1O4QA

Crystal structure of sh2 in complex with ru79256.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
106
Chain Sequence
SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
publication title Requirements for specific binding of low affinity inhibitor fragments to the SH2 domain of (pp60)Src are identical to those for high affinity binding of full length inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 26
structure length 106
sequence length 106
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1o4qA00
1CWEA 1BKMA 5EELA 1NRVA 3PSKA 3CD3A 2SRCA 1LUNA 2PNAA 3N8MA 3OP0A 2OQ1A 2YU7A 4EIHA 2B3OA 3QWXX 1Z3KA 3VRPA 5AULA 5KAZA 5EHRA 5HKWA 1KC2A 1BHHA 1O43A 1OPKA 3MXCA 2EKXA 1FHSA 4NWFA 2IUIA 3BUNB 5GJIA 3HHMB 1O4MA 2PNBA 1CJ1A 1O4PA 2ETZA 2MC1A 4K11A 1QCFA 3M7FA 1RJAA 2L4KA 3NHNA 5J3XA 3N84A 1HCSB 4E68A 1F2FA 2PLDA 5BO4A 1O4HA 4F5BA 1O4RA 1AB2A 4OHEA 2IUGA 3WA4A 4D8KA 1LCJA 1GRIA 1O4DA 1JYQA 2CBLA 1YVLA 2LQWA 4U17A 3PFVA 2CIAA 3IN8A 4K44A 1FYRA 1UUSA 4JEGA 2K79B 1D4WA 2AOAA 1SPSA 1A1CA 3HCKA 2LNWA 3VS5A 3TKZA 1AYCA 2FO0A 1BLKA 3US4A 3MAZA 2AUGA 3QWYA 1SHDA 2DVJA 1AOTF 1X6CA 4GL9E 4P9VA 1OPLA 1FMKA 2OZOA 3VS1A 1LUMA 1O4QA 2HDXA 1RQQC 4K45A 1R1PA 5GJHA 2RORA 5IBMA 2FCIA 1X27A 1O4LA 2C0IA 4OHLA 1KA7A 1Y57A 3EAZA 3CWGA 1FBZA 3BUWB 3GXXA 1FU5A 2IUHA 2DX0A 1F1WA 4FL3A 2EU0A 2ABLA 2DM0A 3KFJA 1A08A 2KK6A 2HMHA 5EHPA 3VRRA 1AYDA 3OVEA 1O4FA 1NZLA 1BF5A 2AOBA 2HDVA 1CSYA 1RPYA 3VRQA 5EG3B 3BKBA 3VS3A 1BM2A 1BG1A 1M61A 1LUKA 2QMSA 5HKZA 1AYBA 3VS0A 5DC0B 2PLEA 4U1PA 1FBVA 3VRNA 4L1BB 2CI9A 1TCEA 2K7AB 4FL2A 3VRZA 4DGPA 1O42A 1HCTB 3S8LA 1CWDL 1A09A 4EY0A 3BUXB 5DF6A 5IBSA 4LUEA 1O47A 3TL0A 2VIFA 2H5KA 2CS0A 3GQIB 1KSWA 1LKKA 4LUDA 1BHFA 2LQNA 1R1QA 2RVFA 4OHDA 4JGHA 3OB2B 1O46A 1O4GA 1BFJA 1P13A 3VRYA 4OHHA 1BMBA 1JU5A 3PS5A 2C0OA 4WWQA 1CSZA 2L6KA 2Y1NA 3GXWA 1AOUF 1TZEE 3S8NA 1ZFPE 2HUWA 5CDWA 1A1BA 1IJRA 3VROA 2DCRA 2H46E 3OV1A 1AYAA 2H8HA 4XZ0A 3S8OA 3N7YA 4H1OA 2YSXA 5DC9A 2Y1MA 1XA6A 2KNOA 2EOBA 1O4BA 1O4NA 1YVHA 1BLJA 1H9OA 1GHUA 4F59A 1K9AA 1JYRA 2BBUA 3VS7A 2C9WA 1G83A 1QADA 4X6SA 2DLYA 4OHIA 3CBLA 1BFIA 2DLZA 3K2MA 1OO4A 4DGXA 4ROJA 3VS4A 1R1SA 2EYZA 1FU6A 2L3TA 1LUIA 1A07A 2PTKA 4P9ZA 3UF4A 1WQUA 1O4KA 1I3ZA 2Y3AB 3EACA 1O4EA 3PSJA 3IN7A 5AXIA 1X0NA 3IMJA 2GSBA 2LCTA 2MQIA 1JWOA 1LCKA 2EYYA 5I6VA 1A1AA 