2KK6A

Solution structure of sh2 domain of proto-oncogene tyrosine-protein kinase fer from homo sapiens, northeast structural genomics consortium (nesg) target hr3461d
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
116
structure length
116
Chain Sequence
b'MGHHHHHHSHMKPLAEQDWYHGAIPRIEAQELLKKQGDFLVRESHGKPGEYVLSVYSDGQRRHFIIQYVDNMYRFEGTGFSNIPQLIDHHYTTKQVITKKSGVVLLNPIPKDKKWI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase FER
publication title Solution structure of sh2 domain of proto-oncogene tyrosine-protein kinase fer from homo sapiens, northeast structural genomics consortium (nesg) target hr3461d
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 21
structure length 116
sequence length 116
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2kk6A00
1LKLA 2LQNA 3VRZA 3PSKA 4P9VA 2DLZA 1GHUA 2K79B 4F5AA 4DGXA 2K7AB 1AD5A 2EO3A 4X6SA 2HDVA 3VS6A 3BUNB 2ECDA 1BMBA 1CJ1A 2EOBA 1BLKA 1CSZA 1TCEA 1BF5A 3N8MA 3TL0A 4F5BA 2PNAA 1O4KA 2EL8A 2ETZA 1SHBA 5DC0B 1FHSA 1BHFA 1KA7A 1QG1E 1A1EA 1F1WA 1RJAA 1Y1UA 1ZFPE 5AULA 1JWOA 5GJIA 5I6VA 4DGPA 2GE9A 1O4IA 1AOTF 3GXXA 5EHPA 3C7IA 1SPRA 1LKKA 2IUIA 2CI9A 2VIFA 4D8KA 2YU7A 5IBSA 1O4AA 3VS2A 4JGHA 3CD3A 2RSYA 1OPLA 3BUXB 3VRRA 1FBZA 4K45A 1O4JA 1BHHA 1A1AA 1BFJA 2OQ1A 3EACA 1JYUA 2H46E 1FU5A 1O4FA 1A81A 2AOAA 3EAZA 1K9AA 2EO6A 2QMSA 5DC4A 4FL3A 1CWDL 1A1BA 2LNWA 1O44A 3KFJA 3PJPA 1A1CA 3N84A 1AYAA 3MXCA 1O4LA 4OHHA 5DC9A 3VS5A 4EIHA 1O4PA 3ZNIA 2L6KA 1BHHB 1O45A 2EYVA 2DLYA 2B3OA 1A09A 1BLJA 3VS1A 1NRVA 1H9OA 1MW4A 2IZVA 4A4CA 2EU0A 2JYQA 1CWEA 1AYCA 1G83A 1JYQA 4L1BB 1FBVA 1X0NA 2RVFA 1OPKA 3OV1A 2L3TA 3BUMB 2C0IA 3VS0A 2C0TA 3OP0A 3UYOA 1M61A 3IN7A 3HCKA 1LCKA 2C0OA 3PLFB 3PSJA 3WA4A 3MAZA 5CDWA 1HCTB 5D0JA 3HHMB 3BKBA 3BUOB 2LNXA 3VS4A 2CIAA 1AB2A 1B47A 2SHPA 5HKZA 1O41A 3VRPA 1IS0A 1YVHA 3VRQA 1QCFA 2CBLA 2HCKA 5EHRA 3NHNA 3T04A 1PICA 2HUWA 4GL9E 1BG1A 4NWFA 2MC1A 2CI8A 1O4BA 2IUHA 2FO0A 1O4QA 1M27A 4OHDA 2PNBA 2DM0A 2CR4A 5J3XA 1O4CA 1BM2A 1O47A 1JU5A 1D4TA 4WWQA 1AYBA 3CXLA 5AXIA 2BBUA 4FBNA 1RPYA 4M4ZA 1R1SA 1CSYA 1O4EA 1O4NA 5EG3B 2Y1NA 2SRCA 3IN8A 3S8NA 3US4A 1IJRA 2AUGA 5EELA 5KAZA 3CBLA 4EY0A 2EYYA 2Y3AB 4K2RA 1FMKA 2YSXA 1O4HA 4E93A 4ROJA 2LQWA 4GWFA 5EEQA 1O4MA 1A08A 1WQUA 4U1PA 1KA6A 1FU6A 2DVJA 2AOBA 1R1QA 2MK2A 3CWGA 2L4KA 3UF4A 1HCSB 1FYRA 2HDXA 3BUWB 1MILA 3GQIB 4U17A 4XZ1A 