2DM0A

Solution structure of the sh2 domain of human tyrosine-protein kinase txk
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
125
structure length
125
Chain Sequence
b'GSSGSSGNKITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRHLGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWYHQHNAAGLMTRLRYPVGLMGSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase TXK
publication title Solution structure of the SH2 domain of human Tyrosine-protein kinase TXK
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 12
structure length 125
sequence length 125
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2dm0A01
1WQUA 5DC4A 1KA6A 5AULA 2EO3A 1BMBA 1I3ZA 1F2FA 2Y1NA 2QMSA 1AYBA 4F59A 1NRVA 1X0NA 1G83A 1BM2A 2B3OA 2PNAA 2XP1A 1MW4A 1BKLA 4A4BA 1RJAA 2Y3AB 1JYRA 4JE4A 1A1BA 2MK2A 2PNBA 2EYVA 2DCRA 2CIAA 2FO0A 1BHHB 1QADA 1XA6A 1TZEE 3VGOA 1AYAA 4A4CA 1O4PA 1IS0A 4F5AA 2LQNA 3BUOB 2EOBA 2GSBA 1AOTF 3BKBA 3PQZA 1FBZA 1OO4A 2L3TA 1O4IA 5EG3B 1PICA 1FBVA 3N84A 4LUEA 4D8KA 2CI8A 2HDXA 2IZVA 4K11A 1AYDA 2PTKA 1A07A 1UURA 1O4AA 3OVEA 4WWQA 2IUHA 2ABLA 3OB2B 2K7AB 1A1AA 1O4CA 4FL3A 3VS4A 3IMJA 2RMXA 2SRCA 3VS2A 4K45A 3CD3A 5HKYA 4FL2A 3QWYA 1JWOA 1AB2A 1HCTB 1SHDA 1BLJA 1ZFPE 2IUIA 1YVLA 5AXIA 1A1EA 4NWFA 1OPLA 4F5BA 5BO4A 2DX0A 1D1ZA 3OV1A 2ETZA 5HKZA 1CSZA 3US4A 2LCTA 4NWGA 2ECDA 2AOBA 4OHDA 5KAZA 3OB1B 1BKMA 4OHEA 3S9KA 1KSWA 1SPRA 1O4NA 2EYYA 3K2MA 4JEGA 4XZ1A 4LUDA 5GJIA 2C0TA 1O4QA 1M61A 1AOUF 3VS7A 2CI9A 1D4WA 2AUGA 2DLZA 1UUSA 1A08A 1O4RA 1O45A 4U1PA 3HHMB 1LCJA 3IN8A 1KA7A 1LCKA 2YU7A 3VRZA 3UF4A 2MQIA 2CS0A 1R1PA 3CWGA 2RVFA 3BUMB 3WA4A 2OZOA 3IMDA 3PJPA 1O44A 2HCKA 2KK6A 1O4BA 1Z3KA 1GHUA 4GWFA 3M7FA 4ROJA 1CSYA 2L4KA 1CWEA 4GPLB 4JGHA 1R1QA 1O41A 3BUWB 1O4JA 5EEQA 1B47A 1BG1A 3CXLA 2CR4A 4XZ0A 3VRRA 1YVHA 3OP0A 3IN7A 1O47A 2PLDA 1BHHA 2YSXA 2KNOA 4OHLA 1QG1E 1O4GA 1KC2A 2DVJA 1X27A 5IBMA 1O4KA 2MRJA 5DC0B 2C0OA 5IBSA 1FYRA 2EKXA 2L6KA 1O48A 1K9AA 1JYQA 2DLYA 3MXYA 1D4TA 1H9OA 3VRPA 1A1CA 1O4EA 1MILA 1CJ1A 3VS0A 2H5KA 2HDVA 1OPKA 5D0JA 1SHBA 1RPYA 3KFJA 4OHHA 4EY0A 3VRQA 1O4HA 1FMKA 4M4ZA 1HCSB 1O49A 5GJHA 1JYUA 1Y57A 2H46E 1BFJA 1O43A 5CDWA 1O42A 1CWDL 2RORA 1O46A 2RSYA 2OQ1A 1BHFA 1FU6A 3HIZB 1BF5A 1SKJA 3N7YA 4QSYA 4E68A 1BLKA 3N8MA 2EL8A 2MRKA 1TCEA 4X6SA 1LUMA 2IUGA 4L1BB 3PS5A 4DGXA 1GRIA 1A81A 4P9ZA 1OO3A 5HKWA 