFSNIPQLIDHHYTTKQVITKKSGVVLLNPIPKDKKWI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase FER
publication title Solution structure of sh2 domain of proto-oncogene tyrosine-protein kinase fer from homo sapiens, northeast structural genomics consortium (nesg) target hr3461d
rcsb
source organism Homo sapiens
total genus 21
structure length 116
sequence length 116
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2kk6A00
1BMBA 1A1BA 4LUDA 1H9OA 1TZEE 3VRNA 4M4ZA 3BUWB 1RQQC 1B47A 2VIFA 2AOAA 3PSJA 3OP0A 3QWYA 1SPRA 3VS1A 4E68A 4QSYA 1BKMA 4OHEA 2Y1MA 1O4MA 2EKXA 2CBLA 1GHUA 4OHLA 3CXLA 5IBSA 1ZFPE 3OVEA 2OQ1A 1G83A 2L4KA 1A07A 4WWQA 4E93A 1QADA 1F2FA 1O42A 1BKLA 3TKZA 1O4OA 2PTKA 1HCTB 3OB2B 1D4TA 2JYQA 4F59A 1O4GA 5AULA 3GXXA 2MRKA 1KC2A 1AB2A 3UF4A 2PNAA 2EYZA 1O4IA 3BUMB 1QG1E 1AD5A 3VS6A 2PLDA 1SHAA 3VRPA 1BHFA 1A1EA 2LCTA 2OZOA 1K9AA 1X0NA 2CS0A 5BO4A 1O41A 2EU0A 2DX0A 4EY0A 1NRVA 1FU5A 4DGXA 3IN8A 3CBLA 4FBNA 5DF6A 1RJAA 1BFJA 2HMHA 1O4JA 2CIAA 4K11A 1FYRA 1O4HA 1CSYA 1I3ZA 1KSWA 2MRJA 4L1BB 3VRRA 1BHHA 1O47A 3VGOA 2LNXA 5EELA 1O4DA 2C0TA 1D1ZA 3PFVA 3VS3A 1BLJA 5DC0B 3T04A 1O4RA 1Z3KA 2FCIA 3S8NA 2H46E 2EO3A 2PLEA 1D4WA 2IUHA 3VS2A 1FBZA 2HDXA 2IUIA 1JWOA 1RPYA 1O49A 4OHIA 1QCFA 1IS0A 1BFIA 3VS7A 1SHBA 3S8OA 1O4CA 4LUEA 1BLKA 1LKLA 1OPLA 3NHNA 1UURA 1AYBA 2RORA 1JYRA 3VS4A 2RMXA 2MQIA 4K2RA 5GJIA 5CDWA 1O4PA 1O4FA 3VS5A 1BHHB 2ECDA 4ROJA 4GWFA 2C0OA 2HCKA 1P13A 3VROA 5HKZA 4K45A 1WQUA 2KK6A 1O4NA 2GE9A 4H1OA 3OB1B 3GQIB 2MC1A 3CWGA 1X6CA 1O4KA 2EYVA 4NWGA 1UUSA 2C0IA 3MXYA 2HDVA 3HHMB 3EACA 2L3TA 3TL0A 3N7YA 1R1PA 1Y57A 3IMJA 3S8LA 2RVFA 5GJHA 2ABLA 1FHSA 5HKYA 2DCRA 3EAZA 1O4LA 5AXIA 2BBUA 1TCEA 3PLFB 1A1CA 1O46A 2EO6A 1IJRA 2LQWA 1JU5A 4K44A 1GRIA 3IMDA 2MK2A 1M61A 3N8MA 5IBMA 1BG1A 5D0JA 4FL3A 1SPSA 2AOBA 2FO0A 1CWEA 1BF5A 2CI8A 1M27A 5HKWA 1R1SA 1O44A 3PSKA 1A09A 1O4EA 3KFJA 1AYCA 1KA7A 3QWXX 3HCKA 3GXWA 2EYYA 3US4A 2IZVA 2DM0A 1A81A 1CJ1A 4OHDA 1AOTF 2YSXA 2Y3AB 1LUMA 1Y1UA 1YVLA 2YU7A 1SKJA 2CI9A 3CD3A 2Y1NA 3VRYA 2LNWA 1SHDA 2HUWA 4H34A 2K79B 2DLZA 4D8KA 1O48A 3K2MA 2L6KA 2ETZA 1AOUF 3BKBA 4F5AA 1JYQA 4U1PA 4P9VA 4X6SA 4P9ZA 1OO4A 3UYOA 4OHHA 4A4CA 1LUIA 2XP1A 1O4AA 1X27A 3IN7A 3N84A 4DGPA 4GPLB 4GL9E 1LUKA 1JYUA 1KA6A 2SRCA 2B3OA 4NWFA 2K7AB 2AUGA 1YVHA 3ZNIA 4A4BA 4XZ0A 1XA6A 4TZIA 2KNOA 