1UUSA 4H34A 1SHDA 1XA6A 2HMHA 3HIZB 5HKYA 3OVEA 1F2FA 1X27A 1YVLA 3MXYA 1BKMA 1SHAA 4OHLA 1BFIA 1AYDA 5DF6A 4OHIA 1SKJA 1UURA 3OB1B 2KNOA 4OHEA 1O42A 2H5KA 1JYRA 3IMDA 3S8OA 1NZVA 3N7YA 1OO4A 1KC2A 2GSBA 2MRJA 1LUNA 2ABLA 1O46A 4QSYA 1LUMA 1O43A 2LCTA 3PQZA 5BO4A 1D4WA 2FCIA 4LUEA 1O48A 3QWYA 1AOUF 1R1PA 1O49A 1X6CA 1OO3A 4E68A 3S8LA 1TZEE 1LCJA 3VROA 3K2MA 2CRHA 1Z3KA 1NZLA 5IBMA 3GXWA 4NWGA 1O4RA 2RORA 1O4OA 1SPSA 2PLEA 3VS7A 2CS0A 1O4GA 3IMJA 3PFVA 2MQIA 4P9ZA 4F59A 3VGOA 2EYZA 4LUDA 5GJHA 1O4DA 2PTKA 2DX0A 1GRIA 1RQQC 3OB2B 3QWXX 1D1ZA 1KSWA 1I3ZA 1Y57A 3VRYA 1LUIA 1P13A 3VS3A 2DCRA 4JE4A 3PS5A 1A07A 3TKZA 2IUGA 4A4BA 2H8HA 3M7FA 4K11A 4JEGA 4H1OA 2XP1A 4K44A 5HKWA 2C9WA 2EKXA 4TZIA 4FL2A 2RMXA 1QADA 3S9KA 1LUKA 2MRKA 2OZOA 3VRNA 2KK6A 4GPLB 2PLDA 1BKLA 4XZ0A 2Y1MA
chains in the Genus database with same CATH superfamily
1LKLA 2LQNA 3VRZA 3PSKA 4P9VA 2DLZA 1GHUA 2K79B 4F5AA 4DGXA 2K7AB 1AD5A 2EO3A 4X6SA 2HDVA 3VS6A 3BUNB 2ECDA 1BMBA 1CJ1A 2EOBA 1BLKA 1CSZA 1TCEA 1BF5A 3N8MA 3TL0A 4F5BA 2PNAA 1O4KA 2EL8A 2ETZA 1SHBA 5DC0B 1FHSA 1BHFA 1KA7A 1QG1E 1A1EA 1F1WA 1RJAA 1Y1UA 1ZFPE 5AULA 1JWOA 5GJIA 5I6VA 4DGPA 2GE9A 1O4IA 1AOTF 3GXXA 5EHPA 3C7IA 1SPRA 1LKKA 3LYVA 2IUIA 2CI9A 2VIFA 4D8KA 2YU7A 5IBSA 1O4AA 3VS2A 4JGHA 3CD3A 2RSYA 1OPLA 3BUXB 3VRRA 1FBZA 4K45A 1O4JA 1BHHA 1A1AA 1BFJA 2OQ1A 3EACA 1JYUA 2H46E 1FU5A 1O4FA 1A81A 2AOAA 3EAZA 1K9AA 2EO6A 2QMSA 5DC4A 4FL3A 1CWDL 1A1BA 2LNWA 1O44A 3KFJA 3PJPA 1A1CA 3N84A 1AYAA 3MXCA 1O4LA 3K2TA 4OHHA 5DC9A 3VS5A 4EIHA 1O4PA 3ZNIA 2L6KA 1BHHB 1O45A 2EYVA 2DLYA 2B3OA 1A09A 1BLJA 3VS1A 1NRVA 1H9OA 1MW4A 2IZVA 4A4CA 2EU0A 2JYQA 1CWEA 1AYCA 1G83A 1JYQA 4L1BB 1FBVA 1X0NA 2RVFA 1OPKA 3OV1A 2L3TA 3BUMB 2C0IA 3VS0A 2C0TA 3OP0A 3UYOA 1M61A 3IN7A 3HCKA 1LCKA 2C0OA 3PLFB 3PSJA 3WA4A 3MAZA 5CDWA 1HCTB 5D0JA 3HHMB 3BKBA 3BUOB 2LNXA 3VS4A 2CIAA 1AB2A 1B47A 2SHPA 5HKZA 2KGYA 1O41A 3VRPA 1IS0A 1YVHA 3VRQA 1QCFA 2CBLA 2HCKA 5EHRA 3NHNA 3T04A 1PICA 2HUWA 4GL9E 1BG1A 4NWFA 2MC1A 2CI8A 1O4BA 2IUHA 2FO0A 1O4QA 1M27A 4OHDA 2PNBA 2DM0A 2CR4A 5J3XA 1O4CA 1BM2A 1O47A 1JU5A 1D4TA 4WWQA 1AYBA 3CXLA 5AXIA 2BBUA 4FBNA 1RPYA 4M4ZA 1R1SA 1CSYA 1O4EA 1O4NA 5EG3B 2Y1NA 2SRCA 3IN8A 3S8NA 3US4A 1IJRA 2AUGA 5EELA 5KAZA 3CBLA 4EY0A 2EYYA 2Y3AB 4K2RA 1FMKA 2YSXA 1O4HA 4E93A 4ROJA 2LQWA 4GWFA 5EEQA 1O4MA 1A08A 1WQUA 4U1PA 1KA6A 1FU6A 2DVJA 2AOBA 1R1QA 