2LQWA 2VIFA 2EO6A 3PFVA 1Y1UA 2LNWA 1RQQC 1QCFA 3PSJA 2C9WA 1LUKA 4H34A 1FU5A 2EU0A 1SPSA 5J3XA 1NZLA 2SHPA 1M27A 5DC9A 2K79B 3GQIB 1NZVA 1X6CA 2CRHA 1SHAA 2H8HA 3VS5A 3TL0A 3NHNA 2LNXA 3S8LA 3VRYA 1O4MA 3EACA 4GL9E 3ZNIA 4FBNA 1LKLA 1JU5A 2PLEA 5I6VA 3VS1A 4OHIA 3QWXX 1AYCA 1R1SA 2EYZA 1O4FA 1LKKA 2MC1A 3HCKA 5EHRA 3TKZA 2CBLA 4U17A 5DF6A 2JYQA 3BUNB 1A09A 4P9VA 3CBLA 3VS3A 2DM0A 3PLFB 1O4OA 2AOAA 2HUWA 3UYOA 4H1OA 1O4DA 3VROA 3S8NA 3S8OA 5EELA 3GXXA 4K44A 1LUNA 1O4LA 3C7IA 3MXCA 5EHPA 1P13A 3PSKA 4E93A 3T04A 2C0IA 3MAZA 2FCIA 1IJRA 1F1WA 1LUIA 4TZIA 1FHSA 1BFIA 2HMHA 3VRNA 2GE9A 4DGPA 3BUXB 3GXWA 1AD5A 3EAZA 4EIHA 2Y1MA 3VS6A 4K2RA 2BBUA
chains in the Genus database with same CATH superfamily
1WQUA 5DC4A 1KA6A 5AULA 2EO3A 1BMBA 1I3ZA 1F2FA 2Y1NA 2QMSA 1AYBA 4F59A 1NRVA 1X0NA 3LYVA 1G83A 1BM2A 2B3OA 2PNAA 2XP1A 1MW4A 1BKLA 4A4BA 1RJAA 2Y3AB 1JYRA 4JE4A 1A1BA 2MK2A 2PNBA 2EYVA 2DCRA 2CIAA 2FO0A 1BHHB 1QADA 1XA6A 1TZEE 3VGOA 1AYAA 4A4CA 1O4PA 1IS0A 4F5AA 2LQNA 3BUOB 2EOBA 2GSBA 1AOTF 3BKBA 3PQZA 1FBZA 1OO4A 2L3TA 1O4IA 5EG3B 1PICA 1FBVA 3N84A 4LUEA 4D8KA 2CI8A 2HDXA 2IZVA 3K2TA 4K11A 1AYDA 2PTKA 1A07A 1UURA 1O4AA 3OVEA 4WWQA 2IUHA 2ABLA 3OB2B 2K7AB 1A1AA 1O4CA 4FL3A 3VS4A 3IMJA 2RMXA 2SRCA 3VS2A 4K45A 3CD3A 5HKYA 4FL2A 3QWYA 1JWOA 1AB2A 1HCTB 1SHDA 1BLJA 1ZFPE 2IUIA 1YVLA 5AXIA 1A1EA 4NWFA 1OPLA 4F5BA 5BO4A 2DX0A 1D1ZA 3OV1A 2ETZA 5HKZA 1CSZA 3US4A 2LCTA 4NWGA 2ECDA 2AOBA 4OHDA 5KAZA 3OB1B 1BKMA 4OHEA 3S9KA 1KSWA 1SPRA 1O4NA 2EYYA 3K2MA 4JEGA 4XZ1A 4LUDA 5GJIA 2C0TA 2KGYA 1O4QA 1M61A 1AOUF 3VS7A 2CI9A 1D4WA 2AUGA 2DLZA 1UUSA 1A08A 1O4RA 1O45A 4U1PA 3HHMB 1LCJA 3IN8A 1KA7A 1LCKA 2YU7A 3VRZA 3UF4A 2MQIA 2CS0A 1R1PA 3CWGA 2RVFA 3BUMB 3WA4A 2OZOA 3IMDA 3PJPA 1O44A 2HCKA 2KK6A 1O4BA 1Z3KA 1GHUA 4GWFA 3M7FA 4ROJA 1CSYA 2L4KA 1CWEA 4GPLB 4JGHA 1R1QA 1O41A 3BUWB 1O4JA 5EEQA 1B47A 1BG1A 3CXLA 2CR4A 4XZ0A 3VRRA 1YVHA 3OP0A 3IN7A 1O47A 2PLDA 1BHHA 2YSXA 2KNOA 4OHLA 1QG1E 1O4GA 1KC2A 2DVJA 1X27A 5IBMA 1O4KA 2MRJA 5DC0B 2C0OA 5IBSA 1FYRA 2EKXA 2L6KA 1O48A 1K9AA 1JYQA 2DLYA 3MXYA 1D4TA 1H9OA 3VRPA 1A1CA 1O4EA 1MILA 1CJ1A 3VS0A 2H5KA 2HDVA 1OPKA 5D0JA 1SHBA 1RPYA 3KFJA 4OHHA 4EY0A 3VRQA 1O4HA 1FMKA 4M4ZA 1HCSB 1O49A 5GJHA 1JYUA 1Y57A 2H46E 1BFJA 1O43A 5CDWA 1O42A 1CWDL 2RORA 1O46A 2RSYA 2OQ1A 1BHFA 1FU6A 3HIZB 1BF5A 1SKJA 3N7YA 4QSYA 4E68A 1BLKA 