3TL0A

Structure of shp2 n-sh2 domain in complex with rlnpyaqlwhr peptide
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
b'RWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein phosphatase non-receptor type 11
publication title Simultaneous binding of two peptidyl ligands by a SRC homology 2 domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/peptide
total genus 25
structure length 99
sequence length 99
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3tl0A00
3US4A 3BUMB 3MXYA 1LUKA 2RMXA 1X6CA 3UF4A 4X6SA 1HCTB 3N8MA 2AUGA 1BHHA 1F2FA 1NRVA 4A4BA 4F5AA 1NZVA 3VRNA 1BLKA 2HCKA 1A81A 1FU6A 3BUXB 2SHPA 1QCFA 1O42A 3OVEA 4U17A 1KA6A 4K11A 1SHBA 1A1AA 2DVJA 2LNWA 1SPRA 2FCIA 1AYBA 1KSWA 1O43A 1WQUA 1Y57A 2L6KA 2ETZA 1OPLA 1H9OA 1O46A 1AYDA 4OHEA 4U1PA 3VS3A 3PJPA 3K2MA 2IUGA 2QMSA 2PNBA 2OZOA 2AOAA 5EG3B 4NWFA 4JGHA 3CBLA 4H1OA 1O4IA 1OO4A 1MILA 2ABLA 4K2RA 2PNAA 1CWDL 2EYYA 2BBUA 2HUWA 3S8NA 1M27A 2RSYA 2PTKA 4FL2A 2Y1MA 4LUEA 5KAZA 2Y1NA 3UYOA 1LKKA 1O4AA 5EEQA 3OB2B 3S9KA 1GRIA 3PSKA 2CS0A 3BUOB 5AXIA 2H8HA 2ECDA 2C9WA 3CXLA 1B47A 5D0JA 1QG1E 4E68A 1UUSA 2MRKA 3VS7A 1JYUA 2IUIA 1BM2A 4L1BB 1X27A 1FBVA 2CBLA 3EAZA 1O47A 3HHMB 3TKZA 1JYRA 3PFVA 1O4BA 1A1BA 1D1ZA 2YU7A 1AOUF 3WA4A 1K9AA 4XZ1A 2EKXA 1O4RA 2LCTA 2GSBA 5IBMA 1RPYA 1OO3A 1A1EA 2K79B 1O4OA 5HKWA 2LQWA 1R1PA 5DC0B 3ZNIA 2EO6A 4JEGA 3VRQA 5I6VA 3IN8A 2HDVA 1O45A 2MC1A 3OV1A 3VROA 1PICA 3BUNB 1YVHA 1O4GA 2B3OA 2CR4A 2CI8A 2IUHA 2Y3AB 1BMBA 1CJ1A 2AOBA 3QWYA 3S8OA 2DM0A 4E93A 1GHUA 3TL0A 1HCSB 1BFJA 4M4ZA 4P9VA 3CD3A 2EYZA 2K7AB 5GJHA 2EL8A 3VGOA 1O4DA 1RJAA 5HKYA 2EOBA 3VS6A 1O4FA 1QADA 2VIFA 1I3ZA 1KA7A 4TZIA 4GWFA 2KNOA 4K44A 4DGXA 1BHFA 1BKLA 1NZLA 1LUNA 1D4WA 5BO4A 1R1SA 1JYQA 3VS5A 1AYCA 1LUMA 5CDWA 1AB2A 1F1WA 5HKZA 1OPKA 5IBSA 1FHSA 1BLJA 3MAZA 1YVLA 4QSYA 2MQIA 2PLEA 1R1QA 3M7FA 3VRRA 2EYVA 2CI9A 1RQQC 1O4KA 1BFIA 2EO3A 5DC9A 3T04A 2PLDA 2C0OA 4EIHA 1P13A 1O4JA 3OB1B 3N7YA 3VRZA 3S8LA 1O4MA 3QWXX 1A1CA 1FU5A 1O44A 2DLYA 2MK2A 2L3TA 5EHRA 3MXCA 1CWEA 3PS5A 4OHIA 2LNXA 3KFJA 3N84A 2YSXA 1LCJA 3VS1A 1AOTF 4GL9E 2SRCA 1AD5A 4JE4A 2H46E 5EHPA 1IJRA 1AYAA 1SKJA 4H34A 3GXWA 1FBZA 1BF5A 3GXXA 3IMJA 4EY0A 1LKLA 4GPLB 1TZEE 3CWGA 1CSZA 1SPSA 3PSJA 2C0IA 1FMKA 2XP1A 3C7IA 4NWGA 2HMHA 1O4NA 5GJIA 1A09A 4XZ0A 4DGPA 4K45A 4OHHA 2LQNA 2MRJA 