3PSKA

Crystal structure of the spt6 tandem sh2 domain from saccharomyces cerevisiae, form native spt6 (1247-1451)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
199
structure length
199
Chain Sequence
b'IDPFTAKRTHRVINHPYYFPFNGRQAEDYLRSKERGEFVIRQSSRGDDHLVITWKLDKDLFQHIDIQELEKENPLALGKVLIVDNQKYNDLDQIIVEYLQNKVRLLNEMTSSEKFKSGTKKDVVKFIEDYSRVNPNKSVYYFSLNHDNPGWFYLMFKINANSKLYTWNVKLTNTGYFLVNYNYPSVIQLCNGFKTLLKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription elongation factor SPT6
publication title Crystal structures of the S. cerevisiae Spt6 core and C-terminal tandem SH2 domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 57
structure length 199
sequence length 199
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3pskA01
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3pskA02
1KSWA 5KAZA 1YVHA 4K45A 4E68A 1O4RA 2HUWA 1O4IA 5EHPA 2BBUA 1LKKA 1BLJA 3PSJA 1LCJA 1QG1E 1JYQA 2CI9A 2LQNA 1O4AA 3CD3A 2LQWA 2CS0A 1MW4A 1D4TA 4GL9E 1BHFA 2DLZA 1NRVA 3CWGA 3GQIB 2AOAA 3HIZB 2DCRA 3IMJA 4OHEA 1O4MA 1CSZA 1O43A 4K11A 1O4CA 2PNBA 3EAZA 4M4ZA 4FBNA 2EYZA 1O47A 1KA6A 1LKLA 3PSKA 1G83A 4DGPA 5CDWA 4TZIA 3EACA 2L3TA 3IN8A 4LUDA 1M61A 3VGOA 3S8OA 1OO4A 4OHIA 1O4LA 1JU5A 1I3ZA 2SHPA 3S8LA 4JE4A 1BFIA 1F1WA 1Y1UA 2C0IA 1FU6A 3OB1B 1O4PA 4F5AA 1O4HA 1MILA 2LCTA 5AXIA 4JEGA 3VS3A 4EY0A 2FCIA 1QADA 2RVFA 1ZFPE 2H5KA 5DC0B 3KFJA 3BKBA 1CWDL 5GJIA 3S8NA 1SHDA 2K79B 5EHRA 1O41A 3K2MA 4E93A 5BO4A 1A1EA 1PICA 1RJAA 1O48A 2ABLA 2VIFA 4XZ1A 4A4CA 1AB2A 1AD5A 2GSBA 1FBVA 2CR4A 1BG1A 1CWEA 4F5BA 2JYQA 3UF4A 3HHMB 2B3OA 1QCFA 1A1BA 2PLEA 4H34A 1O4JA 2HDVA 1LUMA 2HCKA 4F59A 1NZVA 3OV1A 1CSYA 3VRQA 3MAZA 1O4OA 5DF6A 2H8HA 2RORA 2Y1MA 1FMKA 1JYUA 3BUWB 1BLKA 1A81A 2YSXA 1SHBA 3VS6A 3VS7A 4K44A 3T04A 1M27A 1AOUF 1O4KA 3CXLA 3TKZA 1LUKA 1KA7A 1RQQC 3VRZA 1HCTB 2RSYA 5D0JA 3NHNA 3M7FA 2MC1A 1BM2A 1FBZA 1Y57A 1GRIA 4K2RA 4XZ0A 2PLDA 2KNOA 1OO3A 4LUEA 1FYRA 1SHAA 2EL8A 2OQ1A 2CI8A 1D4WA 3HCKA 3TL0A 3BUXB 1F2FA 1AYCA 5AULA 4WWQA 2FO0A 3WA4A 1O46A 2PTKA 5DC9A 4JGHA 1BHHB 2IUIA 3MXYA 2XP1A 3VS0A 5DC4A 1KC2A 1SPSA 2EU0A 1UUSA 4DGXA 2MRJA 1IS0A 2L6KA 3IMDA 2ETZA 1BMBA 3PS5A 1FHSA 1R1QA 4FL3A 5GJHA 1A07A 4U17A 2AOBA 5IBMA 3VRYA 1BKMA 1XA6A 2AUGA 4H1OA 1JWOA 1A08A 4QSYA 3VRRA 4NWGA 5HKZA 2CIAA 2SRCA 4EIHA 2GE9A 2H46E 2QMSA 1BFJA 1O4DA 5EG3B 1P13A 1SPRA 1IJRA 1O45A 2ECDA 1BF5A 