2DVJA 1AYDA 2PNBA 3BUOB 1O45A 1LUNA 1FU6A 2H8HA 1AYAA 3HIZB 1CSZA 1O43A 4EIHA 3WA4A 1A08A 3VS0A 1LCKA 1MILA 1FMKA 3S9KA 3M7FA 2H5KA 5J3XA 1R1QA 1FBVA 1BM2A 5EHRA 1MW4A 4JEGA 4XZ1A 2IUGA 1NZLA 3VRQA 3MXCA 1A1AA 2C9WA 4U17A 1LKKA 1LCJA 1OPKA 3PJPA 5I6VA 2DLYA 3PQZA 1NZVA 3BUNB 3C7IA 1CWDL 3PS5A 4F5BA 1PICA 1F1WA 3BUXB 5DC9A 3OV1A 5KAZA 1HCSB 1O4BA 5EHPA 4JE4A 4JGHA 1OO3A 5DC4A 2RSYA 2CRHA 2SHPA 5EG3B 3VRZA 4FL2A 2LQNA 3MAZA 1O4QA 2EL8A 2CR4A 2QMSA 2GSBA 5EEQA 2EOBA
chains in the Genus database with same CATH superfamily
1BMBA 1A1BA 4LUDA 1H9OA 1TZEE 3VRNA 4M4ZA 3BUWB 1RQQC 1B47A 2VIFA 2AOAA 3PSJA 3OP0A 3QWYA 1SPRA 3VS1A 4E68A 4QSYA 1BKMA 4OHEA 2Y1MA 1O4MA 2EKXA 2CBLA 1GHUA 4OHLA 3CXLA 5IBSA 1ZFPE 3OVEA 2OQ1A 1G83A 2L4KA 1A07A 4WWQA 4E93A 1QADA 1F2FA 1O42A 3LYVA 1BKLA 3TKZA 1O4OA 2PTKA 1HCTB 3OB2B 1D4TA 2JYQA 4F59A 1O4GA 5AULA 3GXXA 2MRKA 1KC2A 1AB2A 3UF4A 2PNAA 2EYZA 1O4IA 3BUMB 1QG1E 1AD5A 3VS6A 2PLDA 1SHAA 3VRPA 1BHFA 1A1EA 2LCTA 2OZOA 1K9AA 1X0NA 2CS0A 5BO4A 1O41A 2EU0A 2DX0A 4EY0A 1NRVA 1FU5A 4DGXA 3IN8A 3CBLA 4FBNA 5DF6A 1RJAA 1BFJA 2HMHA 1O4JA 2CIAA 4K11A 1FYRA 1O4HA 1CSYA 1I3ZA 1KSWA 2MRJA 4L1BB 3VRRA 1BHHA 1O47A 3VGOA 2LNXA 5EELA 1O4DA 2C0TA 1D1ZA 3PFVA 3VS3A 1BLJA 5DC0B 3T04A 1O4RA 1Z3KA 2FCIA 3S8NA 2H46E 2EO3A 2PLEA 1D4WA 2IUHA 3VS2A 1FBZA 2HDXA 2IUIA 1JWOA 1RPYA 1O49A 4OHIA 1QCFA 1IS0A 1BFIA 3VS7A 1SHBA 3S8OA 1O4CA 4LUEA 1BLKA 1LKLA 1OPLA 3NHNA 1UURA 3K2TA 1AYBA 2RORA 1JYRA 3VS4A 2RMXA 2MQIA 4K2RA 5GJIA 5CDWA 1O4PA 1O4FA 3VS5A 1BHHB 2ECDA 4ROJA 4GWFA 2C0OA 2HCKA 1P13A 3VROA 5HKZA 4K45A 1WQUA 2KK6A 1O4NA 2GE9A 4H1OA 3OB1B 3GQIB 2MC1A 3CWGA 2LRAA 1X6CA 1O4KA 2EYVA 4NWGA 1UUSA 2C0IA 3MXYA 2HDVA 3HHMB 3EACA 2L3TA 3TL0A 3N7YA 1R1PA 1Y57A 3IMJA 3S8LA 2RVFA 5GJHA 2ABLA 1FHSA 5HKYA 2DCRA 3EAZA 1O4LA 5AXIA 2BBUA 2KGYA 1TCEA 3PLFB 1A1CA 1O46A 2EO6A 1IJRA 2LQWA 1JU5A 4K44A 1GRIA 3IMDA 2MK2A 1M61A 3N8MA 5IBMA 1BG1A 5D0JA 4FL3A 1SPSA 2AOBA 2FO0A 1CWEA 1BF5A 2CI8A 1M27A 5HKWA 1R1SA 1O44A 3PSKA 1A09A 1O4EA 3KFJA 1AYCA 1KA7A 3QWXX 3HCKA 3GXWA 2EYYA 3US4A 2IZVA 2DM0A 1A81A 1CJ1A 4OHDA 1AOTF 2YSXA 2Y3AB 1LUMA 1Y1UA 1YVLA 2YU7A 1SKJA 2CI9A 3CD3A 2Y1NA 3VRYA 2LNWA 1SHDA 2HUWA 4H34A 2K79B 2DLZA 4D8KA 1O48A 3K2MA 2L6KA 2ETZA 1AOUF 3BKBA 4F5AA 1JYQA 4U1PA 4P9VA 4X6SA 4P9ZA 1OO4A 3UYOA 4OHHA 4A4CA 1LUIA 2XP1A 1O4AA 