2SHPA 1O4AA 2MK2A 3CXLA 4M4ZA 3S9KA 4QSYA 1A1EA 2C0TA 3OB1B 1MW4A 2XP1A 5DC4A 1AD5A 1PICA 4GPLB 1O44A 4F5AA 4XZ1A 1O4IA 3BUMB 1M27A 4H34A 3VS6A 2HCKA 1O4JA 3IMDA 3UYOA 2LNXA 5D0JA 2RSYA 1OO3A 2JYQA 1O41A 4A4BA 3PLFB 1JYUA 3BUOB 4TZIA 3PQZA 3PJPA 4K2RA 4NWGA 4JE4A 4E93A 1LKLA 1SPRA 2CRHA 1KA6A 2EO6A 1IS0A 1O45A 4FBNA 1O4OA 5EEQA 2GE9A 1B47A 1BHHB 4A4CA 5HKYA 1O49A 4GWFA 2ECDA 2RMXA 1BKLA 2CR4A 3HIZB 1UURA 2EO3A 1MILA 3T04A 2EYVA 1O4CA 2CI8A 1O48A 2EL8A 1SHAA 1SKJA 1A81A 3VS2A 2MRJA 3MXYA 1SHBA 2IZVA 1Y1UA 1D4TA 1NZVA 1D1ZA 3C7IA 3VGOA 1QG1E 3ZNIA 2MRKA
chains in the Genus database with same CATH superfamily
1CWEA 1BKMA 5EELA 1NRVA 3PSKA 3CD3A 2SRCA 1LUNA 2PNAA 3N8MA 3OP0A 2OQ1A 2YU7A 4EIHA 2B3OA 3QWXX 1Z3KA 3VRPA 5AULA 5KAZA 5EHRA 5HKWA 1KC2A 1BHHA 1O43A 1OPKA 2KGYA 3MXCA 2EKXA 1FHSA 4NWFA 2IUIA 3BUNB 5GJIA 3HHMB 1O4MA 2PNBA 1CJ1A 1O4PA 2ETZA 2MC1A 4K11A 1QCFA 3M7FA 1RJAA 2L4KA 3NHNA 5J3XA 3N84A 1HCSB 4E68A 1F2FA 2PLDA 5BO4A 1O4HA 4F5BA 1O4RA 1AB2A 4OHEA 2IUGA 3WA4A 4D8KA 1LCJA 1GRIA 1O4DA 1JYQA 2CBLA 1YVLA 2LQWA 4U17A 3PFVA 2CIAA 3IN8A 4K44A 1FYRA 1UUSA 4JEGA 2K79B 1D4WA 2AOAA 1SPSA 1A1CA 3HCKA 2LNWA 3VS5A 3TKZA 1AYCA 2FO0A 1BLKA 3US4A 3MAZA 2AUGA 3QWYA 1SHDA 2DVJA 1AOTF 1X6CA 4GL9E 4P9VA 1OPLA 1FMKA 2OZOA 3VS1A 1LUMA 1O4QA 2HDXA 1RQQC 4K45A 1R1PA 2LRAA 5GJHA 2RORA 5IBMA 2FCIA 1X27A 1O4LA 2C0IA 4OHLA 1KA7A 1Y57A 3EAZA 3CWGA 1FBZA 3BUWB 3GXXA 1FU5A 2IUHA 2DX0A 1F1WA 4FL3A 2EU0A 2ABLA 2DM0A 3KFJA 1A08A 2KK6A 2HMHA 5EHPA 3VRRA 1AYDA 3OVEA 1O4FA 1NZLA 1BF5A 2AOBA 2HDVA 1CSYA 1RPYA 3VRQA 5EG3B 3BKBA 3VS3A 1BM2A 1BG1A 1M61A 1LUKA 2QMSA 5HKZA 1AYBA 3VS0A 5DC0B 2PLEA 4U1PA 1FBVA 3VRNA 4L1BB 2CI9A 1TCEA 2K7AB 4FL2A 3VRZA 4DGPA 1O42A 1HCTB 3S8LA 1CWDL 1A09A 4EY0A 3BUXB 5DF6A 5IBSA 4LUEA 1O47A 3TL0A 2VIFA 2H5KA 2CS0A 3GQIB 1KSWA 1LKKA 4LUDA 1BHFA 2LQNA 1R1QA 2RVFA 4OHDA 4JGHA 3OB2B 1O46A 1O4GA 1BFJA 1P13A 3VRYA 4OHHA 1BMBA 1JU5A 3PS5A 2C0OA 4WWQA 1CSZA 2L6KA 2Y1NA 3GXWA 1AOUF 1TZEE 3S8NA 1ZFPE 2HUWA 5CDWA 1A1BA 1IJRA 3VROA 2DCRA 2H46E 3OV1A 1AYAA 2H8HA 4XZ0A 3S8OA 3LYVA 3N7YA 4H1OA 2YSXA 5DC9A 2Y1MA 1XA6A 2KNOA 2EOBA 1O4BA 1O4NA 1YVHA 1BLJA 1H9OA 1GHUA 4F59A 1K9AA 1JYRA 2BBUA 3VS7A 2C9WA 1G83A 3K2TA 1QADA 4X6SA 2DLYA 4OHIA 3CBLA 1BFIA 2DLZA 3K2MA 1OO4A 4DGXA 4ROJA 3VS4A 1R1SA 2EYZA 1FU6A 2L3TA 1LUIA 1A07A 2PTKA 4P9ZA 3UF4A 1WQUA 