2EU0A

The nmr ensemble structure of the itk sh2 domain bound to a phosphopeptide
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
108
structure length
108
Chain Sequence
b'NNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKAIISENPCIKHYHIKETNDSPKRYYVAEKYVFDSIPLLIQYHQYNGGGLVTRLRYPVCG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Molecular Details of Itk Activation by Prolyl Isomerization and Phospholigand Binding: The NMR Structure of the Itk SH2 Domain Bound to a Phosphopeptide.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 17
structure length 108
sequence length 108
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2eu0A00
1R1QA 4H1OA 1BG1A 3K2MA 3VRPA 1AD5A 1GHUA 1R1PA 1JYRA 2LQNA 2B3OA 3VRYA 4NWGA 1RQQC 4NWFA 5AXIA 1O4QA 3N84A 1BKLA 1FU5A 3ZNIA 3TL0A 2C9WA 3UYOA 1O4KA 1KSWA 4TZIA 1LUNA 1BMBA 1KC2A 2HCKA 3CXLA 5KAZA 2PNAA 1LKLA 3VRRA 1MILA 1O47A 2CS0A 4GWFA 2H8HA 3IN7A 1BM2A 4K2RA 3VS7A 1O46A 4EY0A 3PQZA 1P13A 1SHDA 1SPSA 4OHHA 1SHBA 5EG3B 1SKJA 1FU6A 5GJIA 1AOUF 1O4OA 2L4KA 4GPLB 1R1SA 1M61A 2HDXA 5J3XA 3VGOA 3N8MA 1Y57A 2MK2A 1O4FA 1NZVA 1LCKA 1F2FA 1A1BA 1O44A 3BKBA 5IBSA 1H9OA 2CBLA 3BUMB 2EKXA 4F59A 3PLFB 3VS4A 1KA7A 2RVFA 2CR4A 5GJHA 1UURA 1K9AA 4OHIA 1BHHA 3BUNB 3VS5A 1SHAA 3VS1A 5DC0B 2MQIA 1QCFA 3M7FA 4P9VA 1HCSB 1O4CA 4F5AA 3S8LA 1O4MA 4JE4A 1X6CA 2LCTA 1JYQA 1AYAA 4LUEA 3VRNA 5EHPA 3S8OA 1BLKA 1O4DA 3WA4A 1BKMA 4A4BA 2IUHA 2EYYA 3VRQA 2XP1A 4H34A 3S9KA 2GE9A 4FL2A 3S8NA 1AYCA 1FMKA 5I6VA 3US4A 3BUOB 5HKWA 2FCIA 1OPKA 5DF6A 4K45A 3IMJA 2CRHA 4ROJA 1O4EA 4GL9E 4A4CA 1SPRA 4DGXA 3CWGA 4WWQA 1D4WA 1LKKA 2QMSA 1BHHB 2BBUA 2LNXA 1O4JA 1GRIA 2PLDA 2EO6A 4L1BB 1WQUA 1JU5A 4FL3A 3VS2A 3OV1A 1A1CA 3VRZA 3PS5A 3CD3A 5EHRA 2VIFA 1D1ZA 3EACA 3PFVA 4XZ1A 3TKZA 1JYUA 3T04A 4OHLA 1Y1UA 3HIZB 1OO4A 2KK6A 1NRVA 2EOBA 1O45A 2DX0A 1O4LA 3VS6A 1UUSA 1G83A 1QADA 2LQWA 1O4HA 2AOBA 2IZVA 4LUDA 2H5KA 2ETZA 1O4IA 1BLJA 1IS0A 1YVLA 3MAZA 1LUIA 1XA6A 2ECDA 1AYDA 1NZLA 2FO0A 1I3ZA 1CSZA 2C0OA 3VS3A 2DVJA 1A1AA 1QG1E 5BO4A 1O4GA 4K11A 1FBVA 1FBZA 2L6KA 2DLZA 2CI8A 2MC1A 3GQIB 3GXXA 3EAZA 2SRCA 1IJRA 1O43A 1O4AA 2H46E 1PICA 2OQ1A 2RMXA 1A08A 3KFJA 2LNWA 5EELA 3NHNA 2L3TA 4P9ZA 1LCJA 2HDVA 2Y3AB 1X27A 2MRKA 3OVEA 4U1PA 2CI9A 3N7YA 5D0JA 2CIAA 3OB1B 1OO3A 2RORA 3IMDA 1CJ1A 2MRJA 3OB2B 1F1WA 1O49A 2EU0A 4JEGA 5HKZA 2EL8A 3UF4A 