1X27A 3IN7A 3N84A 4DGPA 4GPLB 4GL9E 1LUKA 1JYUA 1KA6A 2SRCA 2B3OA 4NWFA 2K7AB 2AUGA 1YVHA 3ZNIA 4A4BA 4XZ0A 1XA6A 4TZIA 2KNOA 2DVJA 1AYDA 2PNBA 3BUOB 1O45A 1LUNA 1FU6A 2H8HA 1AYAA 3HIZB 1CSZA 1O43A 4EIHA 3WA4A 1A08A 3VS0A 1LCKA 1MILA 1FMKA 3S9KA 3M7FA 2H5KA 5J3XA 1R1QA 1FBVA 1BM2A 5EHRA 1MW4A 4JEGA 4XZ1A 2IUGA 1NZLA 3VRQA 3MXCA 1A1AA 2C9WA 4U17A 1LKKA 1LCJA 1OPKA 3PJPA 5I6VA 2DLYA 3PQZA 1NZVA 3BUNB 3C7IA 1CWDL 3PS5A 4F5BA 1PICA 1F1WA 3BUXB 5DC9A 3OV1A 5KAZA 1HCSB 1O4BA 5EHPA 4JE4A 4JGHA 1OO3A 2RSYA 2SHPA 2CRHA 5DC4A 5EG3B 3VRZA 4FL2A 2LQNA 3MAZA 1O4QA 2EL8A 2CR4A 2QMSA 2GSBA 5EEQA 2EOBA
chains in the Genus database with same CATH topology
1BMBA 1A1BA 4LUDA 1H9OA 1TZEE 3VRNA 4M4ZA 3BUWB 1RQQC 1B47A 2VIFA 2AOAA 3PSJA 3OP0A 3QWYA 1SPRA 3VS1A 4E68A 4QSYA 1BKMA 4OHEA 2Y1MA 1O4MA 2EKXA 2CBLA 1GHUA 4OHLA 3CXLA 5IBSA 1ZFPE 3OVEA 2OQ1A 1G83A 2L4KA 1A07A 4WWQA 4E93A 1QADA 1F2FA 1O42A 1BKLA 3TKZA 1O4OA 2PTKA 1HCTB 3OB2B 1D4TA 2JYQA 4F59A 1O4GA 5AULA 3GXXA 2MRKA 1KC2A 1AB2A 3UF4A 2PNAA 2EYZA 1O4IA 3BUMB 1QG1E 1AD5A 3VS6A 2PLDA 1SHAA 3VRPA 1BHFA 1A1EA 2LCTA 2OZOA 1K9AA 1X0NA 2CS0A 5BO4A 1O41A 2EU0A 2DX0A 4EY0A 1NRVA 1FU5A 4DGXA 3IN8A 3CBLA 4FBNA 5DF6A 1RJAA 1BFJA 2HMHA 1O4JA 2CIAA 4K11A 1FYRA 1O4HA 1CSYA 1I3ZA 1KSWA 2MRJA 4L1BB 3VRRA 1BHHA 1O47A 3VGOA 2LNXA 5EELA 1O4DA 2C0TA 1D1ZA 3PFVA 3VS3A 1BLJA 5DC0B 3T04A 1O4RA 1Z3KA 2FCIA 3S8NA 2H46E 2EO3A 2PLEA 1D4WA 2IUHA 3VS2A 1FBZA 2HDXA 2IUIA 1JWOA 1RPYA 1O49A 4OHIA 1QCFA 1IS0A 1BFIA 3VS7A 1SHBA 3S8OA 1O4CA 4LUEA 1BLKA 1LKLA 1OPLA 3NHNA 1UURA 1AYBA 2RORA 1JYRA 3VS4A 2RMXA 2MQIA 4K2RA 5GJIA 5CDWA 1O4PA 1O4FA 3VS5A 1BHHB 2ECDA 4ROJA 4GWFA 2C0OA 2HCKA 1P13A 3VROA 5HKZA 4K45A 1WQUA 2KK6A 1O4NA 2GE9A 4H1OA 3OB1B 3GQIB 2MC1A 3CWGA 1X6CA 1O4KA 2EYVA 4NWGA 1UUSA 2C0IA 3MXYA 2HDVA 3HHMB 3EACA 2L3TA 3TL0A 3N7YA 1R1PA 1Y57A 3IMJA 3S8LA 2RVFA 5GJHA 2ABLA 1FHSA 5HKYA 2DCRA 3EAZA 1O4LA 5AXIA 2BBUA 1TCEA 3PLFB 1A1CA 1O46A 2EO6A 1IJRA 2LQWA 1JU5A 4K44A 1GRIA 3IMDA 2MK2A 1M61A 3N8MA 5IBMA 1BG1A 5D0JA 4FL3A 1SPSA 2AOBA 2FO0A 1CWEA 1BF5A 2CI8A 1M27A 5HKWA 1R1SA 1O44A 3PSKA 1A09A 1O4EA 3KFJA 1AYCA 1KA7A 3QWXX 3HCKA 3GXWA 2EYYA 3US4A 2IZVA 2DM0A 1A81A 1CJ1A 4OHDA 1AOTF 2YSXA 2Y3AB 1LUMA 1Y1UA 1YVLA 2YU7A 1SKJA 2CI9A 3CD3A 2Y1NA 3VRYA 2LNWA 1SHDA 2HUWA 4H34A 2K79B 2DLZA 4D8KA 1O48A 3K2MA 2L6KA 