1O4KA 1I3ZA 2Y3AB 3EACA 1O4EA 3PSJA 3IN7A 5AXIA 1X0NA 3IMJA 2GSBA 2LCTA 2MQIA 1JWOA 1LCKA 2EYYA 5I6VA 1A1AA 2SHPA 1O4AA 2MK2A 3CXLA 4M4ZA 3S9KA 4QSYA 1A1EA 2C0TA 3OB1B 1MW4A 2XP1A 5DC4A 1AD5A 1PICA 4GPLB 1O44A 4F5AA 4XZ1A 1O4IA 3BUMB 1M27A 4H34A 3VS6A 2HCKA 1O4JA 3IMDA 3UYOA 2LNXA 5D0JA 2RSYA 1OO3A 2JYQA 1O41A 4A4BA 3PLFB 1JYUA 3BUOB 4TZIA 3PQZA 3PJPA 4K2RA 4NWGA 4JE4A 4E93A 1LKLA 1SPRA 2CRHA 1KA6A 2EO6A 1IS0A 1O45A 4FBNA 1O4OA 5EEQA 2GE9A 1B47A 1BHHB 4A4CA 5HKYA 1O49A 4GWFA 2ECDA 2RMXA 1BKLA 2CR4A 3HIZB 1UURA 2EO3A 1MILA 3T04A 2EYVA 1O4CA 2CI8A 1O48A 2EL8A 1SHAA 1SKJA 1A81A 3VS2A 2MRJA 3MXYA 1SHBA 2IZVA 1Y1UA 1D4TA 1NZVA 1D1ZA 3C7IA 3VGOA 1QG1E 3ZNIA 2MRKA
chains in the Genus database with same CATH topology
1CWEA 1BKMA 5EELA 1NRVA 3PSKA 3CD3A 2SRCA 1LUNA 2PNAA 3N8MA 3OP0A 2OQ1A 2YU7A 4EIHA 2B3OA 3QWXX 1Z3KA 3VRPA 5AULA 5KAZA 5EHRA 5HKWA 1KC2A 1BHHA 1O43A 1OPKA 3MXCA 2EKXA 1FHSA 4NWFA 2IUIA 3BUNB 5GJIA 3HHMB 1O4MA 2PNBA 1CJ1A 1O4PA 2ETZA 2MC1A 4K11A 1QCFA 3M7FA 1RJAA 2L4KA 3NHNA 5J3XA 3N84A 1HCSB 4E68A 1F2FA 2PLDA 5BO4A 1O4HA 4F5BA 1O4RA 1AB2A 4OHEA 2IUGA 3WA4A 4D8KA 1LCJA 1GRIA 1O4DA 1JYQA 2CBLA 1YVLA 2LQWA 4U17A 3PFVA 2CIAA 3IN8A 4K44A 1FYRA 1UUSA 4JEGA 2K79B 1D4WA 2AOAA 1SPSA 1A1CA 3HCKA 2LNWA 3VS5A 3TKZA 1AYCA 2FO0A 1BLKA 3US4A 3MAZA 2AUGA 3QWYA 1SHDA 2DVJA 1AOTF 1X6CA 4GL9E 4P9VA 1OPLA 1FMKA 2OZOA 3VS1A 1LUMA 1O4QA 2HDXA 1RQQC 4K45A 1R1PA 5GJHA 2RORA 5IBMA 2FCIA 1X27A 1O4LA 2C0IA 4OHLA 1KA7A 1Y57A 3EAZA 3CWGA 1FBZA 3BUWB 3GXXA 1FU5A 2IUHA 2DX0A 1F1WA 4FL3A 2EU0A 2ABLA 2DM0A 3KFJA 1A08A 2KK6A 2HMHA 5EHPA 3VRRA 1AYDA 3OVEA 1O4FA 1NZLA 1BF5A 2AOBA 2HDVA 1CSYA 1RPYA 3VRQA 5EG3B 3BKBA 3VS3A 1BM2A 1BG1A 1M61A 1LUKA 2QMSA 5HKZA 1AYBA 3VS0A 5DC0B 2PLEA 4U1PA 1FBVA 3VRNA 4L1BB 2CI9A 1TCEA 2K7AB 4FL2A 3VRZA 4DGPA 1O42A 1HCTB 3S8LA 1CWDL 1A09A 4EY0A 3BUXB 5DF6A 5IBSA 4LUEA 1O47A 3TL0A 2VIFA 2H5KA 2CS0A 3GQIB 1KSWA 1LKKA 4LUDA 1BHFA 2LQNA 1R1QA 2RVFA 4OHDA 4JGHA 3OB2B 1O46A 1O4GA 1BFJA 1P13A 3VRYA 4OHHA 1BMBA 1JU5A 3PS5A 2C0OA 4WWQA 1CSZA 2L6KA 2Y1NA 3GXWA 1AOUF 1TZEE 3S8NA 1ZFPE 2HUWA 5CDWA 1A1BA 1IJRA 3VROA 2DCRA 2H46E 3OV1A 1AYAA 2H8HA 4XZ0A 3S8OA 3N7YA 4H1OA 2YSXA 5DC9A 2Y1MA 1XA6A 2KNOA 2EOBA 1O4BA 1O4NA 1YVHA 1BLJA 1H9OA 1GHUA 4F59A 1K9AA 1JYRA 2BBUA 3VS7A 2C9WA 1G83A 1QADA 4X6SA 2DLYA 4OHIA 3CBLA 1BFIA 2DLZA 3K2MA 