1M61A 1O4PA 1TCEA 2CRHA 2JYQA 5EELA 1D4TA 2GE9A 5DC4A 1MW4A 1O41A 1XA6A 4OHLA 5J3XA 1O4QA 1FYRA 1LUIA 1Z3KA 1BKMA 4P9ZA 5AULA 1A08A 2DCRA 3EACA 4WWQA 3IMDA 1BHHB 2HDXA 2RORA 1G83A 2FO0A 3PLFB 1X0NA 3VS4A 2CIAA 5DF6A 2C0TA 3NHNA 1O49A 4D8KA 1JWOA 3PQZA 2DLZA 2L4KA 4ROJA 1CSYA 3OP0A 4A4CA 4FBNA 3HCKA 2H5KA 4F59A 1KC2A 2RVFA 3BUWB 1BG1A 2IZVA 1SHDA 1IS0A 1A07A 1O4EA 1ZFPE 2DX0A 2KK6A 3VS0A 1O48A 3VRYA 2OQ1A 4OHDA 4F5BA 3IN7A 3VRPA 2EU0A 3GQIB 1O4LA 1SHAA 3HIZB 3VS2A 1JU5A 1O4CA 3BKBA 1Y1UA 1UURA 1O4HA 1LCKA 4FL3A 4LUDA
chains in the Genus database with same CATH superfamily
3US4A 3BUMB 3MXYA 1LUKA 2RMXA 1X6CA 3UF4A 4X6SA 1HCTB 3N8MA 2AUGA 1BHHA 1F2FA 1NRVA 4A4BA 4F5AA 1NZVA 3VRNA 1BLKA 2HCKA 1A81A 1FU6A 3BUXB 2SHPA 1QCFA 1O42A 3OVEA 4U17A 1KA6A 4K11A 1SHBA 1A1AA 2DVJA 2LNWA 1SPRA 2FCIA 1AYBA 1KSWA 1O43A 1WQUA 1Y57A 2L6KA 2ETZA 1OPLA 1H9OA 1O46A 1AYDA 4OHEA 4U1PA 3VS3A 3PJPA 3K2MA 2IUGA 2QMSA 2PNBA 2OZOA 2AOAA 5EG3B 4NWFA 4JGHA 3CBLA 4H1OA 1O4IA 1OO4A 1MILA 2ABLA 4K2RA 2PNAA 1CWDL 2EYYA 2BBUA 2HUWA 3S8NA 1M27A 2RSYA 2PTKA 4FL2A 2Y1MA 4LUEA 5KAZA 2Y1NA 3UYOA 1LKKA 1O4AA 5EEQA 3OB2B 3S9KA 1GRIA 3PSKA 2CS0A 3BUOB 5AXIA 2H8HA 2ECDA 2C9WA 3CXLA 1B47A 5D0JA 1QG1E 2KGYA 4E68A 1UUSA 2MRKA 3VS7A 1JYUA 2IUIA 1BM2A 4L1BB 1X27A 1FBVA 2CBLA 3EAZA 1O47A 3HHMB 3LYVA 3TKZA 1JYRA 3PFVA 1O4BA 1A1BA 1D1ZA 2YU7A 1AOUF 3WA4A 1K9AA 4XZ1A 2EKXA 1O4RA 2LCTA 2GSBA 5IBMA 1RPYA 1OO3A 1A1EA 2K79B 1O4OA 5HKWA 2LQWA 1R1PA 5DC0B 3ZNIA 2EO6A 4JEGA 3VRQA 5I6VA 3IN8A 2HDVA 1O45A 2MC1A 3OV1A 3VROA 1PICA 3BUNB 1YVHA 1O4GA 2B3OA 2CR4A 2CI8A 2IUHA 2Y3AB 1BMBA 1CJ1A 2AOBA 3QWYA 3S8OA 2DM0A 4E93A 1GHUA 3TL0A 1HCSB 1BFJA 4M4ZA 4P9VA 3CD3A 2EYZA 2K7AB 5GJHA 2EL8A 3VGOA 1O4DA 1RJAA 5HKYA 2EOBA 3VS6A 1O4FA 1QADA 2VIFA 1I3ZA 1KA7A 4TZIA 4GWFA 2KNOA 4K44A 4DGXA 1BHFA 1BKLA 1NZLA 1LUNA 1D4WA 5BO4A 1R1SA 1JYQA 3VS5A 1AYCA 1LUMA 5CDWA 1AB2A 1F1WA 5HKZA 1OPKA 5IBSA 1FHSA 1BLJA 3MAZA 1YVLA 4QSYA 2MQIA 2PLEA 1R1QA 3M7FA 3VRRA 2EYVA 2CI9A 1RQQC 1O4KA 3K2TA 1BFIA 2EO3A 5DC9A 3T04A 2PLDA 2C0OA 4EIHA 1P13A 1O4JA 3OB1B 3N7YA 3VRZA 3S8LA 1O4MA 3QWXX 1A1CA 1FU5A 1O44A 2DLYA 2MK2A 2L3TA 5EHRA 3MXCA 1CWEA 3PS5A 4OHIA 2LNXA 3KFJA 3N84A 2YSXA 1LCJA 3VS1A 1AOTF 4GL9E 2SRCA 1AD5A 4JE4A 2H46E 5EHPA 1IJRA 1AYAA 1SKJA 4H34A 3GXWA 1FBZA 1BF5A 3GXXA 3IMJA 4EY0A 1LKLA 4GPLB 1TZEE 3CWGA 