3N8MA 2EL8A 2MRKA 1TCEA 4X6SA 2LRAA 1LUMA 2IUGA 4L1BB 3PS5A 4DGXA 1GRIA 1A81A 4P9ZA 1OO3A 5HKWA 2LQWA 2VIFA 2EO6A 3PFVA 1Y1UA 2LNWA 1RQQC 1QCFA 3PSJA 2C9WA 1LUKA 4H34A 1FU5A 2EU0A 1SPSA 5J3XA 1NZLA 2SHPA 1M27A 5DC9A 2K79B 3GQIB 1NZVA 1X6CA 2CRHA 1SHAA 2H8HA 3VS5A 3TL0A 3NHNA 2LNXA 3S8LA 3VRYA 1O4MA 3EACA 4GL9E 3ZNIA 4FBNA 1LKLA 1JU5A 2PLEA 5I6VA 3VS1A 4OHIA 3QWXX 1AYCA 1R1SA 2EYZA 1O4FA 1LKKA 2MC1A 3HCKA 5EHRA 3TKZA 2CBLA 4U17A 5DF6A 2JYQA 3BUNB 1A09A 4P9VA 3CBLA 3VS3A 2DM0A 3PLFB 1O4OA 2AOAA 2HUWA 3UYOA 4H1OA 1O4DA 3VROA 3S8NA 3S8OA 5EELA 3GXXA 4K44A 1LUNA 1O4LA 3C7IA 3MXCA 5EHPA 1P13A 3PSKA 4E93A 3T04A 2C0IA 3MAZA 2FCIA 1IJRA 1F1WA 1LUIA 4TZIA 1FHSA 1BFIA 2HMHA 3VRNA 2GE9A 4DGPA 3BUXB 3GXWA 1AD5A 3EAZA 4EIHA 2Y1MA 3VS6A 4K2RA 2BBUA
chains in the Genus database with same CATH topology
1WQUA 5DC4A 1KA6A 5AULA 2EO3A 1BMBA 1I3ZA 1F2FA 2Y1NA 2QMSA 1AYBA 4F59A 1NRVA 1X0NA 1G83A 1BM2A 2B3OA 2PNAA 2XP1A 1MW4A 1BKLA 4A4BA 1RJAA 2Y3AB 1JYRA 4JE4A 1A1BA 2MK2A 2PNBA 2EYVA 2DCRA 2CIAA 2FO0A 1BHHB 1QADA 1XA6A 1TZEE 3VGOA 1AYAA 4A4CA 1O4PA 1IS0A 4F5AA 2LQNA 3BUOB 2EOBA 2GSBA 1AOTF 3BKBA 3PQZA 1FBZA 1OO4A 2L3TA 1O4IA 5EG3B 1PICA 1FBVA 3N84A 4LUEA 4D8KA 2CI8A 2HDXA 2IZVA 4K11A 1AYDA 2PTKA 1A07A 1UURA 1O4AA 3OVEA 4WWQA 2IUHA 2ABLA 3OB2B 2K7AB 1A1AA 1O4CA 4FL3A 3VS4A 3IMJA 2RMXA 2SRCA 3VS2A 4K45A 3CD3A 5HKYA 4FL2A 3QWYA 1JWOA 1AB2A 1HCTB 1SHDA 1BLJA 1ZFPE 2IUIA 1YVLA 5AXIA 1A1EA 4NWFA 1OPLA 4F5BA 5BO4A 2DX0A 1D1ZA 3OV1A 2ETZA 5HKZA 1CSZA 3US4A 2LCTA 4NWGA 2ECDA 2AOBA 4OHDA 5KAZA 3OB1B 1BKMA 4OHEA 3S9KA 1KSWA 1SPRA 1O4NA 2EYYA 3K2MA 4JEGA 4XZ1A 4LUDA 5GJIA 2C0TA 1O4QA 1M61A 1AOUF 3VS7A 2CI9A 1D4WA 2AUGA 2DLZA 1UUSA 1A08A 1O4RA 1O45A 4U1PA 3HHMB 1LCJA 3IN8A 1KA7A 1LCKA 2YU7A 3VRZA 3UF4A 2MQIA 2CS0A 1R1PA 3CWGA 2RVFA 3BUMB 3WA4A 2OZOA 3IMDA 3PJPA 1O44A 2HCKA 2KK6A 1O4BA 1Z3KA 1GHUA 4GWFA 3M7FA 4ROJA 1CSYA 2L4KA 1CWEA 4GPLB 4JGHA 1R1QA 1O41A 3BUWB 1O4JA 5EEQA 1B47A 1BG1A 3CXLA 2CR4A 4XZ0A 3VRRA 1YVHA 3OP0A 3IN7A 1O47A 2PLDA 1BHHA 2YSXA 2KNOA 4OHLA 1QG1E 1O4GA 1KC2A 2DVJA 1X27A 5IBMA 1O4KA 2MRJA 5DC0B 2C0OA 5IBSA 1FYRA 2EKXA 2L6KA 1O48A 1K9AA 1JYQA 2DLYA 3MXYA 1D4TA 1H9OA 3VRPA 1A1CA 1O4EA 1MILA 1CJ1A 3VS0A 2H5KA 2HDVA 1OPKA 5D0JA 1SHBA 1RPYA 3KFJA 4OHHA 4EY0A 3VRQA 1O4HA 1FMKA 4M4ZA 1HCSB 1O49A 5GJHA 1JYUA 1Y57A 2H46E 1BFJA 1O43A 5CDWA 1O42A 1CWDL 