2ETZA 1AOUF 3BKBA 4F5AA 1JYQA 4U1PA 4P9VA 4X6SA 4P9ZA 1OO4A 3UYOA 4OHHA 4A4CA 1LUIA 2XP1A 1O4AA 1X27A 3IN7A 3N84A 4DGPA 4GPLB 4GL9E 1LUKA 1JYUA 1KA6A 2SRCA 2B3OA 4NWFA 2K7AB 2AUGA 1YVHA 3ZNIA 4A4BA 4XZ0A 1XA6A 4TZIA 2KNOA 2DVJA 1AYDA 2PNBA 3BUOB 1O45A 1LUNA 1FU6A 2H8HA 1AYAA 3HIZB 1CSZA 1O43A 4EIHA 3WA4A 1A08A 3VS0A 1LCKA 1MILA 1FMKA 3S9KA 3M7FA 2H5KA 5J3XA 1R1QA 1FBVA 1BM2A 5EHRA 1MW4A 4JEGA 4XZ1A 2IUGA 1NZLA 3VRQA 3MXCA 1A1AA 2C9WA 4U17A 1LKKA 1LCJA 1OPKA 3PJPA 5I6VA 2DLYA 3PQZA 1NZVA 3BUNB 3C7IA 1CWDL 3PS5A 4F5BA 1PICA 1F1WA 3BUXB 5DC9A 3OV1A 5KAZA 1HCSB 1O4BA 5EHPA 4JE4A 4JGHA 1OO3A 5DC4A 2RSYA 2CRHA 2SHPA 5EG3B 3VRZA 4FL2A 2LQNA 3MAZA 1O4QA 2EL8A 2CR4A 2QMSA 2GSBA 5EEQA 2EOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BMB A;  1A1B A;  4LUD A;  1H9O A;  1TZE E;  3VRN A;  4M4Z A;  3BUW B;  1RQQ C;  1B47 A;  2VIF A;  2AOA A;  3PSJ A;  3OP0 A;  3QWY A;  1SPR A;  3VS1 A;  4E68 A;  4QSY A;  1BKM A;  4OHE A;  2Y1M A;  1O4M A;  2EKX A;  2CBL A;  1GHU A;  4OHL A;  3CXL A;  5IBS A;  1ZFP E;  3OVE A;  2OQ1 A;  1G83 A;  2L4K A;  1A07 A;  4WWQ A;  4E93 A;  1QAD A;  1F2F A;  1O42 A;  1BKL A;  3TKZ A;  1O4O A;  2PTK A;  1HCT B;  3OB2 B;  1D4T A;  2JYQ A;  4F59 A;  1O4G A;  5AUL A;  3GXX A;  2MRK A;  1KC2 A;  1AB2 A;  3UF4 A;  2PNA A;  2EYZ A;  1O4I A;  3BUM B;  1QG1 E;  1AD5 A;  3VS6 A;  2PLD A;  1SHA A;  3VRP A;  1BHF A;  1A1E A;  2LCT A;  2OZO A;  1K9A A;  1X0N A;  2CS0 A;  5BO4 A;  1O41 A;  2EU0 A;  2DX0 A;  4EY0 A;  1NRV A;  1FU5 A;  4DGX A;  3IN8 A;  3CBL A;  4FBN A;  5DF6 A;  1RJA A;  1BFJ A;  2HMH A;  1O4J A;  2CIA A;  4K11 A;  1FYR A;  1O4H A;  1CSY A;  1I3Z A;  1KSW A;  2MRJ A;  4L1B B;  3VRR A;  1BHH A;  1O47 A;  3VGO A;  2LNX A;  5EEL A;  1O4D A;  2C0T A;  1D1Z A;  3PFV A;  3VS3 A;  1BLJ A;  5DC0 B;  3T04 A;  1O4R A;  1Z3K A;  2FCI A;  3S8N A;  2H46 E;  2EO3 A;  2PLE A;  1D4W A;  2IUH A;  3VS2 A;  1FBZ A;  2HDX A;  2IUI A;  1JWO A;  1RPY A;  1O49 A;  4OHI A;  1QCF A;  1IS0 A;  1BFI A;  3VS7 A;  1SHB A;  3S8O A;  1O4C A;  4LUE A;  1BLK A;  1LKL A;  1OPL A;  3NHN A;  1UUR A;  1AYB A;  2ROR A;  1JYR A;  3VS4 A;  2RMX A;  2MQI A;  4K2R A;  5GJI A;  5CDW A;  1O4P A;  1O4F A;  3VS5 A;  1BHH B;  2ECD A;  4ROJ A;  4GWF A;  2C0O A;  2HCK A;  1P13 A;  3VRO A;  5HKZ A;  4K45 A;  1WQU A;  2KK6 A;  1O4N A;  2GE9 