1JWOA

Crystal structure analysis of the sh2 domain of the csk homologous kinase chk
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
97
structure length
97
Chain Sequence
LSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of the HER-2/neu Receptor by the SH2 Domain of the Csk Homologous Kinase
rcsb
molecule keywords Csk Homologous Kinase
molecule tags Transferase
source organism Homo sapiens
total genus 18
structure length 97
sequence length 97
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1jwoA00
2LNWA 3VRQA 5EELA 1P13A 1CWDL 2LCTA 4LUDA 1O4QA 4A4CA 1O4MA 3TL0A 3S9KA 5KAZA 3S8OA 1JWOA 1Y1UA 2EYYA 1H9OA 4K45A 1GRIA 3NHNA 3VS4A 1LUIA 2EO3A 1O49A 2KNOA 3PLFB 1AYAA 1A08A 4LUEA 4NWGA 1BM2A 1AB2A 1FHSA 2K79B 2SHPA 2L6KA 1O43A 3S8NA 1SHAA 2HCKA 3GXXA 2HMHA 3GXWA 2CI9A 3TKZA 5GJHA 2DM0A 3N7YA 1UURA 1OO3A 5DC4A 3OB1B 1A09A 1BG1A 1O4DA 1JYQA 2ETZA 1O4IA 3OB2B 4A4BA 3PQZA 3S8LA 3VS2A 2PNBA 3HCKA 2EO6A 1FU6A 4OHHA 1O42A 1ZFPE 3VS5A 2AUGA 2MQIA 4D8KA 4EY0A 4GPLB 3VS3A 1MILA 2CI8A 1A1CA 2EYVA 2DLZA 3ZNIA 2DX0A 1KC2A 1BFJA 3IN7A 2EKXA 2MK2A 1Z3KA 1O4RA 1RJAA 4L1BB 5EHRA 1O45A 2LQNA 4K11A 3VRRA 2IZVA 3PJPA 1A1BA 3C7IA 2EOBA 3VS6A 2BBUA 2L3TA 1LUMA 1O4AA 5AULA 1CSYA 1SKJA 4EIHA 4FBNA 5HKYA 1O4JA 1B47A 1FMKA 1SHDA 4FL2A 2EL8A 3VS1A 1O4LA 4JEGA 1AOUF 2Y1MA 1LCJA 2AOBA 3OVEA 2C9WA 2MRJA 1BHFA 2C0OA 3T04A 4DGPA 2CR4A 3QWYA 2AOAA 1O4EA 2ABLA 5CDWA 1JYUA 2RVFA 1FBVA 3BUMB 1BKLA 1O4GA 2PLDA 1SPSA 4OHDA 5IBSA 2CIAA 1QADA 4GL9E 1O4NA 3VRZA 4WWQA 3K2MA 2IUHA 1R1PA 4M4ZA 4ROJA 3BUOB 4FL3A 1O4KA 1O4FA 4XZ0A 3VRPA 1RPYA 1AOTF 1O41A 2GE9A 5IBMA 1Y57A 2JYQA 2PNAA 1D4WA 3N84A 1IS0A 1I3ZA 5DC0B 4K44A 3WA4A 1XA6A 1BFIA 1CSZA 1FYRA 1HCTB 1RQQC 3VGOA 1X27A 2YU7A 2PTKA 1WQUA 1O47A 1CWEA 1O4OA 1AYCA 1LCKA 3IMDA 1SPRA 2K7AB 3N8MA 2IUGA 2VIFA 3KFJA 1KSWA 4F5BA 2MC1A 5DF6A 5I6VA 1AYDA 2H46E 1D1ZA 2CRHA 1AD5A 1X6CA 3CBLA 2RSYA 2MRKA 2C0TA 1O4BA 1QCFA 5GJIA 1BLJA 2L4KA 1CJ1A 3BUXB 1R1QA 2ECDA 2DVJA 1OO4A 4P9VA 1NZLA 3BUNB 2Y1NA 2CS0A 1LKLA 4XZ1A 3VRNA 1LUKA 4F5AA 3PS5A 1K9AA 1X0NA 5EHPA 3QWXX 4DGXA 3PFVA 4OHIA 1BHHA 3BUWB 1GHUA 4U17A 1O4CA 1F1WA 1O44A 1UUSA 1JU5A 3VRYA 2HDXA 3OV1A 4U1PA 4GWFA 4X6SA 1FU5A 