2RORA 1O46A 2RSYA 2OQ1A 1BHFA 1FU6A 3HIZB 1BF5A 1SKJA 3N7YA 4QSYA 4E68A 1BLKA 3N8MA 2EL8A 2MRKA 1TCEA 4X6SA 1LUMA 2IUGA 4L1BB 3PS5A 4DGXA 1GRIA 1A81A 4P9ZA 1OO3A 5HKWA 2LQWA 2VIFA 2EO6A 3PFVA 1Y1UA 2LNWA 1RQQC 1QCFA 3PSJA 2C9WA 1LUKA 4H34A 1FU5A 2EU0A 1SPSA 5J3XA 1NZLA 2SHPA 1M27A 5DC9A 2K79B 3GQIB 1NZVA 1X6CA 2CRHA 1SHAA 2H8HA 3VS5A 3TL0A 3NHNA 2LNXA 3S8LA 3VRYA 1O4MA 3EACA 4GL9E 3ZNIA 4FBNA 1LKLA 1JU5A 2PLEA 5I6VA 3VS1A 4OHIA 3QWXX 1AYCA 1R1SA 2EYZA 1O4FA 1LKKA 2MC1A 3HCKA 5EHRA 3TKZA 2CBLA 4U17A 5DF6A 2JYQA 3BUNB 1A09A 4P9VA 3CBLA 3VS3A 2DM0A 3PLFB 1O4OA 2AOAA 2HUWA 3UYOA 4H1OA 1O4DA 3VROA 3S8NA 3S8OA 5EELA 3GXXA 4K44A 1LUNA 1O4LA 3C7IA 3MXCA 5EHPA 1P13A 3PSKA 4E93A 3T04A 2C0IA 3MAZA 2FCIA 1IJRA 1F1WA 1LUIA 4TZIA 1FHSA 1BFIA 2HMHA 3VRNA 2GE9A 4DGPA 3BUXB 3GXWA 1AD5A 3EAZA 4EIHA 2Y1MA 3VS6A 4K2RA 2BBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQU A;  5DC4 A;  1KA6 A;  5AUL A;  2EO3 A;  1BMB A;  1I3Z A;  1F2F A;  2Y1N A;  2QMS A;  1AYB A;  4F59 A;  1NRV A;  1X0N A;  1G83 A;  1BM2 A;  2B3O A;  2PNA A;  2XP1 A;  1MW4 A;  1BKL A;  4A4B A;  1RJA A;  2Y3A B;  1JYR A;  4JE4 A;  1A1B A;  2MK2 A;  2PNB A;  2EYV A;  2DCR A;  2CIA A;  2FO0 A;  1BHH B;  1QAD A;  1XA6 A;  1TZE E;  3VGO A;  1AYA A;  4A4C A;  1O4P A;  1IS0 A;  4F5A A;  2LQN A;  3BUO B;  2EOB A;  2GSB A;  1AOT F;  3BKB A;  3PQZ A;  1FBZ A;  1OO4 A;  2L3T A;  1O4I A;  5EG3 B;  1PIC A;  1FBV A;  3N84 A;  4LUE A;  4D8K A;  2CI8 A;  2HDX A;  2IZV A;  4K11 A;  1AYD A;  2PTK A;  1A07 A;  1UUR A;  1O4A A;  3OVE A;  4WWQ A;  2IUH A;  2ABL A;  3OB2 B;  2K7A B;  1A1A A;  1O4C A;  4FL3 A;  3VS4 A;  3IMJ A;  2RMX A;  2SRC A;  3VS2 A;  4K45 A;  3CD3 A;  5HKY A;  4FL2 A;  3QWY A;  1JWO A;  1AB2 A;  1HCT B;  1SHD A;  1BLJ A;  1ZFP E;  2IUI A;  1YVL A;  5AXI A;  1A1E A;  4NWF A;  1OPL A;  4F5B A;  5BO4 A;  2DX0 A;  1D1Z A;  3OV1 A;  2ETZ A;  5HKZ A;  1CSZ A;  3US4 A;  2LCT A;  4NWG A;  2ECD A;  2AOB A;  4OHD A;  5KAZ A;  3OB1 B;  1BKM A;  4OHE A;  3S9K A;  1KSW A;  1SPR A;  1O4N A;  2EYY A;  3K2M A;  4JEG A;  4XZ1 A;  4LUD A;  5GJI A;  2C0T A;  1O4Q A;  1M61 A;  1AOU F;  3VS7 A;  2CI9 A;  1D4W A;  2AUG A;  2DLZ A;  1UUS A;  1A08 A;  1O4R A;  1O45 A;  4U1P A;  3HHM B;  1LCJ A;  3IN8 A;  1KA7 A;  1LCK A;  2YU7 A;  3VRZ A;  3UF4 A;  2MQI A;  2CS0 A;  1R1P A;  3CWG A;  2RVF A;  3BUM B;  