5EEQA 3VRNA 2IZVA 2YU7A 1R1PA 2RMXA 2EO3A 1SKJA 2C0OA 1BKLA 2EKXA 5IBSA 2EYYA 2HMHA 4FL2A 1O49A 1O4GA 3PFVA 2EOBA 4P9ZA 2PNAA 2C9WA 2DX0A 4ROJA 4NWFA 1BHHA 3BUNB 1B47A 3OP0A 3US4A 2DM0A 2MRKA 1JYRA 2IUGA 2DVJA 4OHHA 2HDXA 1O4FA 3GXWA 2EYVA 1LUIA 3PQZA 3QWXX 5J3XA 2CRHA 1WQUA 3N8MA 1UURA 2C0TA 1AYDA 1HCSB 3VS1A 4X6SA 2DLYA 2IUHA 1Z3KA 1X27A 1NZLA 1K9AA 3OVEA 3QWYA 1TCEA 3IN7A 3VS4A 1A1AA 4L1BB 1X0NA 1O44A 4P9VA 5EELA 2L4KA 1D1ZA 1R1SA 1A09A 1A1CA 2LNXA 1AOTF 3GXXA 3N84A 1YVLA 4GWFA 3C7IA 1LUNA 1TZEE 3PJPA 3MXCA 3VS2A 1LCKA 4A4BA 3S9KA 2LNWA 1FU5A 5HKYA 3VROA 2MQIA 2OZOA 1O4NA 3BUMB 1O4BA 2CBLA 5HKWA 2EO6A 5I6VA 3ZNIA 1H9OA 1RPYA 4U1PA 1AYAA 2KK6A 1O4EA 1GHUA 2K7AB 3VRPA 3BUOB 4OHLA 3CBLA 1CJ1A 3OB2B 3VS5A 2Y3AB 1OPKA 1OPLA 1O4QA 2MK2A 1O42A 2Y1NA 1AYBA 4D8KA 4OHDA 4GPLB 3N7YA 1X6CA 3UYOA 3PLFB
chains in the Genus database with same CATH superfamily
1KSWA 5KAZA 1YVHA 4K45A 4E68A 1O4RA 2HUWA 1O4IA 5EHPA 2BBUA 1LKKA 1BLJA 3PSJA 1LCJA 1QG1E 1JYQA 2CI9A 2LQNA 1O4AA 3CD3A 2LQWA 2CS0A 1MW4A 1D4TA 4GL9E 1BHFA 2DLZA 1NRVA 3CWGA 3GQIB 2AOAA 3HIZB 2DCRA 3IMJA 4OHEA 1O4MA 1CSZA 1O43A 4K11A 1O4CA 2PNBA 3EAZA 4M4ZA 4FBNA 2EYZA 1O47A 1KA6A 1LKLA 3PSKA 1G83A 4DGPA 5CDWA 4TZIA 3EACA 2L3TA 3IN8A 4LUDA 1M61A 3VGOA 3S8OA 1OO4A 4OHIA 1O4LA 1JU5A 1I3ZA 2SHPA 3S8LA 4JE4A 1BFIA 1F1WA 1Y1UA 2C0IA 1FU6A 3OB1B 1O4PA 4F5AA 1O4HA 1MILA 2LCTA 5AXIA 4JEGA 3VS3A 4EY0A 2FCIA 1QADA 2RVFA 1ZFPE 2H5KA 5DC0B 3KFJA 3BKBA 1CWDL 5GJIA 3S8NA 1SHDA 2K79B 5EHRA 1O41A 3K2MA 4E93A 5BO4A 1A1EA 1PICA 1RJAA 1O48A 2ABLA 2KGYA 2VIFA 4XZ1A 4A4CA 1AB2A 1AD5A 2GSBA 1FBVA 2CR4A 1BG1A 1CWEA 4F5BA 2JYQA 3UF4A 3HHMB 2B3OA 1QCFA 1A1BA 2PLEA 4H34A 1O4JA 2HDVA 1LUMA 2HCKA 4F59A 1NZVA 3OV1A 1CSYA 3VRQA 3MAZA 1O4OA 5DF6A 2H8HA 3LYVA 2RORA 2Y1MA 1FMKA 1JYUA 3BUWB 1BLKA 1A81A 2YSXA 1SHBA 3VS6A 3VS7A 4K44A 3T04A 1M27A 1AOUF 1O4KA 3CXLA 3TKZA 1LUKA 1KA7A 1RQQC 3VRZA 1HCTB 2RSYA 5D0JA 3NHNA 3M7FA 2MC1A 1BM2A 1FBZA 1Y57A 1GRIA 4K2RA 4XZ0A 2PLDA 2KNOA 1OO3A 4LUEA 1FYRA 1SHAA 2EL8A 2OQ1A 2CI8A 1D4WA 3HCKA 3TL0A 3BUXB 1F2FA 1AYCA 5AULA 4WWQA 2FO0A 3WA4A 1O46A 2PTKA 5DC9A 4JGHA 1BHHB 2IUIA 3MXYA 2XP1A 3VS0A 5DC4A 1KC2A 1SPSA 2EU0A 1UUSA 4DGXA 2MRJA 1IS0A 2L6KA 3IMDA 2ETZA 1BMBA 3PS5A 1FHSA 1R1QA 4FL3A 5GJHA 1A07A 4U17A 2AOBA 5IBMA 3VRYA 1BKMA 1XA6A 2AUGA 4H1OA 1JWOA 1A08A 4QSYA 3VRRA 4NWGA 5HKZA 2CIAA 2SRCA 4EIHA 2GE9A 2H46E 