A;  4H1O A;  3OB1 B;  3GQI B;  2MC1 A;  3CWG A;  1X6C A;  1O4K A;  2EYV A;  4NWG A;  1UUS A;  2C0I A;  3MXY A;  2HDV A;  3HHM B;  3EAC A;  2L3T A;  3TL0 A;  3N7Y A;  1R1P A;  1Y57 A;  3IMJ A;  3S8L A;  2RVF A;  5GJH A;  2ABL A;  1FHS A;  5HKY A;  2DCR A;  3EAZ A;  1O4L A;  5AXI A;  2BBU A;  1TCE A;  3PLF B;  1A1C A;  1O46 A;  2EO6 A;  1IJR A;  2LQW A;  1JU5 A;  4K44 A;  1GRI A;  3IMD A;  2MK2 A;  1M61 A;  3N8M A;  5IBM A;  1BG1 A;  5D0J A;  4FL3 A;  1SPS A;  2AOB A;  2FO0 A;  1CWE A;  1BF5 A;  2CI8 A;  1M27 A;  5HKW A;  1R1S A;  1O44 A;  3PSK A;  1A09 A;  1O4E A;  3KFJ A;  1AYC A;  1KA7 A;  3QWX X;  3HCK A;  3GXW A;  2EYY A;  3US4 A;  2IZV A;  2DM0 A;  1A81 A;  1CJ1 A;  4OHD A;  1AOT F;  2YSX A;  2Y3A B;  1LUM A;  1Y1U A;  1YVL A;  2YU7 A;  1SKJ A;  2CI9 A;  3CD3 A;  2Y1N A;  3VRY A;  2LNW A;  1SHD A;  2HUW A;  4H34 A;  2K79 B;  2DLZ A;  4D8K A;  1O48 A;  3K2M A;  2L6K A;  2ETZ A;  1AOU F;  3BKB A;  4F5A A;  1JYQ A;  4U1P A;  4P9V A;  4X6S A;  4P9Z A;  1OO4 A;  3UYO A;  4OHH A;  4A4C A;  1LUI A;  2XP1 A;  1O4A A;  1X27 A;  3IN7 A;  3N84 A;  4DGP A;  4GPL B;  4GL9 E;  1LUK A;  1JYU A;  1KA6 A;  2SRC A;  2B3O A;  4NWF A;  2K7A B;  2AUG A;  1YVH A;  3ZNI A;  4A4B A;  4XZ0 A;  1XA6 A;  4TZI A;  2KNO A;  2DVJ A;  1AYD A;  2PNB A;  3BUO B;  1O45 A;  1LUN A;  1FU6 A;  2H8H A;  1AYA A;  3HIZ B;  1CSZ A;  1O43 A;  4EIH A;  3WA4 A;  1A08 A;  3VS0 A;  1LCK A;  1MIL A;  1FMK A;  3S9K A;  3M7F A;  2H5K A;  5J3X A;  1R1Q A;  1FBV A;  1BM2 A;  5EHR A;  1MW4 A;  4JEG A;  4XZ1 A;  2IUG A;  1NZL A;  3VRQ A;  3MXC A;  1A1A A;  2C9W A;  4U17 A;  1LKK A;  1LCJ A;  1OPK A;  3PJP A;  5I6V A;  2DLY A;  3PQZ A;  1NZV A;  3BUN B;  3C7I A;  1CWD L;  3PS5 A;  4F5B A;  1PIC A;  1F1W A;  3BUX B;  5DC9 A;  3OV1 A;  5KAZ A;  1HCS B;  1O4B A;  5EHP A;  4JE4 A;  4JGH A;  1OO3 A;  5DC4 A;  2RSY A;  2CRH A;  2SHP A;  5EG3 B;  3VRZ A;  4FL2 A;  2LQN A;  3MAZ A;  1O4Q A;  2EL8 A;  2CR4 A;  2QMS A;  2GSB A;  5EEQ A;  2EOB A; 
#chains in the Genus database with same CATH topology