1CSZA 1SPSA 3PSJA 2C0IA 1FMKA 2XP1A 3C7IA 4NWGA 2HMHA 1O4NA 5GJIA 1A09A 4XZ0A 4DGPA 4K45A 4OHHA 2LQNA 2MRJA 1M61A 1O4PA 1TCEA 2CRHA 2JYQA 5EELA 1D4TA 2GE9A 1MW4A 4OHLA 1O41A 1XA6A 5DC4A 5J3XA 1O4QA 1FYRA 1LUIA 1Z3KA 1BKMA 4P9ZA 5AULA 1A08A 2DCRA 3EACA 4WWQA 3IMDA 1BHHB 2HDXA 2RORA 1G83A 2FO0A 3PLFB 1X0NA 3VS4A 2CIAA 5DF6A 2C0TA 3NHNA 1O49A 4D8KA 1JWOA 3PQZA 2DLZA 2L4KA 4ROJA 1CSYA 3OP0A 4A4CA 4FBNA 3HCKA 2H5KA 4F59A 1KC2A 2RVFA 3BUWB 1BG1A 2IZVA 1SHDA 1IS0A 1A07A 1O4EA 1ZFPE 2DX0A 2KK6A 3VS0A 1O48A 3VRYA 2OQ1A 4OHDA 4F5BA 3IN7A 3VRPA 2EU0A 3GQIB 1O4LA 1SHAA 3HIZB 3VS2A 1JU5A 1O4CA 3BKBA 1Y1UA 2LRAA 1UURA 1O4HA 1LCKA 4FL3A 4LUDA
chains in the Genus database with same CATH topology
3US4A 3BUMB 3MXYA 1LUKA 2RMXA 1X6CA 3UF4A 4X6SA 1HCTB 3N8MA 2AUGA 1BHHA 1F2FA 1NRVA 4A4BA 4F5AA 1NZVA 3VRNA 1BLKA 2HCKA 1A81A 1FU6A 3BUXB 2SHPA 1QCFA 1O42A 3OVEA 4U17A 1KA6A 4K11A 1SHBA 1A1AA 2DVJA 2LNWA 1SPRA 2FCIA 1AYBA 1KSWA 1O43A 1WQUA 1Y57A 2L6KA 2ETZA 1OPLA 1H9OA 1O46A 1AYDA 4OHEA 4U1PA 3VS3A 3PJPA 3K2MA 2IUGA 2QMSA 2PNBA 2OZOA 2AOAA 5EG3B 4NWFA 4JGHA 3CBLA 4H1OA 1O4IA 1OO4A 1MILA 2ABLA 4K2RA 2PNAA 1CWDL 2EYYA 2BBUA 2HUWA 3S8NA 1M27A 2RSYA 2PTKA 4FL2A 2Y1MA 4LUEA 5KAZA 2Y1NA 3UYOA 1LKKA 1O4AA 5EEQA 3OB2B 3S9KA 1GRIA 3PSKA 2CS0A 3BUOB 5AXIA 2H8HA 2ECDA 2C9WA 3CXLA 1B47A 5D0JA 1QG1E 4E68A 1UUSA 2MRKA 3VS7A 1JYUA 2IUIA 1BM2A 4L1BB 1X27A 1FBVA 2CBLA 3EAZA 1O47A 3HHMB 3TKZA 1JYRA 3PFVA 1O4BA 1A1BA 1D1ZA 2YU7A 1AOUF 3WA4A 1K9AA 4XZ1A 2EKXA 1O4RA 2LCTA 2GSBA 5IBMA 1RPYA 1OO3A 1A1EA 2K79B 1O4OA 5HKWA 2LQWA 1R1PA 5DC0B 3ZNIA 2EO6A 4JEGA 3VRQA 5I6VA 3IN8A 2HDVA 1O45A 2MC1A 3OV1A 3VROA 1PICA 3BUNB 1YVHA 1O4GA 2B3OA 2CR4A 2CI8A 2IUHA 2Y3AB 1BMBA 1CJ1A 2AOBA 3QWYA 3S8OA 2DM0A 4E93A 1GHUA 3TL0A 1HCSB 1BFJA 4M4ZA 4P9VA 3CD3A 2EYZA 2K7AB 5GJHA 2EL8A 3VGOA 1O4DA 1RJAA 5HKYA 2EOBA 3VS6A 1O4FA 1QADA 2VIFA 1I3ZA 1KA7A 4TZIA 4GWFA 2KNOA 4K44A 4DGXA 1BHFA 1BKLA 1NZLA 1LUNA 1D4WA 5BO4A 1R1SA 1JYQA 3VS5A 1AYCA 1LUMA 5CDWA 1AB2A 1F1WA 5HKZA 1OPKA 5IBSA 1FHSA 1BLJA 3MAZA 1YVLA 4QSYA 2MQIA 2PLEA 1R1QA 3M7FA 3VRRA 2EYVA 2CI9A 1RQQC 1O4KA 1BFIA 2EO3A 5DC9A 3T04A 2PLDA 2C0OA 4EIHA 1P13A 1O4JA 3OB1B 3N7YA 3VRZA 3S8LA 1O4MA 3QWXX 1A1CA 1FU5A 1O44A 2DLYA 2MK2A 2L3TA 5EHRA 3MXCA 1CWEA 3PS5A 4OHIA 2LNXA 3KFJA 3N84A 2YSXA 1LCJA 3VS1A 1AOTF 4GL9E 2SRCA 1AD5A 4JE4A 2H46E 