2QMSA 1BFJA 1O4DA 5EG3B 1P13A 1SPRA 1IJRA 1O45A 2ECDA 1BF5A 5EEQA 3VRNA 2IZVA 2YU7A 1R1PA 2RMXA 2EO3A 1SKJA 2C0OA 1BKLA 2EKXA 5IBSA 2EYYA 2HMHA 4FL2A 1O49A 1O4GA 3PFVA 2EOBA 4P9ZA 2PNAA 2C9WA 2DX0A 4ROJA 4NWFA 1BHHA 3BUNB 1B47A 3OP0A 3US4A 2DM0A 2MRKA 1JYRA 2IUGA 2LRAA 2DVJA 4OHHA 2HDXA 1O4FA 3GXWA 2EYVA 1LUIA 3PQZA 3QWXX 5J3XA 2CRHA 1WQUA 3N8MA 1UURA 2C0TA 1AYDA 1HCSB 3VS1A 4X6SA 2DLYA 2IUHA 1Z3KA 1X27A 1NZLA 1K9AA 3OVEA 3QWYA 1TCEA 3K2TA 3IN7A 3VS4A 1A1AA 4L1BB 1X0NA 1O44A 4P9VA 5EELA 2L4KA 1D1ZA 1R1SA 1A09A 1A1CA 2LNXA 1AOTF 3GXXA 3N84A 1YVLA 4GWFA 3C7IA 1LUNA 1TZEE 3PJPA 3MXCA 3VS2A 1LCKA 4A4BA 3S9KA 2LNWA 1FU5A 5HKYA 3VROA 2MQIA 2OZOA 1O4NA 3BUMB 1O4BA 2CBLA 5HKWA 2EO6A 5I6VA 3ZNIA 1H9OA 1RPYA 4U1PA 1AYAA 2KK6A 1O4EA 1GHUA 2K7AB 3VRPA 3BUOB 4OHLA 3CBLA 1CJ1A 3OB2B 3VS5A 2Y3AB 1OPKA 1OPLA 1O4QA 2MK2A 1O42A 2Y1NA 1AYBA 4D8KA 4OHDA 4GPLB 3N7YA 1X6CA 3UYOA 3PLFB
chains in the Genus database with same CATH topology
1KSWA 5KAZA 1YVHA 4K45A 4E68A 1O4RA 2HUWA 1O4IA 5EHPA 2BBUA 1LKKA 1BLJA 3PSJA 1LCJA 1QG1E 1JYQA 2CI9A 2LQNA 1O4AA 3CD3A 2LQWA 2CS0A 1MW4A 1D4TA 4GL9E 1BHFA 2DLZA 1NRVA 3CWGA 3GQIB 2AOAA 3HIZB 2DCRA 3IMJA 4OHEA 1O4MA 1CSZA 1O43A 4K11A 1O4CA 2PNBA 3EAZA 4M4ZA 4FBNA 2EYZA 1O47A 1KA6A 1LKLA 3PSKA 1G83A 4DGPA 5CDWA 4TZIA 3EACA 2L3TA 3IN8A 4LUDA 1M61A 3VGOA 3S8OA 1OO4A 4OHIA 1O4LA 1JU5A 1I3ZA 2SHPA 3S8LA 4JE4A 1BFIA 1F1WA 1Y1UA 2C0IA 1FU6A 3OB1B 1O4PA 4F5AA 1O4HA 1MILA 2LCTA 5AXIA 4JEGA 3VS3A 4EY0A 2FCIA 1QADA 2RVFA 1ZFPE 2H5KA 5DC0B 3KFJA 3BKBA 1CWDL 5GJIA 3S8NA 1SHDA 2K79B 5EHRA 1O41A 3K2MA 4E93A 5BO4A 1A1EA 1PICA 1RJAA 1O48A 2ABLA 2VIFA 4XZ1A 4A4CA 1AB2A 1AD5A 2GSBA 1FBVA 2CR4A 1BG1A 1CWEA 4F5BA 2JYQA 3UF4A 3HHMB 2B3OA 1QCFA 1A1BA 2PLEA 4H34A 1O4JA 2HDVA 1LUMA 2HCKA 4F59A 1NZVA 3OV1A 1CSYA 3VRQA 3MAZA 1O4OA 5DF6A 2H8HA 2RORA 2Y1MA 1FMKA 1JYUA 3BUWB 1BLKA 1A81A 2YSXA 1SHBA 3VS6A 3VS7A 4K44A 3T04A 1M27A 1AOUF 1O4KA 3CXLA 3TKZA 1LUKA 1KA7A 1RQQC 3VRZA 1HCTB 2RSYA 5D0JA 3NHNA 3M7FA 2MC1A 1BM2A 1FBZA 1Y57A 1GRIA 4K2RA 4XZ0A 2PLDA 2KNOA 1OO3A 4LUEA 1FYRA 1SHAA 2EL8A 2OQ1A 2CI8A 1D4WA 3HCKA 3TL0A 3BUXB 1F2FA 1AYCA 5AULA 4WWQA 2FO0A 3WA4A 1O46A 2PTKA 5DC9A 4JGHA 1BHHB 2IUIA 3MXYA 2XP1A 3VS0A 5DC4A 1KC2A 1SPSA 2EU0A 1UUSA 4DGXA 2MRJA 1IS0A 2L6KA 3IMDA 2ETZA 1BMBA 3PS5A 1FHSA 1R1QA 4FL3A 5GJHA 1A07A 4U17A 2AOBA 5IBMA 3VRYA 1BKMA 1XA6A 2AUGA 4H1OA 1JWOA 