3WA4 A;  2OZO A;  3IMD A;  3PJP A;  1O44 A;  2HCK A;  2KK6 A;  1O4B A;  1Z3K A;  1GHU A;  4GWF A;  3M7F A;  4ROJ A;  1CSY A;  2L4K A;  1CWE A;  4GPL B;  4JGH A;  1R1Q A;  1O41 A;  3BUW B;  1O4J A;  5EEQ A;  1B47 A;  1BG1 A;  3CXL A;  2CR4 A;  4XZ0 A;  3VRR A;  1YVH A;  3OP0 A;  3IN7 A;  1O47 A;  2PLD A;  1BHH A;  2YSX A;  2KNO A;  4OHL A;  1QG1 E;  1O4G A;  1KC2 A;  2DVJ A;  1X27 A;  5IBM A;  1O4K A;  2MRJ A;  5DC0 B;  2C0O A;  5IBS A;  1FYR A;  2EKX A;  2L6K A;  1O48 A;  1K9A A;  1JYQ A;  2DLY A;  3MXY A;  1D4T A;  1H9O A;  3VRP A;  1A1C A;  1O4E A;  1MIL A;  1CJ1 A;  3VS0 A;  2H5K A;  2HDV A;  1OPK A;  5D0J A;  1SHB A;  1RPY A;  3KFJ A;  4OHH A;  4EY0 A;  3VRQ A;  1O4H A;  1FMK A;  4M4Z A;  1HCS B;  1O49 A;  5GJH A;  1JYU A;  1Y57 A;  2H46 E;  1BFJ A;  1O43 A;  5CDW A;  1O42 A;  1CWD L;  2ROR A;  1O46 A;  2RSY A;  2OQ1 A;  1BHF A;  1FU6 A;  3HIZ B;  1BF5 A;  1SKJ A;  3N7Y A;  4QSY A;  4E68 A;  1BLK A;  3N8M A;  2EL8 A;  2MRK A;  1TCE A;  4X6S A;  1LUM A;  2IUG A;  4L1B B;  3PS5 A;  4DGX A;  1GRI A;  1A81 A;  4P9Z A;  1OO3 A;  5HKW A;  2LQW A;  2VIF A;  2EO6 A;  3PFV A;  1Y1U A;  2LNW A;  1RQQ C;  1QCF A;  3PSJ A;  2C9W A;  1LUK A;  4H34 A;  1FU5 A;  2EU0 A;  1SPS A;  5J3X A;  1NZL A;  2SHP A;  1M27 A;  5DC9 A;  2K79 B;  3GQI B;  1NZV A;  1X6C A;  2CRH A;  1SHA A;  2H8H A;  3VS5 A;  3TL0 A;  3NHN A;  2LNX A;  3S8L A;  3VRY A;  1O4M A;  3EAC A;  4GL9 E;  3ZNI A;  4FBN A;  1LKL A;  1JU5 A;  2PLE A;  5I6V A;  3VS1 A;  4OHI A;  3QWX X;  1AYC A;  1R1S A;  2EYZ A;  1O4F A;  1LKK A;  2MC1 A;  3HCK A;  5EHR A;  3TKZ A;  2CBL A;  4U17 A;  5DF6 A;  2JYQ A;  3BUN B;  1A09 A;  4P9V A;  3CBL A;  3VS3 A;  2DM0 A;  3PLF B;  1O4O A;  2AOA A;  2HUW A;  3UYO A;  4H1O A;  1O4D A;  3VRO A;  3S8N A;  3S8O A;  5EEL A;  3GXX A;  4K44 A;  1LUN A;  1O4L A;  3C7I A;  3MXC A;  5EHP A;  1P13 A;  3PSK A;  4E93 A;  3T04 A;  2C0I A;  3MAZ A;  2FCI A;  1IJR A;  1F1W A;  1LUI A;  4TZI A;  1FHS A;  1BFI A;  2HMH A;  3VRN A;  2GE9 A;  4DGP A;  3BUX B;  3GXW A;  1AD5 A;  3EAZ A;  4EIH A;  2Y1M A;  3VS6 A;  4K2R A;  2BBU A; 
#chains in the Genus database with same CATH topology