1OO4A 4DGXA 4ROJA 3VS4A 1R1SA 2EYZA 1FU6A 2L3TA 1LUIA 1A07A 2PTKA 4P9ZA 3UF4A 1WQUA 1O4KA 1I3ZA 2Y3AB 3EACA 1O4EA 3PSJA 3IN7A 5AXIA 1X0NA 3IMJA 2GSBA 2LCTA 2MQIA 1JWOA 1LCKA 2EYYA 5I6VA 1A1AA 2SHPA 1O4AA 2MK2A 3CXLA 4M4ZA 3S9KA 4QSYA 1A1EA 2C0TA 3OB1B 1MW4A 2XP1A 5DC4A 1AD5A 1PICA 4GPLB 1O44A 4F5AA 4XZ1A 1O4IA 3BUMB 1M27A 4H34A 3VS6A 2HCKA 1O4JA 3IMDA 3UYOA 2LNXA 5D0JA 2RSYA 1OO3A 2JYQA 1O41A 4A4BA 3PLFB 1JYUA 3BUOB 4TZIA 3PQZA 3PJPA 4K2RA 4NWGA 4JE4A 4E93A 1LKLA 1SPRA 2CRHA 1KA6A 2EO6A 1IS0A 1O45A 4FBNA 1O4OA 5EEQA 2GE9A 1B47A 1BHHB 4A4CA 5HKYA 1O49A 4GWFA 2ECDA 2RMXA 1BKLA 2CR4A 3HIZB 1UURA 2EO3A 1MILA 3T04A 2EYVA 1O4CA 2CI8A 1O48A 2EL8A 1SHAA 1SKJA 1A81A 3VS2A 2MRJA 3MXYA 1SHBA 2IZVA 1Y1UA 1D4TA 1NZVA 1D1ZA 3C7IA 3VGOA 1QG1E 3ZNIA 2MRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CWE A;  1BKM A;  5EEL A;  1NRV A;  3PSK A;  3CD3 A;  2SRC A;  1LUN A;  2PNA A;  3N8M A;  3OP0 A;  2OQ1 A;  2YU7 A;  4EIH A;  2B3O A;  3QWX X;  1Z3K A;  3VRP A;  5AUL A;  5KAZ A;  5EHR A;  5HKW A;  1KC2 A;  1BHH A;  1O43 A;  1OPK A;  3MXC A;  2EKX A;  1FHS A;  4NWF A;  2IUI A;  3BUN B;  5GJI A;  3HHM B;  1O4M A;  2PNB A;  1CJ1 A;  1O4P A;  2ETZ A;  2MC1 A;  4K11 A;  1QCF A;  3M7F A;  1RJA A;  2L4K A;  3NHN A;  5J3X A;  3N84 A;  1HCS B;  4E68 A;  1F2F A;  2PLD A;  5BO4 A;  1O4H A;  4F5B A;  1O4R A;  1AB2 A;  4OHE A;  2IUG A;  3WA4 A;  4D8K A;  1LCJ A;  1GRI A;  1O4D A;  1JYQ A;  2CBL A;  1YVL A;  2LQW A;  4U17 A;  3PFV A;  2CIA A;  3IN8 A;  4K44 A;  1FYR A;  1UUS A;  4JEG A;  2K79 B;  1D4W A;  2AOA A;  1SPS A;  1A1C A;  3HCK A;  2LNW A;  3VS5 A;  3TKZ A;  1AYC A;  2FO0 A;  1BLK A;  3US4 A;  3MAZ A;  2AUG A;  3QWY A;  1SHD A;  2DVJ A;  1AOT F;  1X6C A;  4GL9 E;  4P9V A;  1OPL A;  1FMK A;  2OZO A;  3VS1 A;  1LUM A;  1O4Q A;  2HDX A;  1RQQ C;  4K45 A;  1R1P A;  5GJH A;  2ROR A;  5IBM A;  2FCI A;  1X27 A;  1O4L A;  2C0I A;  4OHL A;  1KA7 A;  1Y57 A;  3EAZ A;  3CWG A;  1FBZ A;  3BUW B;  3GXX A;  1FU5 A;  2IUH A;  2DX0 A;  1F1W A;  4FL3 A;  2EU0 A;  2ABL A;  2DM0 A;  3KFJ A;  1A08 A;  2KK6 A;  2HMH A;  5EHP A;  3VRR A;  1AYD A;  3OVE A;  1O4F A;  1NZL A;  1BF5 A;  2AOB A;  2HDV A;  1CSY A;  1RPY A;  3VRQ A;  5EG3 B;  3BKB A;  3VS3 A;  1BM2 A;  1BG1 A;  1M61 A;  1LUK A;  2QMS A;  5HKZ A;  1AYB A;  3VS0 A;  5DC0 B;  2PLE A;  4U1P A;  1FBV A;  