 1BMB A;  1A1B A;  4LUD A;  1H9O A;  1TZE E;  3VRN A;  4M4Z A;  3BUW B;  1RQQ C;  1B47 A;  2VIF A;  2AOA A;  3PSJ A;  3OP0 A;  3QWY A;  1SPR A;  3VS1 A;  4E68 A;  4QSY A;  1BKM A;  4OHE A;  2Y1M A;  1O4M A;  2EKX A;  2CBL A;  1GHU A;  4OHL A;  3CXL A;  5IBS A;  1ZFP E;  3OVE A;  2OQ1 A;  1G83 A;  2L4K A;  1A07 A;  4WWQ A;  4E93 A;  1QAD A;  1F2F A;  1O42 A;  3LYV A;  1BKL A;  3TKZ A;  1O4O A;  2PTK A;  1HCT B;  3OB2 B;  1D4T A;  2JYQ A;  4F59 A;  1O4G A;  5AUL A;  3GXX A;  2MRK A;  1KC2 A;  1AB2 A;  3UF4 A;  2PNA A;  2EYZ A;  1O4I A;  3BUM B;  1QG1 E;  1AD5 A;  3VS6 A;  2PLD A;  1SHA A;  3VRP A;  1BHF A;  1A1E A;  2LCT A;  2OZO A;  1K9A A;  1X0N A;  2CS0 A;  5BO4 A;  1O41 A;  2EU0 A;  2DX0 A;  4EY0 A;  1NRV A;  1FU5 A;  4DGX A;  3IN8 A;  3CBL A;  4FBN A;  5DF6 A;  1RJA A;  1BFJ A;  2HMH A;  1O4J A;  2CIA A;  4K11 A;  1FYR A;  1O4H A;  1CSY A;  1I3Z A;  1KSW A;  2MRJ A;  4L1B B;  3VRR A;  1BHH A;  1O47 A;  3VGO A;  2LNX A;  5EEL A;  1O4D A;  2C0T A;  1D1Z A;  3PFV A;  3VS3 A;  1BLJ A;  5DC0 B;  3T04 A;  1O4R A;  1Z3K A;  2FCI A;  3S8N A;  2H46 E;  2EO3 A;  2PLE A;  1D4W A;  2IUH A;  3VS2 A;  1FBZ A;  2HDX A;  2IUI A;  1JWO A;  1RPY A;  1O49 A;  4OHI A;  1QCF A;  1IS0 A;  1BFI A;  3VS7 A;  1SHB A;  3S8O A;  1O4C A;  4LUE A;  1BLK A;  1LKL A;  1OPL A;  3NHN A;  1UUR A;  3K2T A;  1AYB A;  2ROR A;  1JYR A;  3VS4 A;  2RMX A;  2MQI A;  4K2R A;  5GJI A;  5CDW A;  1O4P A;  1O4F A;  3VS5 A;  1BHH B;  2ECD A;  4ROJ A;  4GWF A;  2C0O A;  2HCK A;  1P13 A;  3VRO A;  5HKZ A;  4K45 A;  1WQU A;  2KK6 A;  1O4N A;  2GE9 A;  4H1O A;  3OB1 B;  3GQI B;  2MC1 A;  3CWG A;  2LRA A;  1X6C A;  1O4K A;  2EYV A;  4NWG A;  1UUS A;  2C0I A;  3MXY A;  2HDV A;  3HHM B;  3EAC A;  2L3T A;  3TL0 A;  3N7Y A;  1R1P A;  1Y57 A;  3IMJ A;  3S8L A;  2RVF A;  5GJH A;  2ABL A;  1FHS A;  5HKY A;  2DCR A;  3EAZ A;  1O4L A;  5AXI A;  2BBU A;  2KGY A;  1TCE A;  3PLF B;  1A1C A;  1O46 A;  2EO6 A;  1IJR A;  2LQW A;  1JU5 A;  4K44 A;  1GRI A;  3IMD A;  2MK2 A;  1M61 A;  3N8M A;  5IBM A;  1BG1 A;  5D0J A;  4FL3 A;  1SPS A;  2AOB A;  2FO0 A;  1CWE A;  1BF5 A;  2CI8 A;  1M27 A;  5HKW A;  1R1S A;  1O44 A;  3PSK A;  1A09 A;  1O4E A;  3KFJ A;  1AYC A;  1KA7 A;  3QWX X;  3HCK A;  3GXW A;  2EYY A;  3US4 A;  2IZV A;  2DM0 A;  1A81 A;  1CJ1 A;  4OHD A;  1AOT F;  2YSX A;  2Y3A B;  1LUM A;  1Y1U A;  1YVL A;  2YU7 A;  1SKJ A;  2CI9 A;  3CD3 A;  2Y1N A;  3VRY A;  2LNW A;  1SHD A;  2HUW A;  4H34 A;  2K79 B;  2DLZ A;  4D8K A;  1O48 A;  3K2M A;  2L6K A;  2ETZ A;  1AOU F;  3BKB A;  4F5A A;  1JYQ A;  4U1P A;  4P9V A;  4X6S A;  4P9Z A;  