2Y1MA 3BUXB 3IN8A 5IBMA 1X0NA 4EIHA 1CWDL 1LUKA 1KA6A 1O4BA 2OZOA 2IUIA 5CDWA 1YVHA 4K44A 1M27A 2HUWA 3PJPA 4OHDA 1MW4A 3HHMB 1HCTB 5DC4A 2Y1NA 1O48A 1RPYA 5DC9A 5HKYA 3MXYA 1BHFA 1TZEE 2RSYA 1JWOA 3MXCA 2PTKA 2PNBA 1FYRA 1OPLA 2JYQA 4F5BA 2EO3A 1AOTF 5AULA 2YU7A 4QSYA 4XZ0A 1ZFPE 1RJAA 3BUWB 2PLEA 2ABLA 2KNOA 2C0IA 2K79B 2AOAA 3VS0A 4E68A 1B47A 4FBNA 4M4ZA 2DLYA 1A1EA 2EYVA 3PSJA 4E93A 3PSKA 1AB2A 1A09A 4JGHA 2EYZA 2DM0A 1AYBA 1CWEA 2C0TA 2IUGA 2YSXA 3CBLA 1BF5A 2DCRA 1O4PA 1O41A 2K7AB 3QWXX 1TCEA 3QWYA 2GSBA 1A07A 1O42A 1CSYA 3HCKA 3C7IA 1FHSA 4U17A 2AUGA 1O4RA 4D8KA 5EEQA 4X6SA 2HMHA 1A81A 1D4TA 4DGPA 1O4NA 2SHPA 4OHEA 3GXWA 1Z3KA 1LUMA 1BFJA 3OP0A 1BFIA 3VROA
chains in the Genus database with same CATH superfamily
1R1QA 4H1OA 1BG1A 3K2MA 3VRPA 1AD5A 1GHUA 1R1PA 1JYRA 2LQNA 2B3OA 3VRYA 4NWGA 1RQQC 4NWFA 5AXIA 1O4QA 3N84A 1BKLA 1FU5A 3ZNIA 3TL0A 3LYVA 2C9WA 3UYOA 1O4KA 1KSWA 4TZIA 1LUNA 1BMBA 1KC2A 2HCKA 3CXLA 5KAZA 2PNAA 1LKLA 3VRRA 1MILA 1O47A 2CS0A 4GWFA 2H8HA 3IN7A 1BM2A 4K2RA 3VS7A 1O46A 4EY0A 3PQZA 1P13A 1SHDA 1SPSA 4OHHA 1SHBA 5EG3B 1SKJA 1FU6A 5GJIA 1AOUF 1O4OA 2L4KA 4GPLB 1R1SA 1M61A 2HDXA 5J3XA 3VGOA 3N8MA 1Y57A 2MK2A 1O4FA 1NZVA 1LCKA 1F2FA 1A1BA 1O44A 3BKBA 5IBSA 1H9OA 2CBLA 3BUMB 2EKXA 4F59A 3PLFB 2KGYA 3VS4A 1KA7A 2RVFA 2CR4A 5GJHA 1UURA 1K9AA 4OHIA 1BHHA 3BUNB 3VS5A 1SHAA 3VS1A 5DC0B 2MQIA 1QCFA 3M7FA 4P9VA 1HCSB 1O4CA 4F5AA 3S8LA 1O4MA 4JE4A 1X6CA 2LCTA 1JYQA 1AYAA 4LUEA 3VRNA 5EHPA 3S8OA 1BLKA 1O4DA 3WA4A 1BKMA 4A4BA 2IUHA 2EYYA 3VRQA 2XP1A 4H34A 3S9KA 2GE9A 4FL2A 3S8NA 1AYCA 1FMKA 5I6VA 3US4A 3BUOB 5HKWA 2FCIA 1OPKA 5DF6A 4K45A 3IMJA 2CRHA 4ROJA 2LRAA 1O4EA 4GL9E 4A4CA 1SPRA 4DGXA 3CWGA 4WWQA 1D4WA 1LKKA 2QMSA 1BHHB 2BBUA 2LNXA 1O4JA 1GRIA 2PLDA 2EO6A 4L1BB 1WQUA 1JU5A 4FL3A 3VS2A 3OV1A 1A1CA 3VRZA 3PS5A 3CD3A 5EHRA 2VIFA 1D1ZA 3EACA 3PFVA 4XZ1A 3TKZA 1JYUA 3T04A 4OHLA 1Y1UA 3HIZB 1OO4A 2KK6A 1NRVA 2EOBA 1O45A 2DX0A 1O4LA 3VS6A 1UUSA 1G83A 1QADA 2LQWA 1O4HA 2AOBA 2IZVA 4LUDA 2H5KA 2ETZA 1O4IA 1BLJA 1IS0A 1YVLA 3MAZA 1LUIA 1XA6A 2ECDA 1AYDA 1NZLA 2FO0A 1I3ZA 1CSZA 2C0OA 3VS3A 2DVJA 1A1AA 1QG1E 5BO4A 1O4GA 4K11A 1FBVA 1FBZA 2L6KA 2DLZA 2CI8A 2MC1A 3GQIB 3GXXA 3EAZA 2SRCA 1IJRA 1O43A 1O4AA 2H46E 1PICA 2OQ1A 2RMXA 1A08A 3KFJA 2LNWA 5EELA 3NHNA 2L3TA 4P9ZA 1LCJA 2HDVA 2Y3AB 1X27A 2MRKA 3OVEA 4U1PA 2CI9A 3N7YA 5D0JA 2CIAA 