1A07A 2OQ1A 4F59A 1BMBA 2QMSA 1O4PA 2FO0A 2FCIA 1M61A 2Y3AB 5D0JA 2B3OA 3HHMB 1BHHB 3GQIB 1A1AA 1TZEE 2HDVA 5AXIA 1F2FA 5BO4A 4JGHA 2RMXA 2EYZA 4H34A 4QSYA 1O4HA 1NRVA 4NWFA 1PICA 1MW4A 1OPKA 2LQWA 1AYBA 3VS0A 3IN8A 3UF4A 3MXYA 2H5KA 4OHLA 1KA7A 3EAZA 2C0IA 5EEQA 2DCRA 2KK6A 1IJRA 2OZOA 2HUWA 2XP1A 4H1OA 1JYRA 1A1EA 3PSJA 5J3XA 2RORA 2CBLA 1KA6A 3CXLA 1SHBA 1O48A 2SRCA 3MXCA 4OHEA 1NZVA 3HIZB 3PSKA 1HCSB 1LKKA 1TCEA 4E93A 2LNXA 3US4A 4TZIA 3IMJA 1A81A 5EG3B 2H8HA 1YVLA 1BKMA 1YVHA 1G83A 1M27A 3MAZA 1R1SA 3VS7A 1LUNA 2IUIA 2YSXA 5HKWA 1FBZA 3EACA 3BKBA 4P9ZA 5HKZA 2GSBA 3OP0A 1D4TA 2PLEA 5DC9A 1BLKA 3VROA 3CD3A 1BF5A 2DLYA 1O46A 1OPLA 4K2RA 4JE4A 2EU0A 3CWGA 1QG1E 3UYOA 4E68A 3M7FA
chains in the Genus database with same CATH superfamily
2LNWA 3VRQA 5EELA 1P13A 1CWDL 2LCTA 4LUDA 1O4QA 4A4CA 1O4MA 3TL0A 3S9KA 5KAZA 3S8OA 2LRAA 1JWOA 1Y1UA 2EYYA 1H9OA 4K45A 1GRIA 3NHNA 3VS4A 1LUIA 2EO3A 1O49A 2KNOA 3PLFB 1AYAA 1A08A 4LUEA 4NWGA 1BM2A 1AB2A 1FHSA 2K79B 2SHPA 2L6KA 1O43A 3S8NA 1SHAA 2HCKA 3GXXA 2HMHA 3GXWA 2CI9A 3TKZA 5GJHA 2DM0A 3N7YA 1UURA 3K2TA 1OO3A 5DC4A 3OB1B 1A09A 1BG1A 1O4DA 1JYQA 2ETZA 1O4IA 3OB2B 4A4BA 3PQZA 3S8LA 3VS2A 2PNBA 3HCKA 2EO6A 1FU6A 4OHHA 1O42A 1ZFPE 3VS5A 2AUGA 2MQIA 4D8KA 4EY0A 4GPLB 3VS3A 1MILA 2CI8A 1A1CA 2EYVA 2DLZA 3ZNIA 2DX0A 1KC2A 1BFJA 3IN7A 2EKXA 2MK2A 1Z3KA 1O4RA 1RJAA 4L1BB 5EHRA 1O45A 2LQNA 4K11A 3VRRA 2IZVA 3PJPA 1A1BA 3C7IA 2EOBA 3VS6A 2BBUA 2L3TA 1LUMA 1O4AA 5AULA 1CSYA 1SKJA 4EIHA 4FBNA 5HKYA 1O4JA 1B47A 1FMKA 1SHDA 4FL2A 2EL8A 3VS1A 1O4LA 4JEGA 1AOUF 2Y1MA 1LCJA 2AOBA 3OVEA 2C9WA 2MRJA 1BHFA 2C0OA 3T04A 4DGPA 2CR4A 3QWYA 2AOAA 1O4EA 2ABLA 5CDWA 1JYUA 2RVFA 1FBVA 3BUMB 1BKLA 1O4GA 2PLDA 1SPSA 4OHDA 5IBSA 2CIAA 1QADA 4GL9E 1O4NA 3VRZA 4WWQA 3K2MA 2IUHA 1R1PA 4M4ZA 4ROJA 3BUOB 4FL3A 1O4KA 1O4FA 4XZ0A 3VRPA 1RPYA 1AOTF 1O41A 2GE9A 5IBMA 1Y57A 2JYQA 2PNAA 1D4WA 3N84A 1IS0A 1I3ZA 5DC0B 4K44A 3WA4A 1XA6A 1BFIA 1CSZA 1FYRA 1HCTB 1RQQC 3VGOA 1X27A 2YU7A 2PTKA 1WQUA 1O47A 1CWEA 1O4OA 1AYCA 1LCKA 3IMDA 1SPRA 2K7AB 3N8MA 2IUGA 2VIFA 3KFJA 1KSWA 4F5BA 2MC1A 5DF6A 5I6VA 1AYDA 2H46E 1D1ZA 2CRHA 1AD5A 1X6CA 3CBLA 2RSYA 2MRKA 2C0TA 1O4BA 1QCFA 5GJIA 1BLJA 2L4KA 