2MK2A 3CWGA 2L4KA 3UF4A 1HCSB 1FYRA 2HDXA 3BUWB 1MILA 3GQIB 4U17A 4XZ1A 1UUSA 4H34A 1SHDA 1XA6A 2HMHA 3HIZB 5HKYA 3OVEA 1F2FA 1X27A 1YVLA 3MXYA 1BKMA 1SHAA 4OHLA 1BFIA 1AYDA 5DF6A 4OHIA 1SKJA 1UURA 3OB1B 2KNOA 4OHEA 1O42A 2H5KA 1JYRA 3IMDA 3S8OA 1NZVA 3N7YA 1OO4A 1KC2A 2GSBA 2MRJA 1LUNA 2ABLA 1O46A 4QSYA 1LUMA 1O43A 2LCTA 3PQZA 5BO4A 1D4WA 2FCIA 4LUEA 1O48A 3QWYA 1AOUF 1R1PA 1O49A 1X6CA 1OO3A 4E68A 3S8LA 1TZEE 1LCJA 3VROA 2LRAA 3K2MA 2CRHA 1Z3KA 1NZLA 5IBMA 3GXWA 4NWGA 1O4RA 2RORA 1O4OA 1SPSA 2PLEA 3VS7A 2CS0A 1O4GA 3IMJA 3PFVA 2MQIA 4P9ZA 4F59A 3VGOA 2EYZA 4LUDA 5GJHA 1O4DA 2PTKA 2DX0A 1GRIA 1RQQC 3OB2B 3QWXX 1D1ZA 1KSWA 1I3ZA 1Y57A 3VRYA 1LUIA 1P13A 3VS3A 2DCRA 4JE4A 3PS5A 1A07A 3TKZA 2IUGA 4A4BA 2H8HA 3M7FA 4K11A 4JEGA 4H1OA 2XP1A 4K44A 5HKWA 2C9WA 2EKXA 4TZIA 4FL2A 2RMXA 1QADA 3S9KA 1LUKA 2MRKA 2OZOA 3VRNA 2KK6A 4GPLB 2PLDA 1BKLA 4XZ0A 2Y1MA
chains in the Genus database with same CATH topology
1LKLA 2LQNA 3VRZA 3PSKA 4P9VA 2DLZA 1GHUA 2K79B 4F5AA 4DGXA 2K7AB 1AD5A 2EO3A 4X6SA 2HDVA 3VS6A 3BUNB 2ECDA 1BMBA 1CJ1A 2EOBA 1BLKA 1CSZA 1TCEA 1BF5A 3N8MA 3TL0A 4F5BA 2PNAA 1O4KA 2EL8A 2ETZA 1SHBA 5DC0B 1FHSA 1BHFA 1KA7A 1QG1E 1A1EA 1F1WA 1RJAA 1Y1UA 1ZFPE 5AULA 1JWOA 5GJIA 5I6VA 4DGPA 2GE9A 1O4IA 1AOTF 3GXXA 5EHPA 3C7IA 1SPRA 1LKKA 2IUIA 2CI9A 2VIFA 4D8KA 2YU7A 5IBSA 1O4AA 3VS2A 4JGHA 3CD3A 2RSYA 1OPLA 3BUXB 3VRRA 1FBZA 4K45A 1O4JA 1BHHA 1A1AA 1BFJA 2OQ1A 3EACA 1JYUA 2H46E 1FU5A 1O4FA 1A81A 2AOAA 3EAZA 1K9AA 2EO6A 2QMSA 5DC4A 4FL3A 1CWDL 1A1BA 2LNWA 1O44A 3KFJA 3PJPA 1A1CA 3N84A 1AYAA 3MXCA 1O4LA 4OHHA 5DC9A 3VS5A 4EIHA 1O4PA 3ZNIA 2L6KA 1BHHB 1O45A 2EYVA 2DLYA 2B3OA 1A09A 1BLJA 3VS1A 1NRVA 1H9OA 1MW4A 2IZVA 4A4CA 2EU0A 2JYQA 1CWEA 1AYCA 1G83A 1JYQA 4L1BB 1FBVA 1X0NA 2RVFA 1OPKA 3OV1A 2L3TA 3BUMB 2C0IA 3VS0A 2C0TA 3OP0A 3UYOA 1M61A 3IN7A 3HCKA 1LCKA 2C0OA 3PLFB 3PSJA 3WA4A 3MAZA 5CDWA 1HCTB 5D0JA 3HHMB 3BKBA 3BUOB 2LNXA 3VS4A 2CIAA 1AB2A 1B47A 2SHPA 5HKZA 1O41A 3VRPA 1IS0A 1YVHA 3VRQA 1QCFA 2CBLA 2HCKA 5EHRA 3NHNA 3T04A 1PICA 2HUWA 4GL9E 1BG1A 4NWFA 2MC1A 2CI8A 1O4BA 2IUHA 2FO0A 1O4QA 1M27A 4OHDA 2PNBA 2DM0A 2CR4A 5J3XA 1O4CA 1BM2A 1O47A 1JU5A 1D4TA 4WWQA 1AYBA 3CXLA 5AXIA 2BBUA 4FBNA 1RPYA 4M4ZA 1R1SA 1CSYA 1O4EA 1O4NA 5EG3B 2Y1NA 2SRCA 3IN8A 3S8NA 3US4A 1IJRA 2AUGA 5EELA 5KAZA 3CBLA 4EY0A 2EYYA 2Y3AB 4K2RA 1FMKA 2YSXA 1O4HA 4E93A 4ROJA 2LQWA 4GWFA 5EEQA 