1OO4 A;  3UYO A;  4OHH A;  4A4C A;  1LUI A;  2XP1 A;  1O4A A;  1X27 A;  3IN7 A;  3N84 A;  4DGP A;  4GPL B;  4GL9 E;  1LUK A;  1JYU A;  1KA6 A;  2SRC A;  2B3O A;  4NWF A;  2K7A B;  2AUG A;  1YVH A;  3ZNI A;  4A4B A;  4XZ0 A;  1XA6 A;  4TZI A;  2KNO A;  2DVJ A;  1AYD A;  2PNB A;  3BUO B;  1O45 A;  1LUN A;  1FU6 A;  2H8H A;  1AYA A;  3HIZ B;  1CSZ A;  1O43 A;  4EIH A;  3WA4 A;  1A08 A;  3VS0 A;  1LCK A;  1MIL A;  1FMK A;  3S9K A;  3M7F A;  2H5K A;  5J3X A;  1R1Q A;  1FBV A;  1BM2 A;  5EHR A;  1MW4 A;  4JEG A;  4XZ1 A;  2IUG A;  1NZL A;  3VRQ A;  3MXC A;  1A1A A;  2C9W A;  4U17 A;  1LKK A;  1LCJ A;  1OPK A;  3PJP A;  5I6V A;  2DLY A;  3PQZ A;  1NZV A;  3BUN B;  3C7I A;  1CWD L;  3PS5 A;  4F5B A;  1PIC A;  1F1W A;  3BUX B;  5DC9 A;  3OV1 A;  5KAZ A;  1HCS B;  1O4B A;  5EHP A;  4JE4 A;  4JGH A;  1OO3 A;  2RSY A;  2SHP A;  2CRH A;  5DC4 A;  5EG3 B;  3VRZ A;  4FL2 A;  2LQN A;  3MAZ A;  1O4Q A;  2EL8 A;  2CR4 A;  2QMS A;  2GSB A;  5EEQ A;  2EOB A; 
#chains in the Genus database with same CATH homology
 1BMB A;  1A1B A;  4LUD A;  1H9O A;  1TZE E;  3VRN A;  4M4Z A;  3BUW B;  1RQQ C;  1B47 A;  2VIF A;  2AOA A;  3PSJ A;  3OP0 A;  3QWY A;  1SPR A;  3VS1 A;  4E68 A;  4QSY A;  1BKM A;  4OHE A;  2Y1M A;  1O4M A;  2EKX A;  2CBL A;  1GHU A;  4OHL A;  3CXL A;  5IBS A;  1ZFP E;  3OVE A;  2OQ1 A;  1G83 A;  2L4K A;  1A07 A;  4WWQ A;  4E93 A;  1QAD A;  1F2F A;  1O42 A;  1BKL A;  3TKZ A;  1O4O A;  2PTK A;  1HCT B;  3OB2 B;  1D4T A;  2JYQ A;  4F59 A;  1O4G A;  5AUL A;  3GXX A;  2MRK A;  1KC2 A;  1AB2 A;  3UF4 A;  2PNA A;  2EYZ A;  1O4I A;  3BUM B;  1QG1 E;  1AD5 A;  3VS6 A;  2PLD A;  1SHA A;  3VRP A;  1BHF A;  1A1E A;  2LCT A;  2OZO A;  1K9A A;  1X0N A;  2CS0 A;  5BO4 A;  1O41 A;  2EU0 A;  2DX0 A;  4EY0 A;  1NRV A;  1FU5 A;  4DGX A;  3IN8 A;  3CBL A;  4FBN A;  5DF6 A;  1RJA A;  1BFJ A;  2HMH A;  1O4J A;  2CIA A;  4K11 A;  1FYR A;  1O4H A;  1CSY A;  1I3Z A;  1KSW A;  2MRJ A;  4L1B B;  3VRR A;  1BHH A;  1O47 A;  3VGO A;  2LNX A;  5EEL A;  1O4D A;  2C0T A;  1D1Z A;  3PFV A;  3VS3 A;  1BLJ A;  5DC0 B;  3T04 A;  1O4R A;  1Z3K A;  2FCI A;  3S8N A;  2H46 E;  2EO3 A;  2PLE A;  1D4W A;  2IUH A;  3VS2 A;  1FBZ A;  2HDX A;  2IUI A;  1JWO A;  1RPY A;  1O49 A;  4OHI A;  1QCF A;  1IS0 A;  1BFI A;  3VS7 A;  1SHB A;  3S8O A;  1O4C A;  4LUE A;  