1A08A 4QSYA 3VRRA 4NWGA 5HKZA 2CIAA 2SRCA 4EIHA 2GE9A 2H46E 2QMSA 1BFJA 1O4DA 5EG3B 1P13A 1SPRA 1IJRA 1O45A 2ECDA 1BF5A 5EEQA 3VRNA 2IZVA 2YU7A 1R1PA 2RMXA 2EO3A 1SKJA 2C0OA 1BKLA 2EKXA 5IBSA 2EYYA 2HMHA 4FL2A 1O49A 1O4GA 3PFVA 2EOBA 4P9ZA 2PNAA 2C9WA 2DX0A 4ROJA 4NWFA 1BHHA 3BUNB 1B47A 3OP0A 3US4A 2DM0A 2MRKA 1JYRA 2IUGA 2DVJA 4OHHA 2HDXA 1O4FA 3GXWA 2EYVA 1LUIA 3PQZA 3QWXX 5J3XA 2CRHA 1WQUA 3N8MA 1UURA 2C0TA 1AYDA 1HCSB 3VS1A 4X6SA 2DLYA 2IUHA 1Z3KA 1X27A 1NZLA 1K9AA 3OVEA 3QWYA 1TCEA 3IN7A 3VS4A 1A1AA 4L1BB 1X0NA 1O44A 4P9VA 5EELA 2L4KA 1D1ZA 1R1SA 1A09A 1A1CA 2LNXA 1AOTF 3GXXA 3N84A 1YVLA 4GWFA 3C7IA 1LUNA 1TZEE 3PJPA 3MXCA 3VS2A 1LCKA 4A4BA 3S9KA 2LNWA 1FU5A 5HKYA 3VROA 2MQIA 2OZOA 1O4NA 3BUMB 1O4BA 2CBLA 5HKWA 2EO6A 5I6VA 3ZNIA 1H9OA 1RPYA 4U1PA 1AYAA 2KK6A 1O4EA 1GHUA 2K7AB 3VRPA 3BUOB 4OHLA 3CBLA 1CJ1A 3OB2B 3VS5A 2Y3AB 1OPKA 1OPLA 1O4QA 2MK2A 1O42A 2Y1NA 1AYBA 4D8KA 4OHDA 4GPLB 3N7YA 1X6CA 3UYOA 3PLFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KSW A;  5KAZ A;  1YVH A;  4K45 A;  4E68 A;  1O4R A;  2HUW A;  1O4I A;  5EHP A;  2BBU A;  1LKK A;  1BLJ A;  3PSJ A;  1LCJ A;  1QG1 E;  1JYQ A;  2CI9 A;  2LQN A;  1O4A A;  3CD3 A;  2LQW A;  2CS0 A;  1MW4 A;  1D4T A;  4GL9 E;  1BHF A;  2DLZ A;  1NRV A;  3CWG A;  3GQI B;  2AOA A;  3HIZ B;  2DCR A;  3IMJ A;  4OHE A;  1O4M A;  1CSZ A;  1O43 A;  4K11 A;  1O4C A;  2PNB A;  3EAZ A;  4M4Z A;  4FBN A;  2EYZ A;  1O47 A;  1KA6 A;  1LKL A;  3PSK A;  1G83 A;  4DGP A;  5CDW A;  4TZI A;  3EAC A;  2L3T A;  3IN8 A;  4LUD A;  1M61 A;  3VGO A;  3S8O A;  1OO4 A;  4OHI A;  1O4L A;  1JU5 A;  1I3Z A;  2SHP A;  3S8L A;  4JE4 A;  1BFI A;  1F1W A;  1Y1U A;  2C0I A;  1FU6 A;  3OB1 B;  1O4P A;  4F5A A;  1O4H A;  1MIL A;  2LCT A;  5AXI A;  4JEG A;  3VS3 A;  4EY0 A;  2FCI A;  1QAD A;  2RVF A;  1ZFP E;  2H5K A;  5DC0 B;  3KFJ A;  3BKB A;  1CWD L;  5GJI A;  3S8N A;  1SHD A;  2K79 B;  5EHR A;  1O41 A;  3K2M A;  4E93 A;  5BO4 A;  1A1E A;  1PIC A;  1RJA A;  1O48 A;  2ABL A;  2VIF A;  4XZ1 A;  4A4C A;  1AB2 A;  1AD5 A;  2GSB A;  1FBV A;  2CR4 A;  1BG1 A;  1CWE A;  4F5B A;  2JYQ A;  3UF4 A;  3HHM B;  2B3O A;  1QCF A;  1A1B A;  2PLE A;  4H34 A;  1O4J A;  2HDV A;  1LUM A;  2HCK A;  4F59 A;  1NZV A;  3OV1 A;  1CSY A;  3VRQ A;  3MAZ A;  1O4O A;  5DF6 A;  2H8H A;  2ROR A;  2Y1M A;  1FMK A;  1JYU A;  3BUW B;  1BLK A;  1A81 A;  2YSX A;  1SHB