1O4MA 1A08A 1WQUA 4U1PA 1KA6A 1FU6A 2DVJA 2AOBA 1R1QA 2MK2A 3CWGA 2L4KA 3UF4A 1HCSB 1FYRA 2HDXA 3BUWB 1MILA 3GQIB 4U17A 4XZ1A 1UUSA 4H34A 1SHDA 1XA6A 2HMHA 3HIZB 5HKYA 3OVEA 1F2FA 1X27A 1YVLA 3MXYA 1BKMA 1SHAA 4OHLA 1BFIA 1AYDA 5DF6A 4OHIA 1SKJA 1UURA 3OB1B 2KNOA 4OHEA 1O42A 2H5KA 1JYRA 3IMDA 3S8OA 1NZVA 3N7YA 1OO4A 1KC2A 2GSBA 2MRJA 1LUNA 2ABLA 1O46A 4QSYA 1LUMA 1O43A 2LCTA 3PQZA 5BO4A 1D4WA 2FCIA 4LUEA 1O48A 3QWYA 1AOUF 1R1PA 1O49A 1X6CA 1OO3A 4E68A 3S8LA 1TZEE 1LCJA 3VROA 3K2MA 2CRHA 1Z3KA 1NZLA 5IBMA 3GXWA 4NWGA 1O4RA 2RORA 1O4OA 1SPSA 2PLEA 3VS7A 2CS0A 1O4GA 3IMJA 3PFVA 2MQIA 4P9ZA 4F59A 3VGOA 2EYZA 4LUDA 5GJHA 1O4DA 2PTKA 2DX0A 1GRIA 1RQQC 3OB2B 3QWXX 1D1ZA 1KSWA 1I3ZA 1Y57A 3VRYA 1LUIA 1P13A 3VS3A 2DCRA 4JE4A 3PS5A 1A07A 3TKZA 2IUGA 4A4BA 2H8HA 3M7FA 4K11A 4JEGA 4H1OA 2XP1A 4K44A 5HKWA 2C9WA 2EKXA 4TZIA 4FL2A 2RMXA 1QADA 3S9KA 1LUKA 2MRKA 2OZOA 3VRNA 2KK6A 4GPLB 2PLDA 1BKLA 4XZ0A 2Y1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LKL A;  2LQN A;  3VRZ A;  3PSK A;  4P9V A;  2DLZ A;  1GHU A;  2K79 B;  4F5A A;  4DGX A;  2K7A B;  1AD5 A;  2EO3 A;  4X6S A;  2HDV A;  3VS6 A;  3BUN B;  2ECD A;  1BMB A;  1CJ1 A;  2EOB A;  1BLK A;  1CSZ A;  1TCE A;  1BF5 A;  3N8M A;  3TL0 A;  4F5B A;  2PNA A;  1O4K A;  2EL8 A;  2ETZ A;  1SHB A;  5DC0 B;  1FHS A;  1BHF A;  1KA7 A;  1QG1 E;  1A1E A;  1F1W A;  1RJA A;  1Y1U A;  1ZFP E;  5AUL A;  1JWO A;  5GJI A;  5I6V A;  4DGP A;  2GE9 A;  1O4I A;  1AOT F;  3GXX A;  5EHP A;  3C7I A;  1SPR A;  1LKK A;  2IUI A;  2CI9 A;  2VIF A;  4D8K A;  2YU7 A;  5IBS A;  1O4A A;  3VS2 A;  4JGH A;  3CD3 A;  2RSY A;  1OPL A;  3BUX B;  3VRR A;  1FBZ A;  4K45 A;  1O4J A;  1BHH A;  1A1A A;  1BFJ A;  2OQ1 A;  3EAC A;  1JYU A;  2H46 E;  1FU5 A;  1O4F A;  1A81 A;  2AOA A;  3EAZ A;  1K9A A;  2EO6 A;  2QMS A;  5DC4 A;  4FL3 A;  1CWD L;  1A1B A;  2LNW A;  1O44 A;  3KFJ A;  3PJP A;  1A1C A;  3N84 A;  1AYA A;  3MXC A;  1O4L A;  4OHH A;  5DC9 A;  3VS5 A;  4EIH A;  1O4P A;  3ZNI A;  2L6K A;  1BHH B;  1O45 A;  2EYV A;  2DLY A;  2B3O A;  1A09 A;  1BLJ A;  3VS1 A;  1NRV A;  1H9O A;  1MW4 A;  2IZV A;  4A4C A;  2EU0 A;  2JYQ A;  1CWE A;  1AYC A;  1G83 A;  1JYQ A;  4L1B B;  1FBV A;  1X0N A;  2RVF A;  1OPK A;  3OV1 A;  2L3T A;  3BUM B;  2C0I A;  3VS0 A;  2C0T A;  3OP0 A;  3UYO A;  1M61 A;  3IN7 A;  3HCK A;  1LCK A;  2C0O A;  3PLF B;  3PSJ A;  3WA4 A;  