3OB1B 1OO3A 2RORA 3IMDA 1CJ1A 2MRJA 3OB2B 1F1WA 1O49A 2EU0A 4JEGA 5HKZA 2EL8A 3K2TA 3UF4A 2Y1MA 3BUXB 3IN8A 5IBMA 1X0NA 4EIHA 1CWDL 1LUKA 1KA6A 1O4BA 2OZOA 2IUIA 5CDWA 1YVHA 4K44A 1M27A 2HUWA 3PJPA 4OHDA 1MW4A 3HHMB 1HCTB 5DC4A 2Y1NA 1O48A 1RPYA 5DC9A 5HKYA 3MXYA 1BHFA 1TZEE 2RSYA 1JWOA 3MXCA 2PTKA 2PNBA 1FYRA 1OPLA 2JYQA 4F5BA 2EO3A 1AOTF 5AULA 2YU7A 4QSYA 4XZ0A 1ZFPE 1RJAA 3BUWB 2PLEA 2ABLA 2KNOA 2C0IA 2K79B 2AOAA 3VS0A 4E68A 1B47A 4FBNA 4M4ZA 2DLYA 1A1EA 2EYVA 3PSJA 4E93A 3PSKA 1AB2A 1A09A 4JGHA 2EYZA 2DM0A 1AYBA 1CWEA 2C0TA 2IUGA 2YSXA 3CBLA 1BF5A 2DCRA 1O4PA 1O41A 2K7AB 3QWXX 1TCEA 3QWYA 2GSBA 1A07A 1O42A 1CSYA 3HCKA 3C7IA 1FHSA 4U17A 2AUGA 1O4RA 4D8KA 5EEQA 4X6SA 2HMHA 1A81A 1D4TA 4DGPA 1O4NA 2SHPA 4OHEA 3GXWA 1Z3KA 1LUMA 1BFJA 3OP0A 1BFIA 3VROA
chains in the Genus database with same CATH topology
1R1QA 4H1OA 1BG1A 3K2MA 3VRPA 1AD5A 1GHUA 1R1PA 1JYRA 2LQNA 2B3OA 3VRYA 4NWGA 1RQQC 4NWFA 5AXIA 1O4QA 3N84A 1BKLA 1FU5A 3ZNIA 3TL0A 2C9WA 3UYOA 1O4KA 1KSWA 4TZIA 1LUNA 1BMBA 1KC2A 2HCKA 3CXLA 5KAZA 2PNAA 1LKLA 3VRRA 1MILA 1O47A 2CS0A 4GWFA 2H8HA 3IN7A 1BM2A 4K2RA 3VS7A 1O46A 4EY0A 3PQZA 1P13A 1SHDA 1SPSA 4OHHA 1SHBA 5EG3B 1SKJA 1FU6A 5GJIA 1AOUF 1O4OA 2L4KA 4GPLB 1R1SA 1M61A 2HDXA 5J3XA 3VGOA 3N8MA 1Y57A 2MK2A 1O4FA 1NZVA 1LCKA 1F2FA 1A1BA 1O44A 3BKBA 5IBSA 1H9OA 2CBLA 3BUMB 2EKXA 4F59A 3PLFB 3VS4A 1KA7A 2RVFA 2CR4A 5GJHA 1UURA 1K9AA 4OHIA 1BHHA 3BUNB 3VS5A 1SHAA 3VS1A 5DC0B 2MQIA 1QCFA 3M7FA 4P9VA 1HCSB 1O4CA 4F5AA 3S8LA 1O4MA 4JE4A 1X6CA 2LCTA 1JYQA 1AYAA 4LUEA 3VRNA 5EHPA 3S8OA 1BLKA 1O4DA 3WA4A 1BKMA 4A4BA 2IUHA 2EYYA 3VRQA 2XP1A 4H34A 3S9KA 2GE9A 4FL2A 3S8NA 1AYCA 1FMKA 5I6VA 3US4A 3BUOB 5HKWA 2FCIA 1OPKA 5DF6A 4K45A 3IMJA 2CRHA 4ROJA 1O4EA 4GL9E 4A4CA 1SPRA 4DGXA 3CWGA 4WWQA 1D4WA 1LKKA 2QMSA 1BHHB 2BBUA 2LNXA 1O4JA 1GRIA 2PLDA 2EO6A 4L1BB 1WQUA 1JU5A 4FL3A 3VS2A 3OV1A 1A1CA 3VRZA 3PS5A 3CD3A 5EHRA 2VIFA 1D1ZA 3EACA 3PFVA 4XZ1A 3TKZA 1JYUA 3T04A 4OHLA 1Y1UA 3HIZB 1OO4A 2KK6A 1NRVA 2EOBA 1O45A 2DX0A 1O4LA 3VS6A 1UUSA 1G83A 1QADA 2LQWA 1O4HA 2AOBA 2IZVA 4LUDA 2H5KA 2ETZA 1O4IA 1BLJA 1IS0A 1YVLA 3MAZA 1LUIA 1XA6A 2ECDA 1AYDA 1NZLA 2FO0A 1I3ZA 1CSZA 2C0OA 3VS3A 2DVJA 1A1AA 1QG1E 5BO4A 1O4GA 4K11A 1FBVA 1FBZA 2L6KA 2DLZA 2CI8A 2MC1A 3GQIB 3GXXA 3EAZA 2SRCA 1IJRA 1O43A 1O4AA 2H46E 1PICA 2OQ1A 2RMXA 1A08A 3KFJA 2LNWA 5EELA 3NHNA 2L3TA 