A;  3VS6 A;  3VS7 A;  4K44 A;  3T04 A;  1M27 A;  1AOU F;  1O4K A;  3CXL A;  3TKZ A;  1LUK A;  1KA7 A;  1RQQ C;  3VRZ A;  1HCT B;  2RSY A;  5D0J A;  3NHN A;  3M7F A;  2MC1 A;  1BM2 A;  1FBZ A;  1Y57 A;  1GRI A;  4K2R A;  4XZ0 A;  2PLD A;  2KNO A;  1OO3 A;  4LUE A;  1FYR A;  1SHA A;  2EL8 A;  2OQ1 A;  2CI8 A;  1D4W A;  3HCK A;  3TL0 A;  3BUX B;  1F2F A;  1AYC A;  5AUL A;  4WWQ A;  2FO0 A;  3WA4 A;  1O46 A;  2PTK A;  5DC9 A;  4JGH A;  1BHH B;  2IUI A;  3MXY A;  2XP1 A;  3VS0 A;  5DC4 A;  1KC2 A;  1SPS A;  2EU0 A;  1UUS A;  4DGX A;  2MRJ A;  1IS0 A;  2L6K A;  3IMD A;  2ETZ A;  1BMB A;  3PS5 A;  1FHS A;  1R1Q A;  4FL3 A;  5GJH A;  1A07 A;  4U17 A;  2AOB A;  5IBM A;  3VRY A;  1BKM A;  1XA6 A;  2AUG A;  4H1O A;  1JWO A;  1A08 A;  4QSY A;  3VRR A;  4NWG A;  5HKZ A;  2CIA A;  2SRC A;  4EIH A;  2GE9 A;  2H46 E;  2QMS A;  1BFJ A;  1O4D A;  5EG3 B;  1P13 A;  1SPR A;  1IJR A;  1O45 A;  2ECD A;  1BF5 A;  5EEQ A;  3VRN A;  2IZV A;  2YU7 A;  1R1P A;  2RMX A;  2EO3 A;  1SKJ A;  2C0O A;  1BKL A;  2EKX A;  5IBS A;  2EYY A;  2HMH A;  4FL2 A;  1O49 A;  1O4G A;  3PFV A;  2EOB A;  4P9Z A;  2PNA A;  2C9W A;  2DX0 A;  4ROJ A;  4NWF A;  1BHH A;  3BUN B;  1B47 A;  3OP0 A;  3US4 A;  2DM0 A;  2MRK A;  1JYR A;  2IUG A;  2DVJ A;  4OHH A;  2HDX A;  1O4F A;  3GXW A;  2EYV A;  1LUI A;  3PQZ A;  3QWX X;  5J3X A;  2CRH A;  1WQU A;  3N8M A;  1UUR A;  2C0T A;  1AYD A;  1HCS B;  3VS1 A;  4X6S A;  2DLY A;  2IUH A;  1Z3K A;  1X27 A;  1NZL A;  1K9A A;  3OVE A;  3QWY A;  1TCE A;  3IN7 A;  3VS4 A;  1A1A A;  4L1B B;  1X0N A;  1O44 A;  4P9V A;  5EEL A;  2L4K A;  1D1Z A;  1R1S A;  1A09 A;  1A1C A;  2LNX A;  1AOT F;  3GXX A;  3N84 A;  1YVL A;  4GWF A;  3C7I A;  1LUN A;  1TZE E;  3PJP A;  3MXC A;  3VS2 A;  1LCK A;  4A4B A;  3S9K A;  2LNW A;  1FU5 A;  5HKY A;  3VRO A;  2MQI A;  2OZO A;  1O4N A;  3BUM B;  1O4B A;  2CBL A;  5HKW A;  2EO6 A;  5I6V A;  3ZNI A;  1H9O A;  1RPY A;  4U1P A;  1AYA A;  2KK6 A;  1O4E A;  1GHU A;  2K7A B;  3VRP A;  3BUO B;  4OHL A;  3CBL A;  1CJ1 A;  3OB2 B;  3VS5 A;  2Y3A B;  1OPK A;  1OPL A;  1O4Q A;  2MK2 A;  1O42 A;  2Y1N A;  1AYB A;  4D8K A;  4OHD A;  4GPL B;  3N7Y A;  1X6C A;  3UYO A;  3PLF B; 
#chains in the Genus database with same CATH topology