5EHPA 1IJRA 1AYAA 1SKJA 4H34A 3GXWA 1FBZA 1BF5A 3GXXA 3IMJA 4EY0A 1LKLA 4GPLB 1TZEE 3CWGA 1CSZA 1SPSA 3PSJA 2C0IA 1FMKA 2XP1A 3C7IA 4NWGA 2HMHA 1O4NA 5GJIA 1A09A 4XZ0A 4DGPA 4K45A 4OHHA 2LQNA 2MRJA 1M61A 1O4PA 1TCEA 2CRHA 2JYQA 5EELA 1D4TA 2GE9A 5DC4A 1MW4A 1O41A 1XA6A 4OHLA 5J3XA 1O4QA 1FYRA 1LUIA 1Z3KA 1BKMA 4P9ZA 5AULA 1A08A 2DCRA 3EACA 4WWQA 3IMDA 1BHHB 2HDXA 2RORA 1G83A 2FO0A 3PLFB 1X0NA 3VS4A 2CIAA 5DF6A 2C0TA 3NHNA 1O49A 4D8KA 1JWOA 3PQZA 2DLZA 2L4KA 4ROJA 1CSYA 3OP0A 4A4CA 4FBNA 3HCKA 2H5KA 4F59A 1KC2A 2RVFA 3BUWB 1BG1A 2IZVA 1SHDA 1IS0A 1A07A 1O4EA 1ZFPE 2DX0A 2KK6A 3VS0A 1O48A 3VRYA 2OQ1A 4OHDA 4F5BA 3IN7A 3VRPA 2EU0A 3GQIB 1O4LA 1SHAA 3HIZB 3VS2A 1JU5A 1O4CA 3BKBA 1Y1UA 1UURA 1O4HA 1LCKA 4FL3A 4LUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3US4 A;  3BUM B;  3MXY A;  1LUK A;  2RMX A;  1X6C A;  3UF4 A;  4X6S A;  1HCT B;  3N8M A;  2AUG A;  1BHH A;  1F2F A;  1NRV A;  4A4B A;  4F5A A;  1NZV A;  3VRN A;  1BLK A;  2HCK A;  1A81 A;  1FU6 A;  3BUX B;  2SHP A;  1QCF A;  1O42 A;  3OVE A;  4U17 A;  1KA6 A;  4K11 A;  1SHB A;  1A1A A;  2DVJ A;  2LNW A;  1SPR A;  2FCI A;  1AYB A;  1KSW A;  1O43 A;  1WQU A;  1Y57 A;  2L6K A;  2ETZ A;  1OPL A;  1H9O A;  1O46 A;  1AYD A;  4OHE A;  4U1P A;  3VS3 A;  3PJP A;  3K2M A;  2IUG A;  2QMS A;  2PNB A;  2OZO A;  2AOA A;  5EG3 B;  4NWF A;  4JGH A;  3CBL A;  4H1O A;  1O4I A;  1OO4 A;  1MIL A;  2ABL A;  4K2R A;  2PNA A;  1CWD L;  2EYY A;  2BBU A;  2HUW A;  3S8N A;  1M27 A;  2RSY A;  2PTK A;  4FL2 A;  2Y1M A;  4LUE A;  5KAZ A;  2Y1N A;  3UYO A;  1LKK A;  1O4A A;  5EEQ A;  3OB2 B;  3S9K A;  1GRI A;  3PSK A;  2CS0 A;  3BUO B;  5AXI A;  2H8H A;  2ECD A;  2C9W A;  3CXL A;  1B47 A;  5D0J A;  1QG1 E;  4E68 A;  1UUS A;  2MRK A;  3VS7 A;  1JYU A;  2IUI A;  1BM2 A;  4L1B B;  1X27 A;  1FBV A;  2CBL A;  3EAZ A;  1O47 A;  3HHM B;  3TKZ A;  1JYR A;  3PFV A;  1O4B A;  1A1B A;  1D1Z A;  2YU7 A;  1AOU F;  3WA4 A;  1K9A A;  4XZ1 A;  2EKX A;  1O4R A;  2LCT A;  2GSB A;  5IBM A;  1RPY A;  1OO3 A;  1A1E A;  2K79 B;  1O4O A;  5HKW A;  2LQW A;  1R1P A;  5DC0 B;  3ZNI A;  2EO6 A;  4JEG A;  3VRQ A;  5I6V A;  3IN8 A;  2HDV A;  1O45 A;  2MC1 A;  3OV1 A;  3VRO A;  1PIC A;  3BUN B;  1YVH A;  1O4G A;  2B3O A;  2CR4 A;  2CI8 A;  2IUH A;  2Y3A B;  1BMB A;  1CJ1 A;  2AOB A;  3QWY A;  3S8O A;  2DM0 A;  