3MAZ A;  5CDW A;  1HCT B;  5D0J A;  3HHM B;  3BKB A;  3BUO B;  2LNX A;  3VS4 A;  2CIA A;  1AB2 A;  1B47 A;  2SHP A;  5HKZ A;  1O41 A;  3VRP A;  1IS0 A;  1YVH A;  3VRQ A;  1QCF A;  2CBL A;  2HCK A;  5EHR A;  3NHN A;  3T04 A;  1PIC A;  2HUW A;  4GL9 E;  1BG1 A;  4NWF A;  2MC1 A;  2CI8 A;  1O4B A;  2IUH A;  2FO0 A;  1O4Q A;  1M27 A;  4OHD A;  2PNB A;  2DM0 A;  2CR4 A;  5J3X A;  1O4C A;  1BM2 A;  1O47 A;  1JU5 A;  1D4T A;  4WWQ A;  1AYB A;  3CXL A;  5AXI A;  2BBU A;  4FBN A;  1RPY A;  4M4Z A;  1R1S A;  1CSY A;  1O4E A;  1O4N A;  5EG3 B;  2Y1N A;  2SRC A;  3IN8 A;  3S8N A;  3US4 A;  1IJR A;  2AUG A;  5EEL A;  5KAZ A;  3CBL A;  4EY0 A;  2EYY A;  2Y3A B;  4K2R A;  1FMK A;  2YSX A;  1O4H A;  4E93 A;  4ROJ A;  2LQW A;  4GWF A;  5EEQ A;  1O4M A;  1A08 A;  1WQU A;  4U1P A;  1KA6 A;  1FU6 A;  2DVJ A;  2AOB A;  1R1Q A;  2MK2 A;  3CWG A;  2L4K A;  3UF4 A;  1HCS B;  1FYR A;  2HDX A;  3BUW B;  1MIL A;  3GQI B;  4U17 A;  4XZ1 A;  1UUS A;  4H34 A;  1SHD A;  1XA6 A;  2HMH A;  3HIZ B;  5HKY A;  3OVE A;  1F2F A;  1X27 A;  1YVL A;  3MXY A;  1BKM A;  1SHA A;  4OHL A;  1BFI A;  1AYD A;  5DF6 A;  4OHI A;  1SKJ A;  1UUR A;  3OB1 B;  2KNO A;  4OHE A;  1O42 A;  2H5K A;  1JYR A;  3IMD A;  3S8O A;  1NZV A;  3N7Y A;  1OO4 A;  1KC2 A;  2GSB A;  2MRJ A;  1LUN A;  2ABL A;  1O46 A;  4QSY A;  1LUM A;  1O43 A;  2LCT A;  3PQZ A;  5BO4 A;  1D4W A;  2FCI A;  4LUE A;  1O48 A;  3QWY A;  1AOU F;  1R1P A;  1O49 A;  1X6C A;  1OO3 A;  4E68 A;  3S8L A;  1TZE E;  1LCJ A;  3VRO A;  3K2M A;  2CRH A;  1Z3K A;  1NZL A;  5IBM A;  3GXW A;  4NWG A;  1O4R A;  2ROR A;  1O4O A;  1SPS A;  2PLE A;  3VS7 A;  2CS0 A;  1O4G A;  3IMJ A;  3PFV A;  2MQI A;  4P9Z A;  4F59 A;  3VGO A;  2EYZ A;  4LUD A;  5GJH A;  1O4D A;  2PTK A;  2DX0 A;  1GRI A;  1RQQ C;  3OB2 B;  3QWX X;  1D1Z A;  1KSW A;  1I3Z A;  1Y57 A;  3VRY A;  1LUI A;  1P13 A;  3VS3 A;  2DCR A;  4JE4 A;  3PS5 A;  1A07 A;  3TKZ A;  2IUG A;  4A4B A;  2H8H A;  3M7F A;  4K11 A;  4JEG A;  4H1O A;  2XP1 A;  4K44 A;  5HKW A;  2C9W A;  2EKX A;  4TZI A;  4FL2 A;  2RMX A;  1QAD A;  3S9K A;  1LUK A;  2MRK A;  2OZO A;  3VRN A;  2KK6 A;  4GPL B;  2PLD A;  1BKL A;  4XZ0 A;  2Y1M A; 
#chains in the Genus database with same CATH topology