 1KSW A;  5KAZ A;  1YVH A;  4K45 A;  4E68 A;  1O4R A;  2HUW A;  1O4I A;  5EHP A;  2BBU A;  1LKK A;  1BLJ A;  3PSJ A;  1LCJ A;  1QG1 E;  1JYQ A;  2CI9 A;  2LQN A;  1O4A A;  3CD3 A;  2LQW A;  2CS0 A;  1MW4 A;  1D4T A;  4GL9 E;  1BHF A;  2DLZ A;  1NRV A;  3CWG A;  3GQI B;  2AOA A;  3HIZ B;  2DCR A;  3IMJ A;  4OHE A;  1O4M A;  1CSZ A;  1O43 A;  4K11 A;  1O4C A;  2PNB A;  3EAZ A;  4M4Z A;  4FBN A;  2EYZ A;  1O47 A;  1KA6 A;  1LKL A;  3PSK A;  1G83 A;  4DGP A;  5CDW A;  4TZI A;  3EAC A;  2L3T A;  3IN8 A;  4LUD A;  1M61 A;  3VGO A;  3S8O A;  1OO4 A;  4OHI A;  1O4L A;  1JU5 A;  1I3Z A;  2SHP A;  3S8L A;  4JE4 A;  1BFI A;  1F1W A;  1Y1U A;  2C0I A;  1FU6 A;  3OB1 B;  1O4P A;  4F5A A;  1O4H A;  1MIL A;  2LCT A;  5AXI A;  4JEG A;  3VS3 A;  4EY0 A;  2FCI A;  1QAD A;  2RVF A;  1ZFP E;  2H5K A;  5DC0 B;  3KFJ A;  3BKB A;  1CWD L;  5GJI A;  3S8N A;  1SHD A;  2K79 B;  5EHR A;  1O41 A;  3K2M A;  4E93 A;  5BO4 A;  1A1E A;  1PIC A;  1RJA A;  1O48 A;  2ABL A;  2KGY A;  2VIF A;  4XZ1 A;  4A4C A;  1AB2 A;  1AD5 A;  2GSB A;  1FBV A;  2CR4 A;  1BG1 A;  1CWE A;  4F5B A;  2JYQ A;  3UF4 A;  3HHM B;  2B3O A;  1QCF A;  1A1B A;  2PLE A;  4H34 A;  1O4J A;  2HDV A;  1LUM A;  2HCK A;  4F59 A;  1NZV A;  3OV1 A;  1CSY A;  3VRQ A;  3MAZ A;  1O4O A;  5DF6 A;  2H8H A;  3LYV A;  2ROR A;  2Y1M A;  1FMK A;  1JYU A;  3BUW B;  1BLK A;  1A81 A;  2YSX A;  1SHB A;  3VS6 A;  3VS7 A;  4K44 A;  3T04 A;  1M27 A;  1AOU F;  1O4K A;  3CXL A;  3TKZ A;  1LUK A;  1KA7 A;  1RQQ C;  3VRZ A;  1HCT B;  2RSY A;  5D0J A;  3NHN A;  3M7F A;  2MC1 A;  1BM2 A;  1FBZ A;  1Y57 A;  1GRI A;  4K2R A;  4XZ0 A;  2PLD A;  2KNO A;  1OO3 A;  4LUE A;  1FYR A;  1SHA A;  2EL8 A;  2OQ1 A;  2CI8 A;  1D4W A;  3HCK A;  3TL0 A;  3BUX B;  1F2F A;  1AYC A;  5AUL A;  4WWQ A;  2FO0 A;  3WA4 A;  1O46 A;  2PTK A;  5DC9 A;  4JGH A;  1BHH B;  2IUI A;  3MXY A;  2XP1 A;  3VS0 A;  5DC4 A;  1KC2 A;  1SPS A;  2EU0 A;  1UUS A;  4DGX A;  2MRJ A;  1IS0 A;  2L6K A;  3IMD A;  2ETZ A;  1BMB A;  3PS5 A;  1FHS A;  1R1Q A;  4FL3 A;  5GJH A;  1A07 A;  4U17 A;  2AOB A;  5IBM A;  3VRY A;  1BKM A;  1XA6 A;  2AUG A;  4H1O A;  1JWO A;  1A08 A;  4QSY A;  3VRR A;  4NWG A;  5HKZ A;  2CIA A;  2SRC A;  4EIH A;  2GE9 A;  2H46 E;  2QMS A;  1BFJ A;  1O4D A;  5EG3 B;  1P13 A;  1SPR A;  1IJR A;  1O45 A;  2ECD A;  1BF5 A;  5EEQ A;  3VRN A;  2IZV A;  2YU7 A;  1R1P A;  2RMX A;  2EO3 A;  1SKJ A;  2C0O A;  1BKL A;  2EKX A;  5IBS A;  2EYY A;  2HMH A;  4FL2 A;  1O49 A;  1O4G A;  3PFV A;  2EOB A;  4P9Z