3VRN A;  4L1B B;  2CI9 A;  1TCE A;  2K7A B;  4FL2 A;  3VRZ A;  4DGP A;  1O42 A;  1HCT B;  3S8L A;  1CWD L;  1A09 A;  4EY0 A;  3BUX B;  5DF6 A;  5IBS A;  4LUE A;  1O47 A;  3TL0 A;  2VIF A;  2H5K A;  2CS0 A;  3GQI B;  1KSW A;  1LKK A;  4LUD A;  1BHF A;  2LQN A;  1R1Q A;  2RVF A;  4OHD A;  4JGH A;  3OB2 B;  1O46 A;  1O4G A;  1BFJ A;  1P13 A;  3VRY A;  4OHH A;  1BMB A;  1JU5 A;  3PS5 A;  2C0O A;  4WWQ A;  1CSZ A;  2L6K A;  2Y1N A;  3GXW A;  1AOU F;  1TZE E;  3S8N A;  1ZFP E;  2HUW A;  5CDW A;  1A1B A;  1IJR A;  3VRO A;  2DCR A;  2H46 E;  3OV1 A;  1AYA A;  2H8H A;  4XZ0 A;  3S8O A;  3N7Y A;  4H1O A;  2YSX A;  5DC9 A;  2Y1M A;  1XA6 A;  2KNO A;  2EOB A;  1O4B A;  1O4N A;  1YVH A;  1BLJ A;  1H9O A;  1GHU A;  4F59 A;  1K9A A;  1JYR A;  2BBU A;  3VS7 A;  2C9W A;  1G83 A;  1QAD A;  4X6S A;  2DLY A;  4OHI A;  3CBL A;  1BFI A;  2DLZ A;  3K2M A;  1OO4 A;  4DGX A;  4ROJ A;  3VS4 A;  1R1S A;  2EYZ A;  1FU6 A;  2L3T A;  1LUI A;  1A07 A;  2PTK A;  4P9Z A;  3UF4 A;  1WQU A;  1O4K A;  1I3Z A;  2Y3A B;  3EAC A;  1O4E A;  3PSJ A;  3IN7 A;  5AXI A;  1X0N A;  3IMJ A;  2GSB A;  2LCT A;  2MQI A;  1JWO A;  1LCK A;  2EYY A;  5I6V A;  1A1A A;  2SHP A;  1O4A A;  2MK2 A;  3CXL A;  4M4Z A;  3S9K A;  4QSY A;  1A1E A;  2C0T A;  3OB1 B;  1MW4 A;  2XP1 A;  5DC4 A;  1AD5 A;  1PIC A;  4GPL B;  1O44 A;  4F5A A;  4XZ1 A;  1O4I A;  3BUM B;  1M27 A;  4H34 A;  3VS6 A;  2HCK A;  1O4J A;  3IMD A;  3UYO A;  2LNX A;  5D0J A;  2RSY A;  1OO3 A;  2JYQ A;  1O41 A;  4A4B A;  3PLF B;  1JYU A;  3BUO B;  4TZI A;  3PQZ A;  3PJP A;  4K2R A;  4NWG A;  4JE4 A;  4E93 A;  1LKL A;  1SPR A;  2CRH A;  1KA6 A;  2EO6 A;  1IS0 A;  1O45 A;  4FBN A;  1O4O A;  5EEQ A;  2GE9 A;  1B47 A;  1BHH B;  4A4C A;  5HKY A;  1O49 A;  4GWF A;  2ECD A;  2RMX A;  1BKL A;  2CR4 A;  3HIZ B;  1UUR A;  2EO3 A;  1MIL A;  3T04 A;  2EYV A;  1O4C A;  2CI8 A;  1O48 A;  2EL8 A;  1SHA A;  1SKJ A;  1A81 A;  3VS2 A;  2MRJ A;  3MXY A;  1SHB A;  2IZV A;  1Y1U A;  1D4T A;  1NZV A;  1D1Z A;  3C7I A;  3VGO A;  1QG1 E;  3ZNI A;  2MRK A; 
#chains in the Genus database with same CATH topology