 1LKL A;  2LQN A;  3VRZ A;  3PSK A;  4P9V A;  2DLZ A;  1GHU A;  2K79 B;  4F5A A;  4DGX A;  2K7A B;  1AD5 A;  2EO3 A;  4X6S A;  2HDV A;  3VS6 A;  3BUN B;  2ECD A;  1BMB A;  1CJ1 A;  2EOB A;  1BLK A;  1CSZ A;  1TCE A;  1BF5 A;  3N8M A;  3TL0 A;  4F5B A;  2PNA A;  1O4K A;  2EL8 A;  2ETZ A;  1SHB A;  5DC0 B;  1FHS A;  1BHF A;  1KA7 A;  1QG1 E;  1A1E A;  1F1W A;  1RJA A;  1Y1U A;  1ZFP E;  5AUL A;  1JWO A;  5GJI A;  5I6V A;  4DGP A;  2GE9 A;  1O4I A;  1AOT F;  3GXX A;  5EHP A;  3C7I A;  1SPR A;  1LKK A;  3LYV A;  2IUI A;  2CI9 A;  2VIF A;  4D8K A;  2YU7 A;  5IBS A;  1O4A A;  3VS2 A;  4JGH A;  3CD3 A;  2RSY A;  1OPL A;  3BUX B;  3VRR A;  1FBZ A;  4K45 A;  1O4J A;  1BHH A;  1A1A A;  1BFJ A;  2OQ1 A;  3EAC A;  1JYU A;  2H46 E;  1FU5 A;  1O4F A;  1A81 A;  2AOA A;  3EAZ A;  1K9A A;  2EO6 A;  2QMS A;  5DC4 A;  4FL3 A;  1CWD L;  1A1B A;  2LNW A;  1O44 A;  3KFJ A;  3PJP A;  1A1C A;  3N84 A;  1AYA A;  3MXC A;  1O4L A;  3K2T A;  4OHH A;  5DC9 A;  3VS5 A;  4EIH A;  1O4P A;  3ZNI A;  2L6K A;  1BHH B;  1O45 A;  2EYV A;  2DLY A;  2B3O A;  1A09 A;  1BLJ A;  3VS1 A;  1NRV A;  1H9O A;  1MW4 A;  2IZV A;  4A4C A;  2EU0 A;  2JYQ A;  1CWE A;  1AYC A;  1G83 A;  1JYQ A;  4L1B B;  1FBV A;  1X0N A;  2RVF A;  1OPK A;  3OV1 A;  2L3T A;  3BUM B;  2C0I A;  3VS0 A;  2C0T A;  3OP0 A;  3UYO A;  1M61 A;  3IN7 A;  3HCK A;  1LCK A;  2C0O A;  3PLF B;  3PSJ A;  3WA4 A;  3MAZ A;  5CDW A;  1HCT B;  5D0J A;  3HHM B;  3BKB A;  3BUO B;  2LNX A;  3VS4 A;  2CIA A;  1AB2 A;  1B47 A;  2SHP A;  5HKZ A;  2KGY A;  1O41 A;  3VRP A;  1IS0 A;  1YVH A;  3VRQ A;  1QCF A;  2CBL A;  2HCK A;  5EHR A;  3NHN A;  3T04 A;  1PIC A;  2HUW A;  4GL9 E;  1BG1 A;  4NWF A;  2MC1 A;  2CI8 A;  1O4B A;  2IUH A;  2FO0 A;  1O4Q A;  1M27 A;  4OHD A;  2PNB A;  2DM0 A;  2CR4 A;  5J3X A;  1O4C A;  1BM2 A;  1O47 A;  1JU5 A;  1D4T A;  4WWQ A;  1AYB A;  3CXL A;  5AXI A;  2BBU A;  4FBN A;  1RPY A;  4M4Z A;  1R1S A;  1CSY A;  1O4E A;  1O4N A;  5EG3 B;  2Y1N A;  2SRC A;  3IN8 A;  3S8N A;  3US4 A;  1IJR A;  2AUG A;  5EEL A;  5KAZ A;  3CBL A;  4EY0 A;  2EYY A;  2Y3A B;  4K2R A;  1FMK A;  2YSX A;  1O4H A;  4E93 A;  4ROJ A;  2LQW A;  4GWF A;  5EEQ A;  1O4M A;  1A08 A;  1WQU A;  4U1P A;  1KA6 A;  1FU6 A;  2DVJ A;  2AOB A;  1R1Q A;  2MK2 A;  3CWG A;  2L4K A;  3UF4 A;  1HCS B;  1FYR A;  2HDX A;  3BUW B;  1MIL A;  3GQI B;  4U17 A;  4XZ1 A;  1UUS A;  4H34 A;  1SHD A;  1XA6 A;  2HMH A;  3HIZ B;  5HKY A;  3OVE A;  1F2F A;  1X27 A;  1YVL A;  3MXY A;  1BKM A;  1SHA A;  4OHL A;  