A;  2PNA A;  2C9W A;  2DX0 A;  4ROJ A;  4NWF A;  1BHH A;  3BUN B;  1B47 A;  3OP0 A;  3US4 A;  2DM0 A;  2MRK A;  1JYR A;  2IUG A;  2LRA A;  2DVJ A;  4OHH A;  2HDX A;  1O4F A;  3GXW A;  2EYV A;  1LUI A;  3PQZ A;  3QWX X;  5J3X A;  2CRH A;  1WQU A;  3N8M A;  1UUR A;  2C0T A;  1AYD A;  1HCS B;  3VS1 A;  4X6S A;  2DLY A;  2IUH A;  1Z3K A;  1X27 A;  1NZL A;  1K9A A;  3OVE A;  3QWY A;  1TCE A;  3K2T A;  3IN7 A;  3VS4 A;  1A1A A;  4L1B B;  1X0N A;  1O44 A;  4P9V A;  5EEL A;  2L4K A;  1D1Z A;  1R1S A;  1A09 A;  1A1C A;  2LNX A;  1AOT F;  3GXX A;  3N84 A;  1YVL A;  4GWF A;  3C7I A;  1LUN A;  1TZE E;  3PJP A;  3MXC A;  3VS2 A;  1LCK A;  4A4B A;  3S9K A;  2LNW A;  1FU5 A;  5HKY A;  3VRO A;  2MQI A;  2OZO A;  1O4N A;  3BUM B;  1O4B A;  2CBL A;  5HKW A;  2EO6 A;  5I6V A;  3ZNI A;  1H9O A;  1RPY A;  4U1P A;  1AYA A;  2KK6 A;  1O4E A;  1GHU A;  2K7A B;  3VRP A;  3BUO B;  4OHL A;  3CBL A;  1CJ1 A;  3OB2 B;  3VS5 A;  2Y3A B;  1OPK A;  1OPL A;  1O4Q A;  2MK2 A;  1O42 A;  2Y1N A;  1AYB A;  4D8K A;  4OHD A;  4GPL B;  3N7Y A;  1X6C A;  3UYO A;  3PLF B; 
#chains in the Genus database with same CATH homology
 1KSW A;  5KAZ A;  1YVH A;  4K45 A;  4E68 A;  1O4R A;  2HUW A;  1O4I A;  5EHP A;  2BBU A;  1LKK A;  1BLJ A;  3PSJ A;  1LCJ A;  1QG1 E;  1JYQ A;  2CI9 A;  2LQN A;  1O4A A;  3CD3 A;  2LQW A;  2CS0 A;  1MW4 A;  1D4T A;  4GL9 E;  1BHF A;  2DLZ A;  1NRV A;  3CWG A;  3GQI B;  2AOA A;  3HIZ B;  2DCR A;  3IMJ A;  4OHE A;  1O4M A;  1CSZ A;  1O43 A;  4K11 A;  1O4C A;  2PNB A;  3EAZ A;  4M4Z A;  4FBN A;  2EYZ A;  1O47 A;  1KA6 A;  1LKL A;  3PSK A;  1G83 A;  4DGP A;  5CDW A;  4TZI A;  3EAC A;  2L3T A;  3IN8 A;  4LUD A;  1M61 A;  3VGO A;  3S8O A;  1OO4 A;  4OHI A;  1O4L A;  1JU5 A;  1I3Z A;  2SHP A;  3S8L A;  4JE4 A;  1BFI A;  1F1W A;  1Y1U A;  2C0I A;  1FU6 A;  3OB1 B;  1O4P A;  4F5A A;  1O4H A;  1MIL A;  2LCT A;  5AXI A;  4JEG A;  3VS3 A;  4EY0 A;  2FCI A;  1QAD A;  2RVF A;  1ZFP E;  2H5K A;  5DC0 B;  3KFJ A;  3BKB A;  1CWD L;  5GJI A;  3S8N A;  1SHD A;  2K79 B;  5EHR A;  1O41 A;  3K2M A;  4E93 A;  5BO4 A;  1A1E A;  1PIC A;  1RJA A;  1O48 A;  2ABL A;  2VIF A;  4XZ1 A;  4A4C A;  1AB2 A;  1AD5 A;  2GSB A;  1FBV A;  2CR4 A;  1BG1 A;  1CWE A;  4F5B A;  2JYQ A;  3UF4 A;  3HHM B;  2B3O A;  1QCF A;  1A1B A;  2PLE A;  4H34 A;  1O4J A;  2HDV A;  1LUM A;  2HCK A;  4F59 A;  1NZV A;  3OV1 A;  