4E93 A;  1GHU A;  3TL0 A;  1HCS B;  1BFJ A;  4M4Z A;  4P9V A;  3CD3 A;  2EYZ A;  2K7A B;  5GJH A;  2EL8 A;  3VGO A;  1O4D A;  1RJA A;  5HKY A;  2EOB A;  3VS6 A;  1O4F A;  1QAD A;  2VIF A;  1I3Z A;  1KA7 A;  4TZI A;  4GWF A;  2KNO A;  4K44 A;  4DGX A;  1BHF A;  1BKL A;  1NZL A;  1LUN A;  1D4W A;  5BO4 A;  1R1S A;  1JYQ A;  3VS5 A;  1AYC A;  1LUM A;  5CDW A;  1AB2 A;  1F1W A;  5HKZ A;  1OPK A;  5IBS A;  1FHS A;  1BLJ A;  3MAZ A;  1YVL A;  4QSY A;  2MQI A;  2PLE A;  1R1Q A;  3M7F A;  3VRR A;  2EYV A;  2CI9 A;  1RQQ C;  1O4K A;  1BFI A;  2EO3 A;  5DC9 A;  3T04 A;  2PLD A;  2C0O A;  4EIH A;  1P13 A;  1O4J A;  3OB1 B;  3N7Y A;  3VRZ A;  3S8L A;  1O4M A;  3QWX X;  1A1C A;  1FU5 A;  1O44 A;  2DLY A;  2MK2 A;  2L3T A;  5EHR A;  3MXC A;  1CWE A;  3PS5 A;  4OHI A;  2LNX A;  3KFJ A;  3N84 A;  2YSX A;  1LCJ A;  3VS1 A;  1AOT F;  4GL9 E;  2SRC A;  1AD5 A;  4JE4 A;  2H46 E;  5EHP A;  1IJR A;  1AYA A;  1SKJ A;  4H34 A;  3GXW A;  1FBZ A;  1BF5 A;  3GXX A;  3IMJ A;  4EY0 A;  1LKL A;  4GPL B;  1TZE E;  3CWG A;  1CSZ A;  1SPS A;  3PSJ A;  2C0I A;  1FMK A;  2XP1 A;  3C7I A;  4NWG A;  2HMH A;  1O4N A;  5GJI A;  1A09 A;  4XZ0 A;  4DGP A;  4K45 A;  4OHH A;  2LQN A;  2MRJ A;  1M61 A;  1O4P A;  1TCE A;  2CRH A;  2JYQ A;  5EEL A;  1D4T A;  2GE9 A;  5DC4 A;  1MW4 A;  1O41 A;  1XA6 A;  4OHL A;  5J3X A;  1O4Q A;  1FYR A;  1LUI A;  1Z3K A;  1BKM A;  4P9Z A;  5AUL A;  1A08 A;  2DCR A;  3EAC A;  4WWQ A;  3IMD A;  1BHH B;  2HDX A;  2ROR A;  1G83 A;  2FO0 A;  3PLF B;  1X0N A;  3VS4 A;  2CIA A;  5DF6 A;  2C0T A;  3NHN A;  1O49 A;  4D8K A;  1JWO A;  3PQZ A;  2DLZ A;  2L4K A;  4ROJ A;  1CSY A;  3OP0 A;  4A4C A;  4FBN A;  3HCK A;  2H5K A;  4F59 A;  1KC2 A;  2RVF A;  3BUW B;  1BG1 A;  2IZV A;  1SHD A;  1IS0 A;  1A07 A;  1O4E A;  1ZFP E;  2DX0 A;  2KK6 A;  3VS0 A;  1O48 A;  3VRY A;  2OQ1 A;  4OHD A;  4F5B A;  3IN7 A;  3VRP A;  2EU0 A;  3GQI B;  1O4L A;  1SHA A;  3HIZ B;  3VS2 A;  1JU5 A;  1O4C A;  3BKB A;  1Y1U A;  1UUR A;  1O4H A;  1LCK A;  4FL3 A;  4LUD A; 
#chains in the Genus database with same CATH topology