4P9ZA 1LCJA 2HDVA 2Y3AB 1X27A 2MRKA 3OVEA 4U1PA 2CI9A 3N7YA 5D0JA 2CIAA 3OB1B 1OO3A 2RORA 3IMDA 1CJ1A 2MRJA 3OB2B 1F1WA 1O49A 2EU0A 4JEGA 5HKZA 2EL8A 3UF4A 2Y1MA 3BUXB 3IN8A 5IBMA 1X0NA 4EIHA 1CWDL 1LUKA 1KA6A 1O4BA 2OZOA 2IUIA 5CDWA 1YVHA 4K44A 1M27A 2HUWA 3PJPA 4OHDA 1MW4A 3HHMB 1HCTB 5DC4A 2Y1NA 1O48A 1RPYA 5DC9A 5HKYA 3MXYA 1BHFA 1TZEE 2RSYA 1JWOA 3MXCA 2PTKA 2PNBA 1FYRA 1OPLA 2JYQA 4F5BA 2EO3A 1AOTF 5AULA 2YU7A 4QSYA 4XZ0A 1ZFPE 1RJAA 3BUWB 2PLEA 2ABLA 2KNOA 2C0IA 2K79B 2AOAA 3VS0A 4E68A 1B47A 4FBNA 4M4ZA 2DLYA 1A1EA 2EYVA 3PSJA 4E93A 3PSKA 1AB2A 1A09A 4JGHA 2EYZA 2DM0A 1AYBA 1CWEA 2C0TA 2IUGA 2YSXA 3CBLA 1BF5A 2DCRA 1O4PA 1O41A 2K7AB 3QWXX 1TCEA 3QWYA 2GSBA 1A07A 1O42A 1CSYA 3HCKA 3C7IA 1FHSA 4U17A 2AUGA 1O4RA 4D8KA 5EEQA 4X6SA 2HMHA 1A81A 1D4TA 4DGPA 1O4NA 2SHPA 4OHEA 3GXWA 1Z3KA 1LUMA 1BFJA 3OP0A 1BFIA 3VROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R1Q A;  4H1O A;  1BG1 A;  3K2M A;  3VRP A;  1AD5 A;  1GHU A;  1R1P A;  1JYR A;  2LQN A;  2B3O A;  3VRY A;  4NWG A;  1RQQ C;  4NWF A;  5AXI A;  1O4Q A;  3N84 A;  1BKL A;  1FU5 A;  3ZNI A;  3TL0 A;  2C9W A;  3UYO A;  1O4K A;  1KSW A;  4TZI A;  1LUN A;  1BMB A;  1KC2 A;  2HCK A;  3CXL A;  5KAZ A;  2PNA A;  1LKL A;  3VRR A;  1MIL A;  1O47 A;  2CS0 A;  4GWF A;  2H8H A;  3IN7 A;  1BM2 A;  4K2R A;  3VS7 A;  1O46 A;  4EY0 A;  3PQZ A;  1P13 A;  1SHD A;  1SPS A;  4OHH A;  1SHB A;  5EG3 B;  1SKJ A;  1FU6 A;  5GJI A;  1AOU F;  1O4O A;  2L4K A;  4GPL B;  1R1S A;  1M61 A;  2HDX A;  5J3X A;  3VGO A;  3N8M A;  1Y57 A;  2MK2 A;  1O4F A;  1NZV A;  1LCK A;  1F2F A;  1A1B A;  1O44 A;  3BKB A;  5IBS A;  1H9O A;  2CBL A;  3BUM B;  2EKX A;  4F59 A;  3PLF B;  3VS4 A;  1KA7 A;  2RVF A;  2CR4 A;  5GJH A;  1UUR A;  1K9A A;  4OHI A;  1BHH A;  3BUN B;  3VS5 A;  1SHA A;  3VS1 A;  5DC0 B;  2MQI A;  1QCF A;  3M7F A;  4P9V A;  1HCS B;  1O4C A;  4F5A A;  3S8L A;  1O4M A;  4JE4 A;  1X6C A;  2LCT A;  1JYQ A;  1AYA A;  4LUE A;  3VRN A;  5EHP A;  3S8O A;  1BLK A;  1O4D A;  3WA4 A;  1BKM A;  4A4B A;  2IUH A;  2EYY A;  3VRQ A;  2XP1 A;  4H34 A;  3S9K A;  2GE9 A;  4FL2 A;  3S8N A;  1AYC A;  1FMK A;  5I6V A;  3US4 A;  3BUO B;  5HKW A;  2FCI A;  1OPK A;  5DF6 A;  4K45 A;  3IMJ A;  2CRH A;  4ROJ A;  1O4E A;  4GL9 E;  4A4C A;  1SPR A;  4DGX A;  3CWG A;  4WWQ A;  1D4W A;  1LKK A;  2QMS A;  1BHH B;  2BBU A;  2LNX