 1CWE A;  1BKM A;  5EEL A;  1NRV A;  3PSK A;  3CD3 A;  2SRC A;  1LUN A;  2PNA A;  3N8M A;  3OP0 A;  2OQ1 A;  2YU7 A;  4EIH A;  2B3O A;  3QWX X;  1Z3K A;  3VRP A;  5AUL A;  5KAZ A;  5EHR A;  5HKW A;  1KC2 A;  1BHH A;  1O43 A;  1OPK A;  2KGY A;  3MXC A;  2EKX A;  1FHS A;  4NWF A;  2IUI A;  3BUN B;  5GJI A;  3HHM B;  1O4M A;  2PNB A;  1CJ1 A;  1O4P A;  2ETZ A;  2MC1 A;  4K11 A;  1QCF A;  3M7F A;  1RJA A;  2L4K A;  3NHN A;  5J3X A;  3N84 A;  1HCS B;  4E68 A;  1F2F A;  2PLD A;  5BO4 A;  1O4H A;  4F5B A;  1O4R A;  1AB2 A;  4OHE A;  2IUG A;  3WA4 A;  4D8K A;  1LCJ A;  1GRI A;  1O4D A;  1JYQ A;  2CBL A;  1YVL A;  2LQW A;  4U17 A;  3PFV A;  2CIA A;  3IN8 A;  4K44 A;  1FYR A;  1UUS A;  4JEG A;  2K79 B;  1D4W A;  2AOA A;  1SPS A;  1A1C A;  3HCK A;  2LNW A;  3VS5 A;  3TKZ A;  1AYC A;  2FO0 A;  1BLK A;  3US4 A;  3MAZ A;  2AUG A;  3QWY A;  1SHD A;  2DVJ A;  1AOT F;  1X6C A;  4GL9 E;  4P9V A;  1OPL A;  1FMK A;  2OZO A;  3VS1 A;  1LUM A;  1O4Q A;  2HDX A;  1RQQ C;  4K45 A;  1R1P A;  2LRA A;  5GJH A;  2ROR A;  5IBM A;  2FCI A;  1X27 A;  1O4L A;  2C0I A;  4OHL A;  1KA7 A;  1Y57 A;  3EAZ A;  3CWG A;  1FBZ A;  3BUW B;  3GXX A;  1FU5 A;  2IUH A;  2DX0 A;  1F1W A;  4FL3 A;  2EU0 A;  2ABL A;  2DM0 A;  3KFJ A;  1A08 A;  2KK6 A;  2HMH A;  5EHP A;  3VRR A;  1AYD A;  3OVE A;  1O4F A;  1NZL A;  1BF5 A;  2AOB A;  2HDV A;  1CSY A;  1RPY A;  3VRQ A;  5EG3 B;  3BKB A;  3VS3 A;  1BM2 A;  1BG1 A;  1M61 A;  1LUK A;  2QMS A;  5HKZ A;  1AYB A;  3VS0 A;  5DC0 B;  2PLE A;  4U1P A;  1FBV A;  3VRN A;  4L1B B;  2CI9 A;  1TCE A;  2K7A B;  4FL2 A;  3VRZ A;  4DGP A;  1O42 A;  1HCT B;  3S8L A;  1CWD L;  1A09 A;  4EY0 A;  3BUX B;  5DF6 A;  5IBS A;  4LUE A;  1O47 A;  3TL0 A;  2VIF A;  2H5K A;  2CS0 A;  3GQI B;  1KSW A;  1LKK A;  4LUD A;  1BHF A;  2LQN A;  1R1Q A;  2RVF A;  4OHD A;  4JGH A;  3OB2 B;  1O46 A;  1O4G A;  1BFJ A;  1P13 A;  3VRY A;  4OHH A;  1BMB A;  1JU5 A;  3PS5 A;  2C0O A;  4WWQ A;  1CSZ A;  2L6K A;  2Y1N A;  3GXW A;  1AOU F;  1TZE E;  3S8N A;  1ZFP E;  2HUW A;  5CDW A;  1A1B A;  1IJR A;  3VRO A;  2DCR A;  2H46 E;  3OV1 A;  1AYA A;  2H8H A;  4XZ0 A;  3S8O A;  3LYV A;  3N7Y A;  4H1O A;  2YSX A;  5DC9 A;  2Y1M A;  1XA6 A;  2KNO A;  2EOB A;  1O4B A;  1O4N A;  1YVH A;  1BLJ A;  1H9O A;  1GHU A;  4F59 A;  1K9A A;  1JYR A;  2BBU A;  3VS7 A;  2C9W A;  1G83 A;  3K2T A;  1QAD A;  4X6S A;  2DLY A;  4OHI A;  3CBL A;  1BFI A;  2DLZ A;  3K2M A;  1OO4 A;  4DGX A;  4ROJ A;  3VS4 A;  1R1S A;  2EYZ A;  1FU6 A;  2L3T A;  1LUI A;  1A07 A;  2PTK A;  4P9Z A;  3UF4 A;  1WQU A;  1O4K A;  1I3Z A;  