 3US4 A;  3BUM B;  3MXY A;  1LUK A;  2RMX A;  1X6C A;  3UF4 A;  4X6S A;  1HCT B;  3N8M A;  2AUG A;  1BHH A;  1F2F A;  1NRV A;  4A4B A;  4F5A A;  1NZV A;  3VRN A;  1BLK A;  2HCK A;  1A81 A;  1FU6 A;  3BUX B;  2SHP A;  1QCF A;  1O42 A;  3OVE A;  4U17 A;  1KA6 A;  4K11 A;  1SHB A;  1A1A A;  2DVJ A;  2LNW A;  1SPR A;  2FCI A;  1AYB A;  1KSW A;  1O43 A;  1WQU A;  1Y57 A;  2L6K A;  2ETZ A;  1OPL A;  1H9O A;  1O46 A;  1AYD A;  4OHE A;  4U1P A;  3VS3 A;  3PJP A;  3K2M A;  2IUG A;  2QMS A;  2PNB A;  2OZO A;  2AOA A;  5EG3 B;  4NWF A;  4JGH A;  3CBL A;  4H1O A;  1O4I A;  1OO4 A;  1MIL A;  2ABL A;  4K2R A;  2PNA A;  1CWD L;  2EYY A;  2BBU A;  2HUW A;  3S8N A;  1M27 A;  2RSY A;  2PTK A;  4FL2 A;  2Y1M A;  4LUE A;  5KAZ A;  2Y1N A;  3UYO A;  1LKK A;  1O4A A;  5EEQ A;  3OB2 B;  3S9K A;  1GRI A;  3PSK A;  2CS0 A;  3BUO B;  5AXI A;  2H8H A;  2ECD A;  2C9W A;  3CXL A;  1B47 A;  5D0J A;  1QG1 E;  2KGY A;  4E68 A;  1UUS A;  2MRK A;  3VS7 A;  1JYU A;  2IUI A;  1BM2 A;  4L1B B;  1X27 A;  1FBV A;  2CBL A;  3EAZ A;  1O47 A;  3HHM B;  3LYV A;  3TKZ A;  1JYR A;  3PFV A;  1O4B A;  1A1B A;  1D1Z A;  2YU7 A;  1AOU F;  3WA4 A;  1K9A A;  4XZ1 A;  2EKX A;  1O4R A;  2LCT A;  2GSB A;  5IBM A;  1RPY A;  1OO3 A;  1A1E A;  2K79 B;  1O4O A;  5HKW A;  2LQW A;  1R1P A;  5DC0 B;  3ZNI A;  2EO6 A;  4JEG A;  3VRQ A;  5I6V A;  3IN8 A;  2HDV A;  1O45 A;  2MC1 A;  3OV1 A;  3VRO A;  1PIC A;  3BUN B;  1YVH A;  1O4G A;  2B3O A;  2CR4 A;  2CI8 A;  2IUH A;  2Y3A B;  1BMB A;  1CJ1 A;  2AOB A;  3QWY A;  3S8O A;  2DM0 A;  4E93 A;  1GHU A;  3TL0 A;  1HCS B;  1BFJ A;  4M4Z A;  4P9V A;  3CD3 A;  2EYZ A;  2K7A B;  5GJH A;  2EL8 A;  3VGO A;  1O4D A;  1RJA A;  5HKY A;  2EOB A;  3VS6 A;  1O4F A;  1QAD A;  2VIF A;  1I3Z A;  1KA7 A;  4TZI A;  4GWF A;  2KNO A;  4K44 A;  4DGX A;  1BHF A;  1BKL A;  1NZL A;  1LUN A;  1D4W A;  5BO4 A;  1R1S A;  1JYQ A;  3VS5 A;  1AYC A;  1LUM A;  5CDW A;  1AB2 A;  1F1W A;  5HKZ A;  1OPK A;  5IBS A;  1FHS A;  1BLJ A;  3MAZ A;  1YVL A;  4QSY A;  2MQI A;  2PLE A;  1R1Q A;  3M7F A;  3VRR A;  2EYV A;  2CI9 A;  1RQQ C;  1O4K A;  3K2T A;  1BFI A;  2EO3 A;  5DC9 A;  3T04 A;  2PLD A;  2C0O A;  4EIH A;  1P13 A;  1O4J A;  3OB1 B;  3N7Y A;  3VRZ A;  3S8L A;  1O4M A;  3QWX X;  1A1C A;  1FU5 A;  1O44 A;  2DLY A;  2MK2 A;  2L3T A;  5EHR A;  3MXC A;  1CWE A;  3PS5 A;  4OHI A;  2LNX A;  3KFJ A;  3N84 A;  2YSX A;  1LCJ A;  3VS1 A;  1AOT F;  4GL9 E;  2SRC A;  1AD5 A;  4JE4 A;  2H46 E;  5EHP A;  1IJR A;  1AYA A;  1SKJ A;  4H34 A;  3GXW A;  1FBZ A;  1BF5 A;  3GXX A;  3IMJ A;  4EY0 A;  1LKL A;  4GPL B;  1TZE