 1WQU A;  5DC4 A;  1KA6 A;  5AUL A;  2EO3 A;  1BMB A;  1I3Z A;  1F2F A;  2Y1N A;  2QMS A;  1AYB A;  4F59 A;  1NRV A;  1X0N A;  3LYV A;  1G83 A;  1BM2 A;  2B3O A;  2PNA A;  2XP1 A;  1MW4 A;  1BKL A;  4A4B A;  1RJA A;  2Y3A B;  1JYR A;  4JE4 A;  1A1B A;  2MK2 A;  2PNB A;  2EYV A;  2DCR A;  2CIA A;  2FO0 A;  1BHH B;  1QAD A;  1XA6 A;  1TZE E;  3VGO A;  1AYA A;  4A4C A;  1O4P A;  1IS0 A;  4F5A A;  2LQN A;  3BUO B;  2EOB A;  2GSB A;  1AOT F;  3BKB A;  3PQZ A;  1FBZ A;  1OO4 A;  2L3T A;  1O4I A;  5EG3 B;  1PIC A;  1FBV A;  3N84 A;  4LUE A;  4D8K A;  2CI8 A;  2HDX A;  2IZV A;  3K2T A;  4K11 A;  1AYD A;  2PTK A;  1A07 A;  1UUR A;  1O4A A;  3OVE A;  4WWQ A;  2IUH A;  2ABL A;  3OB2 B;  2K7A B;  1A1A A;  1O4C A;  4FL3 A;  3VS4 A;  3IMJ A;  2RMX A;  2SRC A;  3VS2 A;  4K45 A;  3CD3 A;  5HKY A;  4FL2 A;  3QWY A;  1JWO A;  1AB2 A;  1HCT B;  1SHD A;  1BLJ A;  1ZFP E;  2IUI A;  1YVL A;  5AXI A;  1A1E A;  4NWF A;  1OPL A;  4F5B A;  5BO4 A;  2DX0 A;  1D1Z A;  3OV1 A;  2ETZ A;  5HKZ A;  1CSZ A;  3US4 A;  2LCT A;  4NWG A;  2ECD A;  2AOB A;  4OHD A;  5KAZ A;  3OB1 B;  1BKM A;  4OHE A;  3S9K A;  1KSW A;  1SPR A;  1O4N A;  2EYY A;  3K2M A;  4JEG A;  4XZ1 A;  4LUD A;  5GJI A;  2C0T A;  2KGY A;  1O4Q A;  1M61 A;  1AOU F;  3VS7 A;  2CI9 A;  1D4W A;  2AUG A;  2DLZ A;  1UUS A;  1A08 A;  1O4R A;  1O45 A;  4U1P A;  3HHM B;  1LCJ A;  3IN8 A;  1KA7 A;  1LCK A;  2YU7 A;  3VRZ A;  3UF4 A;  2MQI A;  2CS0 A;  1R1P A;  3CWG A;  2RVF A;  3BUM B;  3WA4 A;  2OZO A;  3IMD A;  3PJP A;  1O44 A;  2HCK A;  2KK6 A;  1O4B A;  1Z3K A;  1GHU A;  4GWF A;  3M7F A;  4ROJ A;  1CSY A;  2L4K A;  1CWE A;  4GPL B;  4JGH A;  1R1Q A;  1O41 A;  3BUW B;  1O4J A;  5EEQ A;  1B47 A;  1BG1 A;  3CXL A;  2CR4 A;  4XZ0 A;  3VRR A;  1YVH A;  3OP0 A;  3IN7 A;  1O47 A;  2PLD A;  1BHH A;  2YSX A;  2KNO A;  4OHL A;  1QG1 E;  1O4G A;  1KC2 A;  2DVJ A;  1X27 A;  5IBM A;  1O4K A;  2MRJ A;  5DC0 B;  2C0O A;  5IBS A;  1FYR A;  2EKX A;  2L6K A;  1O48 A;  1K9A A;  1JYQ A;  2DLY A;  3MXY A;  1D4T A;  1H9O A;  3VRP A;  1A1C A;  1O4E A;  1MIL A;  1CJ1 A;  3VS0 A;  2H5K A;  2HDV A;  1OPK A;  5D0J A;  1SHB A;  1RPY A;  3KFJ A;  4OHH A;  4EY0 A;  3VRQ A;  1O4H A;  1FMK A;  4M4Z A;  1HCS B;  1O49 A;  5GJH A;  1JYU A;  1Y57 A;  2H46 E;  1BFJ A;  1O43 A;  5CDW A;  1O42 A;  1CWD L;  2ROR A;  1O46 A;  2RSY A;  2OQ1 A;  1BHF A;  1FU6 A;  3HIZ B;  1BF5 A;  1SKJ A;  3N7Y A;  4QSY A;  4E68 A;  1BLK A;  3N8M A;  2EL8 A;  2MRK A;  1TCE A;  4X6S A;  2LRA A;  1LUM A;  2IUG A;  4L1B B;  3PS5 A;  4DGX A;  1GRI A;  1A81 