2Y3A B;  3EAC A;  1O4E A;  3PSJ A;  3IN7 A;  5AXI A;  1X0N A;  3IMJ A;  2GSB A;  2LCT A;  2MQI A;  1JWO A;  1LCK A;  2EYY A;  5I6V A;  1A1A A;  2SHP A;  1O4A A;  2MK2 A;  3CXL A;  4M4Z A;  3S9K A;  4QSY A;  1A1E A;  2C0T A;  3OB1 B;  1MW4 A;  2XP1 A;  5DC4 A;  1AD5 A;  1PIC A;  4GPL B;  1O44 A;  4F5A A;  4XZ1 A;  1O4I A;  3BUM B;  1M27 A;  4H34 A;  3VS6 A;  2HCK A;  1O4J A;  3IMD A;  3UYO A;  2LNX A;  5D0J A;  2RSY A;  1OO3 A;  2JYQ A;  1O41 A;  4A4B A;  3PLF B;  1JYU A;  3BUO B;  4TZI A;  3PQZ A;  3PJP A;  4K2R A;  4NWG A;  4JE4 A;  4E93 A;  1LKL A;  1SPR A;  2CRH A;  1KA6 A;  2EO6 A;  1IS0 A;  1O45 A;  4FBN A;  1O4O A;  5EEQ A;  2GE9 A;  1B47 A;  1BHH B;  4A4C A;  5HKY A;  1O49 A;  4GWF A;  2ECD A;  2RMX A;  1BKL A;  2CR4 A;  3HIZ B;  1UUR A;  2EO3 A;  1MIL A;  3T04 A;  2EYV A;  1O4C A;  2CI8 A;  1O48 A;  2EL8 A;  1SHA A;  1SKJ A;  1A81 A;  3VS2 A;  2MRJ A;  3MXY A;  1SHB A;  2IZV A;  1Y1U A;  1D4T A;  1NZV A;  1D1Z A;  3C7I A;  3VGO A;  1QG1 E;  3ZNI A;  2MRK A; 
#chains in the Genus database with same CATH homology
 1CWE A;  1BKM A;  5EEL A;  1NRV A;  3PSK A;  3CD3 A;  2SRC A;  1LUN A;  2PNA A;  3N8M A;  3OP0 A;  2OQ1 A;  2YU7 A;  4EIH A;  2B3O A;  3QWX X;  1Z3K A;  3VRP A;  5AUL A;  5KAZ A;  5EHR A;  5HKW A;  1KC2 A;  1BHH A;  1O43 A;  1OPK A;  3MXC A;  2EKX A;  1FHS A;  4NWF A;  2IUI A;  3BUN B;  5GJI A;  3HHM B;  1O4M A;  2PNB A;  1CJ1 A;  1O4P A;  2ETZ A;  2MC1 A;  4K11 A;  1QCF A;  3M7F A;  1RJA A;  2L4K A;  3NHN A;  5J3X A;  3N84 A;  1HCS B;  4E68 A;  1F2F A;  2PLD A;  5BO4 A;  1O4H A;  4F5B A;  1O4R A;  1AB2 A;  4OHE A;  2IUG A;  3WA4 A;  4D8K A;  1LCJ A;  1GRI A;  1O4D A;  1JYQ A;  2CBL A;  1YVL A;  2LQW A;  4U17 A;  3PFV A;  2CIA A;  3IN8 A;  4K44 A;  1FYR A;  1UUS A;  4JEG A;  2K79 B;  1D4W A;  2AOA A;  1SPS A;  1A1C A;  3HCK A;  2LNW A;  3VS5 A;  3TKZ A;  1AYC A;  2FO0 A;  1BLK A;  3US4 A;  3MAZ A;  2AUG A;  3QWY A;  1SHD A;  2DVJ A;  1AOT F;  1X6C A;  4GL9 E;  4P9V A;  1OPL A;  1FMK A;  2OZO A;  3VS1 A;  1LUM A;  1O4Q A;  2HDX A;  1RQQ C;  4K45 A;  1R1P A;  5GJH A;  2ROR A;  5IBM A;  2FCI A;  1X27 A;  1O4L A;  2C0I A;  4OHL A;  1KA7 A;  1Y57 A;  3EAZ A;  3CWG A;  1FBZ A;  3BUW B;  3GXX A;  1FU5 A;  2IUH A;  2DX0 A;  1F1W A;  4FL3 A;  2EU0 A;  2ABL A;  2DM0 A;  3KFJ A;  1A08 A;  2KK6 A;  2HMH A;  5EHP A;  