A;  1O4J A;  1GRI A;  2PLD A;  2EO6 A;  4L1B B;  1WQU A;  1JU5 A;  4FL3 A;  3VS2 A;  3OV1 A;  1A1C A;  3VRZ A;  3PS5 A;  3CD3 A;  5EHR A;  2VIF A;  1D1Z A;  3EAC A;  3PFV A;  4XZ1 A;  3TKZ A;  1JYU A;  3T04 A;  4OHL A;  1Y1U A;  3HIZ B;  1OO4 A;  2KK6 A;  1NRV A;  2EOB A;  1O45 A;  2DX0 A;  1O4L A;  3VS6 A;  1UUS A;  1G83 A;  1QAD A;  2LQW A;  1O4H A;  2AOB A;  2IZV A;  4LUD A;  2H5K A;  2ETZ A;  1O4I A;  1BLJ A;  1IS0 A;  1YVL A;  3MAZ A;  1LUI A;  1XA6 A;  2ECD A;  1AYD A;  1NZL A;  2FO0 A;  1I3Z A;  1CSZ A;  2C0O A;  3VS3 A;  2DVJ A;  1A1A A;  1QG1 E;  5BO4 A;  1O4G A;  4K11 A;  1FBV A;  1FBZ A;  2L6K A;  2DLZ A;  2CI8 A;  2MC1 A;  3GQI B;  3GXX A;  3EAZ A;  2SRC A;  1IJR A;  1O43 A;  1O4A A;  2H46 E;  1PIC A;  2OQ1 A;  2RMX A;  1A08 A;  3KFJ A;  2LNW A;  5EEL A;  3NHN A;  2L3T A;  4P9Z A;  1LCJ A;  2HDV A;  2Y3A B;  1X27 A;  2MRK A;  3OVE A;  4U1P A;  2CI9 A;  3N7Y A;  5D0J A;  2CIA A;  3OB1 B;  1OO3 A;  2ROR A;  3IMD A;  1CJ1 A;  2MRJ A;  3OB2 B;  1F1W A;  1O49 A;  2EU0 A;  4JEG A;  5HKZ A;  2EL8 A;  3UF4 A;  2Y1M A;  3BUX B;  3IN8 A;  5IBM A;  1X0N A;  4EIH A;  1CWD L;  1LUK A;  1KA6 A;  1O4B A;  2OZO A;  2IUI A;  5CDW A;  1YVH A;  4K44 A;  1M27 A;  2HUW A;  3PJP A;  4OHD A;  1MW4 A;  3HHM B;  1HCT B;  5DC4 A;  2Y1N A;  1O48 A;  1RPY A;  5DC9 A;  5HKY A;  3MXY A;  1BHF A;  1TZE E;  2RSY A;  1JWO A;  3MXC A;  2PTK A;  2PNB A;  1FYR A;  1OPL A;  2JYQ A;  4F5B A;  2EO3 A;  1AOT F;  5AUL A;  2YU7 A;  4QSY A;  4XZ0 A;  1ZFP E;  1RJA A;  3BUW B;  2PLE A;  2ABL A;  2KNO A;  2C0I A;  2K79 B;  2AOA A;  3VS0 A;  4E68 A;  1B47 A;  4FBN A;  4M4Z A;  2DLY A;  1A1E A;  2EYV A;  3PSJ A;  4E93 A;  3PSK A;  1AB2 A;  1A09 A;  4JGH A;  2EYZ A;  2DM0 A;  1AYB A;  1CWE A;  2C0T A;  2IUG A;  2YSX A;  3CBL A;  1BF5 A;  2DCR A;  1O4P A;  1O41 A;  2K7A B;  3QWX X;  1TCE A;  3QWY A;  2GSB A;  1A07 A;  1O42 A;  1CSY A;  3HCK A;  3C7I A;  1FHS A;  4U17 A;  2AUG A;  1O4R A;  4D8K A;  5EEQ A;  4X6S A;  2HMH A;  1A81 A;  1D4T A;  4DGP A;  1O4N A;  2SHP A;  4OHE A;  3GXW A;  1Z3K A;  1LUM A;  1BFJ A;  3OP0 A;  1BFI A;  3VRO A; 
#chains in the Genus database with same CATH topology