1BLK A;  1LKL A;  1OPL A;  3NHN A;  1UUR A;  1AYB A;  2ROR A;  1JYR A;  3VS4 A;  2RMX A;  2MQI A;  4K2R A;  5GJI A;  5CDW A;  1O4P A;  1O4F A;  3VS5 A;  1BHH B;  2ECD A;  4ROJ A;  4GWF A;  2C0O A;  2HCK A;  1P13 A;  3VRO A;  5HKZ A;  4K45 A;  1WQU A;  2KK6 A;  1O4N A;  2GE9 A;  4H1O A;  3OB1 B;  3GQI B;  2MC1 A;  3CWG A;  1X6C A;  1O4K A;  2EYV A;  4NWG A;  1UUS A;  2C0I A;  3MXY A;  2HDV A;  3HHM B;  3EAC A;  2L3T A;  3TL0 A;  3N7Y A;  1R1P A;  1Y57 A;  3IMJ A;  3S8L A;  2RVF A;  5GJH A;  2ABL A;  1FHS A;  5HKY A;  2DCR A;  3EAZ A;  1O4L A;  5AXI A;  2BBU A;  1TCE A;  3PLF B;  1A1C A;  1O46 A;  2EO6 A;  1IJR A;  2LQW A;  1JU5 A;  4K44 A;  1GRI A;  3IMD A;  2MK2 A;  1M61 A;  3N8M A;  5IBM A;  1BG1 A;  5D0J A;  4FL3 A;  1SPS A;  2AOB A;  2FO0 A;  1CWE A;  1BF5 A;  2CI8 A;  1M27 A;  5HKW A;  1R1S A;  1O44 A;  3PSK A;  1A09 A;  1O4E A;  3KFJ A;  1AYC A;  1KA7 A;  3QWX X;  3HCK A;  3GXW A;  2EYY A;  3US4 A;  2IZV A;  2DM0 A;  1A81 A;  1CJ1 A;  4OHD A;  1AOT F;  2YSX A;  2Y3A B;  1LUM A;  1Y1U A;  1YVL A;  2YU7 A;  1SKJ A;  2CI9 A;  3CD3 A;  2Y1N A;  3VRY A;  2LNW A;  1SHD A;  2HUW A;  4H34 A;  2K79 B;  2DLZ A;  4D8K A;  1O48 A;  3K2M A;  2L6K A;  2ETZ A;  1AOU F;  3BKB A;  4F5A A;  1JYQ A;  4U1P A;  4P9V A;  4X6S A;  4P9Z A;  1OO4 A;  3UYO A;  4OHH A;  4A4C A;  1LUI A;  2XP1 A;  1O4A A;  1X27 A;  3IN7 A;  3N84 A;  4DGP A;  4GPL B;  4GL9 E;  1LUK A;  1JYU A;  1KA6 A;  2SRC A;  2B3O A;  4NWF A;  2K7A B;  2AUG A;  1YVH A;  3ZNI A;  4A4B A;  4XZ0 A;  1XA6 A;  4TZI A;  2KNO A;  2DVJ A;  1AYD A;  2PNB A;  3BUO B;  1O45 A;  1LUN A;  1FU6 A;  2H8H A;  1AYA A;  3HIZ B;  1CSZ A;  1O43 A;  4EIH A;  3WA4 A;  1A08 A;  3VS0 A;  1LCK A;  1MIL A;  1FMK A;  3S9K A;  3M7F A;  2H5K A;  5J3X A;  1R1Q A;  1FBV A;  1BM2 A;  5EHR A;  1MW4 A;  4JEG A;  4XZ1 A;  2IUG A;  1NZL A;  3VRQ A;  3MXC A;  1A1A A;  2C9W A;  4U17 A;  1LKK A;  1LCJ A;  1OPK A;  3PJP A;  5I6V A;  2DLY A;  3PQZ A;  1NZV A;  3BUN B;  3C7I A;  1CWD L;  3PS5 A;  4F5B A;  1PIC A;  1F1W A;  3BUX B;  5DC9 A;  3OV1 A;  5KAZ A;  1HCS B;  1O4B A;  5EHP A;  4JE4 A;  4JGH A;  1OO3 A;  5DC4 A;  2RSY A;  2CRH A;  2SHP A;  5EG3 B;  3VRZ A;  4FL2 A;  2LQN A;  3MAZ A;  1O4Q A;  2EL8 A;  2CR4 A;  2QMS A;  2GSB A;  5EEQ A;  2EOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...