1BFI A;  1AYD A;  5DF6 A;  4OHI A;  1SKJ A;  1UUR A;  3OB1 B;  2KNO A;  4OHE A;  1O42 A;  2H5K A;  1JYR A;  3IMD A;  3S8O A;  1NZV A;  3N7Y A;  1OO4 A;  1KC2 A;  2GSB A;  2MRJ A;  1LUN A;  2ABL A;  1O46 A;  4QSY A;  1LUM A;  1O43 A;  2LCT A;  3PQZ A;  5BO4 A;  1D4W A;  2FCI A;  4LUE A;  1O48 A;  3QWY A;  1AOU F;  1R1P A;  1O49 A;  1X6C A;  1OO3 A;  4E68 A;  3S8L A;  1TZE E;  1LCJ A;  3VRO A;  2LRA A;  3K2M A;  2CRH A;  1Z3K A;  1NZL A;  5IBM A;  3GXW A;  4NWG A;  1O4R A;  2ROR A;  1O4O A;  1SPS A;  2PLE A;  3VS7 A;  2CS0 A;  1O4G A;  3IMJ A;  3PFV A;  2MQI A;  4P9Z A;  4F59 A;  3VGO A;  2EYZ A;  4LUD A;  5GJH A;  1O4D A;  2PTK A;  2DX0 A;  1GRI A;  1RQQ C;  3OB2 B;  3QWX X;  1D1Z A;  1KSW A;  1I3Z A;  1Y57 A;  3VRY A;  1LUI A;  1P13 A;  3VS3 A;  2DCR A;  4JE4 A;  3PS5 A;  1A07 A;  3TKZ A;  2IUG A;  4A4B A;  2H8H A;  3M7F A;  4K11 A;  4JEG A;  4H1O A;  2XP1 A;  4K44 A;  5HKW A;  2C9W A;  2EKX A;  4TZI A;  4FL2 A;  2RMX A;  1QAD A;  3S9K A;  1LUK A;  2MRK A;  2OZO A;  3VRN A;  2KK6 A;  4GPL B;  2PLD A;  1BKL A;  4XZ0 A;  2Y1M A; 
#chains in the Genus database with same CATH homology
 1LKL A;  2LQN A;  3VRZ A;  3PSK A;  4P9V A;  2DLZ A;  1GHU A;  2K79 B;  4F5A A;  4DGX A;  2K7A B;  1AD5 A;  2EO3 A;  4X6S A;  2HDV A;  3VS6 A;  3BUN B;  2ECD A;  1BMB A;  1CJ1 A;  2EOB A;  1BLK A;  1CSZ A;  1TCE A;  1BF5 A;  3N8M A;  3TL0 A;  4F5B A;  2PNA A;  1O4K A;  2EL8 A;  2ETZ A;  1SHB A;  5DC0 B;  1FHS A;  1BHF A;  1KA7 A;  1QG1 E;  1A1E A;  1F1W A;  1RJA A;  1Y1U A;  1ZFP E;  5AUL A;  1JWO A;  5GJI A;  5I6V A;  4DGP A;  2GE9 A;  1O4I A;  1AOT F;  3GXX A;  5EHP A;  3C7I A;  1SPR A;  1LKK A;  2IUI A;  2CI9 A;  2VIF A;  4D8K A;  2YU7 A;  5IBS A;  1O4A A;  3VS2 A;  4JGH A;  3CD3 A;  2RSY A;  1OPL A;  3BUX B;  3VRR A;  1FBZ A;  4K45 A;  1O4J A;  1BHH A;  1A1A A;  1BFJ A;  2OQ1 A;  3EAC A;  1JYU A;  2H46 E;  1FU5 A;  1O4F A;  1A81 A;  2AOA A;  3EAZ A;  1K9A A;  2EO6 A;  2QMS A;  5DC4 A;  4FL3 A;  1CWD L;  1A1B A;  2LNW A;  1O44 A;  3KFJ A;  3PJP A;  1A1C A;  3N84 A;  1AYA A;  3MXC A;  1O4L A;  4OHH A;  5DC9 A;  3VS5 A;  4EIH A;  1O4P A;  3ZNI A;  2L6K A;  1BHH B;  1O45 A;  2EYV A;  2DLY A;  2B3O A;  1A09 A;  1BLJ A;  3VS1 A;  1NRV A;  1H9O A;  1MW4 A;  2IZV A;  4A4C A;  2EU0 A;  2JYQ A;  1CWE A;  1AYC A;  1G83 A;  1JYQ A;  4L1B B;  1FBV A;  1X0N A;  2RVF A;  1OPK A;  3OV1 