1CSY A;  3VRQ A;  3MAZ A;  1O4O A;  5DF6 A;  2H8H A;  2ROR A;  2Y1M A;  1FMK A;  1JYU A;  3BUW B;  1BLK A;  1A81 A;  2YSX A;  1SHB A;  3VS6 A;  3VS7 A;  4K44 A;  3T04 A;  1M27 A;  1AOU F;  1O4K A;  3CXL A;  3TKZ A;  1LUK A;  1KA7 A;  1RQQ C;  3VRZ A;  1HCT B;  2RSY A;  5D0J A;  3NHN A;  3M7F A;  2MC1 A;  1BM2 A;  1FBZ A;  1Y57 A;  1GRI A;  4K2R A;  4XZ0 A;  2PLD A;  2KNO A;  1OO3 A;  4LUE A;  1FYR A;  1SHA A;  2EL8 A;  2OQ1 A;  2CI8 A;  1D4W A;  3HCK A;  3TL0 A;  3BUX B;  1F2F A;  1AYC A;  5AUL A;  4WWQ A;  2FO0 A;  3WA4 A;  1O46 A;  2PTK A;  5DC9 A;  4JGH A;  1BHH B;  2IUI A;  3MXY A;  2XP1 A;  3VS0 A;  5DC4 A;  1KC2 A;  1SPS A;  2EU0 A;  1UUS A;  4DGX A;  2MRJ A;  1IS0 A;  2L6K A;  3IMD A;  2ETZ A;  1BMB A;  3PS5 A;  1FHS A;  1R1Q A;  4FL3 A;  5GJH A;  1A07 A;  4U17 A;  2AOB A;  5IBM A;  3VRY A;  1BKM A;  1XA6 A;  2AUG A;  4H1O A;  1JWO A;  1A08 A;  4QSY A;  3VRR A;  4NWG A;  5HKZ A;  2CIA A;  2SRC A;  4EIH A;  2GE9 A;  2H46 E;  2QMS A;  1BFJ A;  1O4D A;  5EG3 B;  1P13 A;  1SPR A;  1IJR A;  1O45 A;  2ECD A;  1BF5 A;  5EEQ A;  3VRN A;  2IZV A;  2YU7 A;  1R1P A;  2RMX A;  2EO3 A;  1SKJ A;  2C0O A;  1BKL A;  2EKX A;  5IBS A;  2EYY A;  2HMH A;  4FL2 A;  1O49 A;  1O4G A;  3PFV A;  2EOB A;  4P9Z A;  2PNA A;  2C9W A;  2DX0 A;  4ROJ A;  4NWF A;  1BHH A;  3BUN B;  1B47 A;  3OP0 A;  3US4 A;  2DM0 A;  2MRK A;  1JYR A;  2IUG A;  2DVJ A;  4OHH A;  2HDX A;  1O4F A;  3GXW A;  2EYV A;  1LUI A;  3PQZ A;  3QWX X;  5J3X A;  2CRH A;  1WQU A;  3N8M A;  1UUR A;  2C0T A;  1AYD A;  1HCS B;  3VS1 A;  4X6S A;  2DLY A;  2IUH A;  1Z3K A;  1X27 A;  1NZL A;  1K9A A;  3OVE A;  3QWY A;  1TCE A;  3IN7 A;  3VS4 A;  1A1A A;  4L1B B;  1X0N A;  1O44 A;  4P9V A;  5EEL A;  2L4K A;  1D1Z A;  1R1S A;  1A09 A;  1A1C A;  2LNX A;  1AOT F;  3GXX A;  3N84 A;  1YVL A;  4GWF A;  3C7I A;  1LUN A;  1TZE E;  3PJP A;  3MXC A;  3VS2 A;  1LCK A;  4A4B A;  3S9K A;  2LNW A;  1FU5 A;  5HKY A;  3VRO A;  2MQI A;  2OZO A;  1O4N A;  3BUM B;  1O4B A;  2CBL A;  5HKW A;  2EO6 A;  5I6V A;  3ZNI A;  1H9O A;  1RPY A;  4U1P A;  1AYA A;  2KK6 A;  1O4E A;  1GHU A;  2K7A B;  3VRP A;  3BUO B;  4OHL A;  3CBL A;  1CJ1 A;  3OB2 B;  3VS5 A;  2Y3A B;  1OPK A;  1OPL A;  1O4Q A;  2MK2 A;  1O42 A;  2Y1N A;  1AYB A;  4D8K A;  4OHD A;  4GPL B;  3N7Y A;  1X6C A;  3UYO A;  3PLF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...