A;  4P9Z A;  1OO3 A;  5HKW A;  2LQW A;  2VIF A;  2EO6 A;  3PFV A;  1Y1U A;  2LNW A;  1RQQ C;  1QCF A;  3PSJ A;  2C9W A;  1LUK A;  4H34 A;  1FU5 A;  2EU0 A;  1SPS A;  5J3X A;  1NZL A;  2SHP A;  1M27 A;  5DC9 A;  2K79 B;  3GQI B;  1NZV A;  1X6C A;  2CRH A;  1SHA A;  2H8H A;  3VS5 A;  3TL0 A;  3NHN A;  2LNX A;  3S8L A;  3VRY A;  1O4M A;  3EAC A;  4GL9 E;  3ZNI A;  4FBN A;  1LKL A;  1JU5 A;  2PLE A;  5I6V A;  3VS1 A;  4OHI A;  3QWX X;  1AYC A;  1R1S A;  2EYZ A;  1O4F A;  1LKK A;  2MC1 A;  3HCK A;  5EHR A;  3TKZ A;  2CBL A;  4U17 A;  5DF6 A;  2JYQ A;  3BUN B;  1A09 A;  4P9V A;  3CBL A;  3VS3 A;  2DM0 A;  3PLF B;  1O4O A;  2AOA A;  2HUW A;  3UYO A;  4H1O A;  1O4D A;  3VRO A;  3S8N A;  3S8O A;  5EEL A;  3GXX A;  4K44 A;  1LUN A;  1O4L A;  3C7I A;  3MXC A;  5EHP A;  1P13 A;  3PSK A;  4E93 A;  3T04 A;  2C0I A;  3MAZ A;  2FCI A;  1IJR A;  1F1W A;  1LUI A;  4TZI A;  1FHS A;  1BFI A;  2HMH A;  3VRN A;  2GE9 A;  4DGP A;  3BUX B;  3GXW A;  1AD5 A;  3EAZ A;  4EIH A;  2Y1M A;  3VS6 A;  4K2R A;  2BBU A; 
#chains in the Genus database with same CATH homology
 1WQU A;  5DC4 A;  1KA6 A;  5AUL A;  2EO3 A;  1BMB A;  1I3Z A;  1F2F A;  2Y1N A;  2QMS A;  1AYB A;  4F59 A;  1NRV A;  1X0N A;  1G83 A;  1BM2 A;  2B3O A;  2PNA A;  2XP1 A;  1MW4 A;  1BKL A;  4A4B A;  1RJA A;  2Y3A B;  1JYR A;  4JE4 A;  1A1B A;  2MK2 A;  2PNB A;  2EYV A;  2DCR A;  2CIA A;  2FO0 A;  1BHH B;  1QAD A;  1XA6 A;  1TZE E;  3VGO A;  1AYA A;  4A4C A;  1O4P A;  1IS0 A;  4F5A A;  2LQN A;  3BUO B;  2EOB A;  2GSB A;  1AOT F;  3BKB A;  3PQZ A;  1FBZ A;  1OO4 A;  2L3T A;  1O4I A;  5EG3 B;  1PIC A;  1FBV A;  3N84 A;  4LUE A;  4D8K A;  2CI8 A;  2HDX A;  2IZV A;  4K11 A;  1AYD A;  2PTK A;  1A07 A;  1UUR A;  1O4A A;  3OVE A;  4WWQ A;  2IUH A;  2ABL A;  3OB2 B;  2K7A B;  1A1A A;  1O4C A;  4FL3 A;  3VS4 A;  3IMJ A;  2RMX A;  2SRC A;  3VS2 A;  4K45 A;  3CD3 A;  5HKY A;  4FL2 A;  3QWY A;  1JWO A;  1AB2 A;  1HCT B;  1SHD A;  1BLJ A;  1ZFP E;  2IUI A;  1YVL A;  5AXI A;  1A1E A;  4NWF A;  1OPL A;  4F5B A;  5BO4 A;  2DX0 A;  1D1Z A;  3OV1 A;  2ETZ A;  5HKZ A;  1CSZ A;  3US4 A;  2LCT A;  4NWG A;  2ECD A;  2AOB A;  4OHD A;  5KAZ A;  3OB1 B;  1BKM A;  4OHE A;  3S9K A;  1KSW A;  1SPR A;  1O4N A;  2EYY A;  3K2M A;  4JEG A;  4XZ1 A;  4LUD A;  5GJI A;  2C0T A;  1O4Q A;  1M61 A;  1AOU F;  3VS7 A;  2CI9 A;  1D4W