 1R1Q A;  4H1O A;  1BG1 A;  3K2M A;  3VRP A;  1AD5 A;  1GHU A;  1R1P A;  1JYR A;  2LQN A;  2B3O A;  3VRY A;  4NWG A;  1RQQ C;  4NWF A;  5AXI A;  1O4Q A;  3N84 A;  1BKL A;  1FU5 A;  3ZNI A;  3TL0 A;  3LYV A;  2C9W A;  3UYO A;  1O4K A;  1KSW A;  4TZI A;  1LUN A;  1BMB A;  1KC2 A;  2HCK A;  3CXL A;  5KAZ A;  2PNA A;  1LKL A;  3VRR A;  1MIL A;  1O47 A;  2CS0 A;  4GWF A;  2H8H A;  3IN7 A;  1BM2 A;  4K2R A;  3VS7 A;  1O46 A;  4EY0 A;  3PQZ A;  1P13 A;  1SHD A;  1SPS A;  4OHH A;  1SHB A;  5EG3 B;  1SKJ A;  1FU6 A;  5GJI A;  1AOU F;  1O4O A;  2L4K A;  4GPL B;  1R1S A;  1M61 A;  2HDX A;  5J3X A;  3VGO A;  3N8M A;  1Y57 A;  2MK2 A;  1O4F A;  1NZV A;  1LCK A;  1F2F A;  1A1B A;  1O44 A;  3BKB A;  5IBS A;  1H9O A;  2CBL A;  3BUM B;  2EKX A;  4F59 A;  3PLF B;  2KGY A;  3VS4 A;  1KA7 A;  2RVF A;  2CR4 A;  5GJH A;  1UUR A;  1K9A A;  4OHI A;  1BHH A;  3BUN B;  3VS5 A;  1SHA A;  3VS1 A;  5DC0 B;  2MQI A;  1QCF A;  3M7F A;  4P9V A;  1HCS B;  1O4C A;  4F5A A;  3S8L A;  1O4M A;  4JE4 A;  1X6C A;  2LCT A;  1JYQ A;  1AYA A;  4LUE A;  3VRN A;  5EHP A;  3S8O A;  1BLK A;  1O4D A;  3WA4 A;  1BKM A;  4A4B A;  2IUH A;  2EYY A;  3VRQ A;  2XP1 A;  4H34 A;  3S9K A;  2GE9 A;  4FL2 A;  3S8N A;  1AYC A;  1FMK A;  5I6V A;  3US4 A;  3BUO B;  5HKW A;  2FCI A;  1OPK A;  5DF6 A;  4K45 A;  3IMJ A;  2CRH A;  4ROJ A;  2LRA A;  1O4E A;  4GL9 E;  4A4C A;  1SPR A;  4DGX A;  3CWG A;  4WWQ A;  1D4W A;  1LKK A;  2QMS A;  1BHH B;  2BBU A;  2LNX A;  1O4J A;  1GRI A;  2PLD A;  2EO6 A;  4L1B B;  1WQU A;  1JU5 A;  4FL3 A;  3VS2 A;  3OV1 A;  1A1C A;  3VRZ A;  3PS5 A;  3CD3 A;  5EHR A;  2VIF A;  1D1Z A;  3EAC A;  3PFV A;  4XZ1 A;  3TKZ A;  1JYU A;  3T04 A;  4OHL A;  1Y1U A;  3HIZ B;  1OO4 A;  2KK6 A;  1NRV A;  2EOB A;  1O45 A;  2DX0 A;  1O4L A;  3VS6 A;  1UUS A;  1G83 A;  1QAD A;  2LQW A;  1O4H A;  2AOB A;  2IZV A;  4LUD A;  2H5K A;  2ETZ A;  1O4I A;  1BLJ A;  1IS0 A;  1YVL A;  3MAZ A;  1LUI A;  1XA6 A;  2ECD A;  1AYD A;  1NZL A;  2FO0 A;  1I3Z A;  1CSZ A;  2C0O A;  3VS3 A;  2DVJ A;  1A1A A;  1QG1 E;  5BO4 A;  1O4G A;  4K11 A;  1FBV A;  1FBZ A;  2L6K A;  2DLZ A;  2CI8 A;  2MC1 A;  3GQI B;  3GXX A;  3EAZ A;  2SRC A;  1IJR A;  1O43 A;  1O4A A;  2H46 E;  1PIC A;  2OQ1 A;  2RMX A;  1A08 A;  3KFJ A;  2LNW A;  5EEL A;  3NHN A;  2L3T A;  4P9Z A;  1LCJ A;  2HDV A;  2Y3A B;  1X27 A;  2MRK A;  3OVE A;  4U1P A;  2CI9 A;  3N7Y A;  5D0J A;  2CIA A;  3OB1 B;  1OO3 A;  2ROR A;  3IMD A;  1CJ1 A;  2MRJ A;  3OB2 B;  1F1W A;  1O49 A;  2EU0 A;  4JEG A;  5HKZ A;  2EL8 A;  3K2T A;  3UF4 