E;  3CWG A;  1CSZ A;  1SPS A;  3PSJ A;  2C0I A;  1FMK A;  2XP1 A;  3C7I A;  4NWG A;  2HMH A;  1O4N A;  5GJI A;  1A09 A;  4XZ0 A;  4DGP A;  4K45 A;  4OHH A;  2LQN A;  2MRJ A;  1M61 A;  1O4P A;  1TCE A;  2CRH A;  2JYQ A;  5EEL A;  1D4T A;  2GE9 A;  1MW4 A;  4OHL A;  1O41 A;  1XA6 A;  5DC4 A;  5J3X A;  1O4Q A;  1FYR A;  1LUI A;  1Z3K A;  1BKM A;  4P9Z A;  5AUL A;  1A08 A;  2DCR A;  3EAC A;  4WWQ A;  3IMD A;  1BHH B;  2HDX A;  2ROR A;  1G83 A;  2FO0 A;  3PLF B;  1X0N A;  3VS4 A;  2CIA A;  5DF6 A;  2C0T A;  3NHN A;  1O49 A;  4D8K A;  1JWO A;  3PQZ A;  2DLZ A;  2L4K A;  4ROJ A;  1CSY A;  3OP0 A;  4A4C A;  4FBN A;  3HCK A;  2H5K A;  4F59 A;  1KC2 A;  2RVF A;  3BUW B;  1BG1 A;  2IZV A;  1SHD A;  1IS0 A;  1A07 A;  1O4E A;  1ZFP E;  2DX0 A;  2KK6 A;  3VS0 A;  1O48 A;  3VRY A;  2OQ1 A;  4OHD A;  4F5B A;  3IN7 A;  3VRP A;  2EU0 A;  3GQI B;  1O4L A;  1SHA A;  3HIZ B;  3VS2 A;  1JU5 A;  1O4C A;  3BKB A;  1Y1U A;  2LRA A;  1UUR A;  1O4H A;  1LCK A;  4FL3 A;  4LUD A; 
#chains in the Genus database with same CATH homology
 3US4 A;  3BUM B;  3MXY A;  1LUK A;  2RMX A;  1X6C A;  3UF4 A;  4X6S A;  1HCT B;  3N8M A;  2AUG A;  1BHH A;  1F2F A;  1NRV A;  4A4B A;  4F5A A;  1NZV A;  3VRN A;  1BLK A;  2HCK A;  1A81 A;  1FU6 A;  3BUX B;  2SHP A;  1QCF A;  1O42 A;  3OVE A;  4U17 A;  1KA6 A;  4K11 A;  1SHB A;  1A1A A;  2DVJ A;  2LNW A;  1SPR A;  2FCI A;  1AYB A;  1KSW A;  1O43 A;  1WQU A;  1Y57 A;  2L6K A;  2ETZ A;  1OPL A;  1H9O A;  1O46 A;  1AYD A;  4OHE A;  4U1P A;  3VS3 A;  3PJP A;  3K2M A;  2IUG A;  2QMS A;  2PNB A;  2OZO A;  2AOA A;  5EG3 B;  4NWF A;  4JGH A;  3CBL A;  4H1O A;  1O4I A;  1OO4 A;  1MIL A;  2ABL A;  4K2R A;  2PNA A;  1CWD L;  2EYY A;  2BBU A;  2HUW A;  3S8N A;  1M27 A;  2RSY A;  2PTK A;  4FL2 A;  2Y1M A;  4LUE A;  5KAZ A;  2Y1N A;  3UYO A;  1LKK A;  1O4A A;  5EEQ A;  3OB2 B;  3S9K A;  1GRI A;  3PSK A;  2CS0 A;  3BUO B;  5AXI A;  2H8H A;  2ECD A;  2C9W A;  3CXL A;  1B47 A;  5D0J A;  1QG1 E;  4E68 A;  1UUS A;  2MRK A;  3VS7 A;  1JYU A;  2IUI A;  1BM2 A;  4L1B B;  1X27 A;  1FBV A;  2CBL A;  3EAZ A;  1O47 A;  3HHM B;  3TKZ A;  1JYR A;  3PFV A;  1O4B A;  1A1B A;  1D1Z A;  2YU7 A;  1AOU F;  3WA4 A;  1K9A A;  4XZ1 A;  2EKX A;  1O4R A;  2LCT A;  2GSB A;  5IBM A;  1RPY A;  1OO3 A;  1A1E A;  2K79 B;  1O4O A;  5HKW A;  2LQW A;  1R1P