3VRR A;  1AYD A;  3OVE A;  1O4F A;  1NZL A;  1BF5 A;  2AOB A;  2HDV A;  1CSY A;  1RPY A;  3VRQ A;  5EG3 B;  3BKB A;  3VS3 A;  1BM2 A;  1BG1 A;  1M61 A;  1LUK A;  2QMS A;  5HKZ A;  1AYB A;  3VS0 A;  5DC0 B;  2PLE A;  4U1P A;  1FBV A;  3VRN A;  4L1B B;  2CI9 A;  1TCE A;  2K7A B;  4FL2 A;  3VRZ A;  4DGP A;  1O42 A;  1HCT B;  3S8L A;  1CWD L;  1A09 A;  4EY0 A;  3BUX B;  5DF6 A;  5IBS A;  4LUE A;  1O47 A;  3TL0 A;  2VIF A;  2H5K A;  2CS0 A;  3GQI B;  1KSW A;  1LKK A;  4LUD A;  1BHF A;  2LQN A;  1R1Q A;  2RVF A;  4OHD A;  4JGH A;  3OB2 B;  1O46 A;  1O4G A;  1BFJ A;  1P13 A;  3VRY A;  4OHH A;  1BMB A;  1JU5 A;  3PS5 A;  2C0O A;  4WWQ A;  1CSZ A;  2L6K A;  2Y1N A;  3GXW A;  1AOU F;  1TZE E;  3S8N A;  1ZFP E;  2HUW A;  5CDW A;  1A1B A;  1IJR A;  3VRO A;  2DCR A;  2H46 E;  3OV1 A;  1AYA A;  2H8H A;  4XZ0 A;  3S8O A;  3N7Y A;  4H1O A;  2YSX A;  5DC9 A;  2Y1M A;  1XA6 A;  2KNO A;  2EOB A;  1O4B A;  1O4N A;  1YVH A;  1BLJ A;  1H9O A;  1GHU A;  4F59 A;  1K9A A;  1JYR A;  2BBU A;  3VS7 A;  2C9W A;  1G83 A;  1QAD A;  4X6S A;  2DLY A;  4OHI A;  3CBL A;  1BFI A;  2DLZ A;  3K2M A;  1OO4 A;  4DGX A;  4ROJ A;  3VS4 A;  1R1S A;  2EYZ A;  1FU6 A;  2L3T A;  1LUI A;  1A07 A;  2PTK A;  4P9Z A;  3UF4 A;  1WQU A;  1O4K A;  1I3Z A;  2Y3A B;  3EAC A;  1O4E A;  3PSJ A;  3IN7 A;  5AXI A;  1X0N A;  3IMJ A;  2GSB A;  2LCT A;  2MQI A;  1JWO A;  1LCK A;  2EYY A;  5I6V A;  1A1A A;  2SHP A;  1O4A A;  2MK2 A;  3CXL A;  4M4Z A;  3S9K A;  4QSY A;  1A1E A;  2C0T A;  3OB1 B;  1MW4 A;  2XP1 A;  5DC4 A;  1AD5 A;  1PIC A;  4GPL B;  1O44 A;  4F5A A;  4XZ1 A;  1O4I A;  3BUM B;  1M27 A;  4H34 A;  3VS6 A;  2HCK A;  1O4J A;  3IMD A;  3UYO A;  2LNX A;  5D0J A;  2RSY A;  1OO3 A;  2JYQ A;  1O41 A;  4A4B A;  3PLF B;  1JYU A;  3BUO B;  4TZI A;  3PQZ A;  3PJP A;  4K2R A;  4NWG A;  4JE4 A;  4E93 A;  1LKL A;  1SPR A;  2CRH A;  1KA6 A;  2EO6 A;  1IS0 A;  1O45 A;  4FBN A;  1O4O A;  5EEQ A;  2GE9 A;  1B47 A;  1BHH B;  4A4C A;  5HKY A;  1O49 A;  4GWF A;  2ECD A;  2RMX A;  1BKL A;  2CR4 A;  3HIZ B;  1UUR A;  2EO3 A;  1MIL A;  3T04 A;  2EYV A;  1O4C A;  2CI8 A;  1O48 A;  2EL8 A;  1SHA A;  1SKJ A;  1A81 A;  3VS2 A;  2MRJ A;  3MXY A;  1SHB A;  2IZV A;  1Y1U A;  1D4T A;  1NZV A;  1D1Z A;  3C7I A;  3VGO A;  1QG1 E;  3ZNI A;  2MRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...