A;  2Y1M A;  3BUX B;  3IN8 A;  5IBM A;  1X0N A;  4EIH A;  1CWD L;  1LUK A;  1KA6 A;  1O4B A;  2OZO A;  2IUI A;  5CDW A;  1YVH A;  4K44 A;  1M27 A;  2HUW A;  3PJP A;  4OHD A;  1MW4 A;  3HHM B;  1HCT B;  5DC4 A;  2Y1N A;  1O48 A;  1RPY A;  5DC9 A;  5HKY A;  3MXY A;  1BHF A;  1TZE E;  2RSY A;  1JWO A;  3MXC A;  2PTK A;  2PNB A;  1FYR A;  1OPL A;  2JYQ A;  4F5B A;  2EO3 A;  1AOT F;  5AUL A;  2YU7 A;  4QSY A;  4XZ0 A;  1ZFP E;  1RJA A;  3BUW B;  2PLE A;  2ABL A;  2KNO A;  2C0I A;  2K79 B;  2AOA A;  3VS0 A;  4E68 A;  1B47 A;  4FBN A;  4M4Z A;  2DLY A;  1A1E A;  2EYV A;  3PSJ A;  4E93 A;  3PSK A;  1AB2 A;  1A09 A;  4JGH A;  2EYZ A;  2DM0 A;  1AYB A;  1CWE A;  2C0T A;  2IUG A;  2YSX A;  3CBL A;  1BF5 A;  2DCR A;  1O4P A;  1O41 A;  2K7A B;  3QWX X;  1TCE A;  3QWY A;  2GSB A;  1A07 A;  1O42 A;  1CSY A;  3HCK A;  3C7I A;  1FHS A;  4U17 A;  2AUG A;  1O4R A;  4D8K A;  5EEQ A;  4X6S A;  2HMH A;  1A81 A;  1D4T A;  4DGP A;  1O4N A;  2SHP A;  4OHE A;  3GXW A;  1Z3K A;  1LUM A;  1BFJ A;  3OP0 A;  1BFI A;  3VRO A; 
#chains in the Genus database with same CATH homology
 1R1Q A;  4H1O A;  1BG1 A;  3K2M A;  3VRP A;  1AD5 A;  1GHU A;  1R1P A;  1JYR A;  2LQN A;  2B3O A;  3VRY A;  4NWG A;  1RQQ C;  4NWF A;  5AXI A;  1O4Q A;  3N84 A;  1BKL A;  1FU5 A;  3ZNI A;  3TL0 A;  2C9W A;  3UYO A;  1O4K A;  1KSW A;  4TZI A;  1LUN A;  1BMB A;  1KC2 A;  2HCK A;  3CXL A;  5KAZ A;  2PNA A;  1LKL A;  3VRR A;  1MIL A;  1O47 A;  2CS0 A;  4GWF A;  2H8H A;  3IN7 A;  1BM2 A;  4K2R A;  3VS7 A;  1O46 A;  4EY0 A;  3PQZ A;  1P13 A;  1SHD A;  1SPS A;  4OHH A;  1SHB A;  5EG3 B;  1SKJ A;  1FU6 A;  5GJI A;  1AOU F;  1O4O A;  2L4K A;  4GPL B;  1R1S A;  1M61 A;  2HDX A;  5J3X A;  3VGO A;  3N8M A;  1Y57 A;  2MK2 A;  1O4F A;  1NZV A;  1LCK A;  1F2F A;  1A1B A;  1O44 A;  3BKB A;  5IBS A;  1H9O A;  2CBL A;  3BUM B;  2EKX A;  4F59 A;  3PLF B;  3VS4 A;  1KA7 A;  2RVF A;  2CR4 A;  5GJH A;  1UUR A;  1K9A A;  4OHI A;  1BHH A;  3BUN B;  3VS5 A;  1SHA A;  3VS1 A;  5DC0 B;  2MQI A;  1QCF A;  3M7F A;  4P9V A;  1HCS B;  1O4C A;  4F5A A;  3S8L A;  1O4M A;  4JE4 A;  1X6C A;  2LCT A;  1JYQ A;  1AYA A;  4LUE A;  3VRN A;  5EHP A;  3S8O A;  1BLK A;  1O4D A;  3WA4 A;  1BKM A;  4A4B A;  2IUH A;  2EYY A;  3VRQ A;  2XP1 A;  4H34 A;  3S9K A;  2GE9 A;  4FL2 A;  3S8N A;  1AYC A;  1FMK A;  5I6V A;  3US4 A;  3BUO B;  