A;  2L3T A;  3BUM B;  2C0I A;  3VS0 A;  2C0T A;  3OP0 A;  3UYO A;  1M61 A;  3IN7 A;  3HCK A;  1LCK A;  2C0O A;  3PLF B;  3PSJ A;  3WA4 A;  3MAZ A;  5CDW A;  1HCT B;  5D0J A;  3HHM B;  3BKB A;  3BUO B;  2LNX A;  3VS4 A;  2CIA A;  1AB2 A;  1B47 A;  2SHP A;  5HKZ A;  1O41 A;  3VRP A;  1IS0 A;  1YVH A;  3VRQ A;  1QCF A;  2CBL A;  2HCK A;  5EHR A;  3NHN A;  3T04 A;  1PIC A;  2HUW A;  4GL9 E;  1BG1 A;  4NWF A;  2MC1 A;  2CI8 A;  1O4B A;  2IUH A;  2FO0 A;  1O4Q A;  1M27 A;  4OHD A;  2PNB A;  2DM0 A;  2CR4 A;  5J3X A;  1O4C A;  1BM2 A;  1O47 A;  1JU5 A;  1D4T A;  4WWQ A;  1AYB A;  3CXL A;  5AXI A;  2BBU A;  4FBN A;  1RPY A;  4M4Z A;  1R1S A;  1CSY A;  1O4E A;  1O4N A;  5EG3 B;  2Y1N A;  2SRC A;  3IN8 A;  3S8N A;  3US4 A;  1IJR A;  2AUG A;  5EEL A;  5KAZ A;  3CBL A;  4EY0 A;  2EYY A;  2Y3A B;  4K2R A;  1FMK A;  2YSX A;  1O4H A;  4E93 A;  4ROJ A;  2LQW A;  4GWF A;  5EEQ A;  1O4M A;  1A08 A;  1WQU A;  4U1P A;  1KA6 A;  1FU6 A;  2DVJ A;  2AOB A;  1R1Q A;  2MK2 A;  3CWG A;  2L4K A;  3UF4 A;  1HCS B;  1FYR A;  2HDX A;  3BUW B;  1MIL A;  3GQI B;  4U17 A;  4XZ1 A;  1UUS A;  4H34 A;  1SHD A;  1XA6 A;  2HMH A;  3HIZ B;  5HKY A;  3OVE A;  1F2F A;  1X27 A;  1YVL A;  3MXY A;  1BKM A;  1SHA A;  4OHL A;  1BFI A;  1AYD A;  5DF6 A;  4OHI A;  1SKJ A;  1UUR A;  3OB1 B;  2KNO A;  4OHE A;  1O42 A;  2H5K A;  1JYR A;  3IMD A;  3S8O A;  1NZV A;  3N7Y A;  1OO4 A;  1KC2 A;  2GSB A;  2MRJ A;  1LUN A;  2ABL A;  1O46 A;  4QSY A;  1LUM A;  1O43 A;  2LCT A;  3PQZ A;  5BO4 A;  1D4W A;  2FCI A;  4LUE A;  1O48 A;  3QWY A;  1AOU F;  1R1P A;  1O49 A;  1X6C A;  1OO3 A;  4E68 A;  3S8L A;  1TZE E;  1LCJ A;  3VRO A;  3K2M A;  2CRH A;  1Z3K A;  1NZL A;  5IBM A;  3GXW A;  4NWG A;  1O4R A;  2ROR A;  1O4O A;  1SPS A;  2PLE A;  3VS7 A;  2CS0 A;  1O4G A;  3IMJ A;  3PFV A;  2MQI A;  4P9Z A;  4F59 A;  3VGO A;  2EYZ A;  4LUD A;  5GJH A;  1O4D A;  2PTK A;  2DX0 A;  1GRI A;  1RQQ C;  3OB2 B;  3QWX X;  1D1Z A;  1KSW A;  1I3Z A;  1Y57 A;  3VRY A;  1LUI A;  1P13 A;  3VS3 A;  2DCR A;  4JE4 A;  3PS5 A;  1A07 A;  3TKZ A;  2IUG A;  4A4B A;  2H8H A;  3M7F A;  4K11 A;  4JEG A;  4H1O A;  2XP1 A;  4K44 A;  5HKW A;  2C9W A;  2EKX A;  4TZI A;  4FL2 A;  2RMX A;  1QAD A;  3S9K A;  1LUK A;  2MRK A;  2OZO A;  3VRN A;  2KK6 A;  4GPL B;  2PLD A;  1BKL A;  4XZ0 A;  2Y1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...