A;  5DC0 B;  3ZNI A;  2EO6 A;  4JEG A;  3VRQ A;  5I6V A;  3IN8 A;  2HDV A;  1O45 A;  2MC1 A;  3OV1 A;  3VRO A;  1PIC A;  3BUN B;  1YVH A;  1O4G A;  2B3O A;  2CR4 A;  2CI8 A;  2IUH A;  2Y3A B;  1BMB A;  1CJ1 A;  2AOB A;  3QWY A;  3S8O A;  2DM0 A;  4E93 A;  1GHU A;  3TL0 A;  1HCS B;  1BFJ A;  4M4Z A;  4P9V A;  3CD3 A;  2EYZ A;  2K7A B;  5GJH A;  2EL8 A;  3VGO A;  1O4D A;  1RJA A;  5HKY A;  2EOB A;  3VS6 A;  1O4F A;  1QAD A;  2VIF A;  1I3Z A;  1KA7 A;  4TZI A;  4GWF A;  2KNO A;  4K44 A;  4DGX A;  1BHF A;  1BKL A;  1NZL A;  1LUN A;  1D4W A;  5BO4 A;  1R1S A;  1JYQ A;  3VS5 A;  1AYC A;  1LUM A;  5CDW A;  1AB2 A;  1F1W A;  5HKZ A;  1OPK A;  5IBS A;  1FHS A;  1BLJ A;  3MAZ A;  1YVL A;  4QSY A;  2MQI A;  2PLE A;  1R1Q A;  3M7F A;  3VRR A;  2EYV A;  2CI9 A;  1RQQ C;  1O4K A;  1BFI A;  2EO3 A;  5DC9 A;  3T04 A;  2PLD A;  2C0O A;  4EIH A;  1P13 A;  1O4J A;  3OB1 B;  3N7Y A;  3VRZ A;  3S8L A;  1O4M A;  3QWX X;  1A1C A;  1FU5 A;  1O44 A;  2DLY A;  2MK2 A;  2L3T A;  5EHR A;  3MXC A;  1CWE A;  3PS5 A;  4OHI A;  2LNX A;  3KFJ A;  3N84 A;  2YSX A;  1LCJ A;  3VS1 A;  1AOT F;  4GL9 E;  2SRC A;  1AD5 A;  4JE4 A;  2H46 E;  5EHP A;  1IJR A;  1AYA A;  1SKJ A;  4H34 A;  3GXW A;  1FBZ A;  1BF5 A;  3GXX A;  3IMJ A;  4EY0 A;  1LKL A;  4GPL B;  1TZE E;  3CWG A;  1CSZ A;  1SPS A;  3PSJ A;  2C0I A;  1FMK A;  2XP1 A;  3C7I A;  4NWG A;  2HMH A;  1O4N A;  5GJI A;  1A09 A;  4XZ0 A;  4DGP A;  4K45 A;  4OHH A;  2LQN A;  2MRJ A;  1M61 A;  1O4P A;  1TCE A;  2CRH A;  2JYQ A;  5EEL A;  1D4T A;  2GE9 A;  5DC4 A;  1MW4 A;  1O41 A;  1XA6 A;  4OHL A;  5J3X A;  1O4Q A;  1FYR A;  1LUI A;  1Z3K A;  1BKM A;  4P9Z A;  5AUL A;  1A08 A;  2DCR A;  3EAC A;  4WWQ A;  3IMD A;  1BHH B;  2HDX A;  2ROR A;  1G83 A;  2FO0 A;  3PLF B;  1X0N A;  3VS4 A;  2CIA A;  5DF6 A;  2C0T A;  3NHN A;  1O49 A;  4D8K A;  1JWO A;  3PQZ A;  2DLZ A;  2L4K A;  4ROJ A;  1CSY A;  3OP0 A;  4A4C A;  4FBN A;  3HCK A;  2H5K A;  4F59 A;  1KC2 A;  2RVF A;  3BUW B;  1BG1 A;  2IZV A;  1SHD A;  1IS0 A;  1A07 A;  1O4E A;  1ZFP E;  2DX0 A;  2KK6 A;  3VS0 A;  1O48 A;  3VRY A;  2OQ1 A;  4OHD A;  4F5B A;  3IN7 A;  3VRP A;  2EU0 A;  3GQI B;  1O4L A;  1SHA A;  3HIZ B;  3VS2 A;  1JU5 A;  1O4C A;  3BKB A;  1Y1U A;  1UUR A;  1O4H A;  1LCK A;  4FL3 A;  4LUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...