A;  2AUG A;  2DLZ A;  1UUS A;  1A08 A;  1O4R A;  1O45 A;  4U1P A;  3HHM B;  1LCJ A;  3IN8 A;  1KA7 A;  1LCK A;  2YU7 A;  3VRZ A;  3UF4 A;  2MQI A;  2CS0 A;  1R1P A;  3CWG A;  2RVF A;  3BUM B;  3WA4 A;  2OZO A;  3IMD A;  3PJP A;  1O44 A;  2HCK A;  2KK6 A;  1O4B A;  1Z3K A;  1GHU A;  4GWF A;  3M7F A;  4ROJ A;  1CSY A;  2L4K A;  1CWE A;  4GPL B;  4JGH A;  1R1Q A;  1O41 A;  3BUW B;  1O4J A;  5EEQ A;  1B47 A;  1BG1 A;  3CXL A;  2CR4 A;  4XZ0 A;  3VRR A;  1YVH A;  3OP0 A;  3IN7 A;  1O47 A;  2PLD A;  1BHH A;  2YSX A;  2KNO A;  4OHL A;  1QG1 E;  1O4G A;  1KC2 A;  2DVJ A;  1X27 A;  5IBM A;  1O4K A;  2MRJ A;  5DC0 B;  2C0O A;  5IBS A;  1FYR A;  2EKX A;  2L6K A;  1O48 A;  1K9A A;  1JYQ A;  2DLY A;  3MXY A;  1D4T A;  1H9O A;  3VRP A;  1A1C A;  1O4E A;  1MIL A;  1CJ1 A;  3VS0 A;  2H5K A;  2HDV A;  1OPK A;  5D0J A;  1SHB A;  1RPY A;  3KFJ A;  4OHH A;  4EY0 A;  3VRQ A;  1O4H A;  1FMK A;  4M4Z A;  1HCS B;  1O49 A;  5GJH A;  1JYU A;  1Y57 A;  2H46 E;  1BFJ A;  1O43 A;  5CDW A;  1O42 A;  1CWD L;  2ROR A;  1O46 A;  2RSY A;  2OQ1 A;  1BHF A;  1FU6 A;  3HIZ B;  1BF5 A;  1SKJ A;  3N7Y A;  4QSY A;  4E68 A;  1BLK A;  3N8M A;  2EL8 A;  2MRK A;  1TCE A;  4X6S A;  1LUM A;  2IUG A;  4L1B B;  3PS5 A;  4DGX A;  1GRI A;  1A81 A;  4P9Z A;  1OO3 A;  5HKW A;  2LQW A;  2VIF A;  2EO6 A;  3PFV A;  1Y1U A;  2LNW A;  1RQQ C;  1QCF A;  3PSJ A;  2C9W A;  1LUK A;  4H34 A;  1FU5 A;  2EU0 A;  1SPS A;  5J3X A;  1NZL A;  2SHP A;  1M27 A;  5DC9 A;  2K79 B;  3GQI B;  1NZV A;  1X6C A;  2CRH A;  1SHA A;  2H8H A;  3VS5 A;  3TL0 A;  3NHN A;  2LNX A;  3S8L A;  3VRY A;  1O4M A;  3EAC A;  4GL9 E;  3ZNI A;  4FBN A;  1LKL A;  1JU5 A;  2PLE A;  5I6V A;  3VS1 A;  4OHI A;  3QWX X;  1AYC A;  1R1S A;  2EYZ A;  1O4F A;  1LKK A;  2MC1 A;  3HCK A;  5EHR A;  3TKZ A;  2CBL A;  4U17 A;  5DF6 A;  2JYQ A;  3BUN B;  1A09 A;  4P9V A;  3CBL A;  3VS3 A;  2DM0 A;  3PLF B;  1O4O A;  2AOA A;  2HUW A;  3UYO A;  4H1O A;  1O4D A;  3VRO A;  3S8N A;  3S8O A;  5EEL A;  3GXX A;  4K44 A;  1LUN A;  1O4L A;  3C7I A;  3MXC A;  5EHP A;  1P13 A;  3PSK A;  4E93 A;  3T04 A;  2C0I A;  3MAZ A;  2FCI A;  1IJR A;  1F1W A;  1LUI A;  4TZI A;  1FHS A;  1BFI A;  2HMH A;  3VRN A;  2GE9 A;  4DGP A;  3BUX B;  3GXW A;  1AD5 A;  3EAZ A;  4EIH A;  2Y1M A;  3VS6 A;  4K2R A;  2BBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...