5HKW A;  2FCI A;  1OPK A;  5DF6 A;  4K45 A;  3IMJ A;  2CRH A;  4ROJ A;  1O4E A;  4GL9 E;  4A4C A;  1SPR A;  4DGX A;  3CWG A;  4WWQ A;  1D4W A;  1LKK A;  2QMS A;  1BHH B;  2BBU A;  2LNX A;  1O4J A;  1GRI A;  2PLD A;  2EO6 A;  4L1B B;  1WQU A;  1JU5 A;  4FL3 A;  3VS2 A;  3OV1 A;  1A1C A;  3VRZ A;  3PS5 A;  3CD3 A;  5EHR A;  2VIF A;  1D1Z A;  3EAC A;  3PFV A;  4XZ1 A;  3TKZ A;  1JYU A;  3T04 A;  4OHL A;  1Y1U A;  3HIZ B;  1OO4 A;  2KK6 A;  1NRV A;  2EOB A;  1O45 A;  2DX0 A;  1O4L A;  3VS6 A;  1UUS A;  1G83 A;  1QAD A;  2LQW A;  1O4H A;  2AOB A;  2IZV A;  4LUD A;  2H5K A;  2ETZ A;  1O4I A;  1BLJ A;  1IS0 A;  1YVL A;  3MAZ A;  1LUI A;  1XA6 A;  2ECD A;  1AYD A;  1NZL A;  2FO0 A;  1I3Z A;  1CSZ A;  2C0O A;  3VS3 A;  2DVJ A;  1A1A A;  1QG1 E;  5BO4 A;  1O4G A;  4K11 A;  1FBV A;  1FBZ A;  2L6K A;  2DLZ A;  2CI8 A;  2MC1 A;  3GQI B;  3GXX A;  3EAZ A;  2SRC A;  1IJR A;  1O43 A;  1O4A A;  2H46 E;  1PIC A;  2OQ1 A;  2RMX A;  1A08 A;  3KFJ A;  2LNW A;  5EEL A;  3NHN A;  2L3T A;  4P9Z A;  1LCJ A;  2HDV A;  2Y3A B;  1X27 A;  2MRK A;  3OVE A;  4U1P A;  2CI9 A;  3N7Y A;  5D0J A;  2CIA A;  3OB1 B;  1OO3 A;  2ROR A;  3IMD A;  1CJ1 A;  2MRJ A;  3OB2 B;  1F1W A;  1O49 A;  2EU0 A;  4JEG A;  5HKZ A;  2EL8 A;  3UF4 A;  2Y1M A;  3BUX B;  3IN8 A;  5IBM A;  1X0N A;  4EIH A;  1CWD L;  1LUK A;  1KA6 A;  1O4B A;  2OZO A;  2IUI A;  5CDW A;  1YVH A;  4K44 A;  1M27 A;  2HUW A;  3PJP A;  4OHD A;  1MW4 A;  3HHM B;  1HCT B;  5DC4 A;  2Y1N A;  1O48 A;  1RPY A;  5DC9 A;  5HKY A;  3MXY A;  1BHF A;  1TZE E;  2RSY A;  1JWO A;  3MXC A;  2PTK A;  2PNB A;  1FYR A;  1OPL A;  2JYQ A;  4F5B A;  2EO3 A;  1AOT F;  5AUL A;  2YU7 A;  4QSY A;  4XZ0 A;  1ZFP E;  1RJA A;  3BUW B;  2PLE A;  2ABL A;  2KNO A;  2C0I A;  2K79 B;  2AOA A;  3VS0 A;  4E68 A;  1B47 A;  4FBN A;  4M4Z A;  2DLY A;  1A1E A;  2EYV A;  3PSJ A;  4E93 A;  3PSK A;  1AB2 A;  1A09 A;  4JGH A;  2EYZ A;  2DM0 A;  1AYB A;  1CWE A;  2C0T A;  2IUG A;  2YSX A;  3CBL A;  1BF5 A;  2DCR A;  1O4P A;  1O41 A;  2K7A B;  3QWX X;  1TCE A;  3QWY A;  2GSB A;  1A07 A;  1O42 A;  1CSY A;  3HCK A;  3C7I A;  1FHS A;  4U17 A;  2AUG A;  1O4R A;  4D8K A;  5EEQ A;  4X6S A;  2HMH A;  1A81 A;  1D4T A;  4DGP A;  1O4N A;  2SHP A;  4OHE A;  3GXW A;  1Z3K A;  1LUM A;  1BFJ A;  3OP0 A;  1BFI A;  3VRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...