1CJ1A 3BUXB 1R1QA 2ECDA 2DVJA 1OO4A 4P9VA 1NZLA 3BUNB 2Y1NA 2CS0A 1LKLA 4XZ1A 3VRNA 1LUKA 4F5AA 3PS5A 1K9AA 1X0NA 5EHPA 3QWXX 3LYVA 4DGXA 3PFVA 4OHIA 1BHHA 3BUWB 1GHUA 4U17A 1O4CA 1F1WA 1O44A 1UUSA 1JU5A 3VRYA 2HDXA 3OV1A 4U1PA 4GWFA 4X6SA 1FU5A 1A07A 2OQ1A 4F59A 1BMBA 2QMSA 1O4PA 2FO0A 2FCIA 1M61A 2Y3AB 5D0JA 2B3OA 3HHMB 1BHHB 3GQIB 1A1AA 1TZEE 2HDVA 5AXIA 1F2FA 5BO4A 4JGHA 2RMXA 2EYZA 4H34A 4QSYA 1O4HA 1NRVA 4NWFA 1PICA 1MW4A 1OPKA 2LQWA 1AYBA 3VS0A 3IN8A 3UF4A 3MXYA 2H5KA 4OHLA 1KA7A 3EAZA 2C0IA 5EEQA 2DCRA 2KK6A 1IJRA 2OZOA 2HUWA 2XP1A 4H1OA 1JYRA 1A1EA 3PSJA 5J3XA 2RORA 2CBLA 1KA6A 3CXLA 1SHBA 1O48A 2SRCA 3MXCA 4OHEA 1NZVA 3HIZB 3PSKA 1HCSB 1LKKA 1TCEA 4E93A 2LNXA 3US4A 4TZIA 3IMJA 1A81A 5EG3B 2H8HA 1YVLA 1BKMA 1YVHA 1G83A 1M27A 3MAZA 1R1SA 3VS7A 1LUNA 2IUIA 2KGYA 2YSXA 5HKWA 1FBZA 3EACA 3BKBA 4P9ZA 5HKZA 2GSBA 3OP0A 1D4TA 2PLEA 5DC9A 1BLKA 3VROA 3CD3A 1BF5A 2DLYA 1O46A 1OPLA 4K2RA 4JE4A 2EU0A 3CWGA 1QG1E 3UYOA 4E68A 3M7FA
chains in the Genus database with same CATH topology
2LNWA 3VRQA 5EELA 1P13A 1CWDL 2LCTA 4LUDA 1O4QA 4A4CA 1O4MA 3TL0A 3S9KA 5KAZA 3S8OA 1JWOA 1Y1UA 2EYYA 1H9OA 4K45A 1GRIA 3NHNA 3VS4A 1LUIA 2EO3A 1O49A 2KNOA 3PLFB 1AYAA 1A08A 4LUEA 4NWGA 1BM2A 1AB2A 1FHSA 2K79B 2SHPA 2L6KA 1O43A 3S8NA 1SHAA 2HCKA 3GXXA 2HMHA 3GXWA 2CI9A 3TKZA 5GJHA 2DM0A 3N7YA 1UURA 1OO3A 5DC4A 3OB1B 1A09A 1BG1A 1O4DA 1JYQA 2ETZA 1O4IA 3OB2B 4A4BA 3PQZA 3S8LA 3VS2A 2PNBA 3HCKA 2EO6A 1FU6A 4OHHA 1O42A 1ZFPE 3VS5A 2AUGA 2MQIA 4D8KA 4EY0A 4GPLB 3VS3A 1MILA 2CI8A 1A1CA 2EYVA 2DLZA 3ZNIA 2DX0A 1KC2A 1BFJA 3IN7A 2EKXA 2MK2A 1Z3KA 1O4RA 1RJAA 4L1BB 5EHRA 1O45A 2LQNA 4K11A 3VRRA 2IZVA 3PJPA 1A1BA 3C7IA 2EOBA 3VS6A 2BBUA 2L3TA 1LUMA 1O4AA 5AULA 1CSYA 1SKJA 4EIHA 4FBNA 5HKYA 1O4JA 1B47A 1FMKA 1SHDA 4FL2A 2EL8A 3VS1A 1O4LA 4JEGA 1AOUF 2Y1MA 1LCJA 2AOBA 3OVEA 2C9WA 2MRJA 1BHFA 2C0OA 3T04A 4DGPA 2CR4A 3QWYA 2AOAA 1O4EA 2ABLA 5CDWA 1JYUA 2RVFA 1FBVA 3BUMB 1BKLA 1O4GA 2PLDA 1SPSA 4OHDA 5IBSA 2CIAA 1QADA 4GL9E 1O4NA 3VRZA 4WWQA 3K2MA 2IUHA 1R1PA 4M4ZA 4ROJA 3BUOB 4FL3A 1O4KA 1O4FA 4XZ0A 3VRPA 1RPYA 1AOTF 1O41A 2GE9A 5IBMA 1Y57A 2JYQA 2PNAA 1D4WA 3N84A 1IS0A 1I3ZA 5DC0B 4K44A 3WA4A 1XA6A 1BFIA 1CSZA 1FYRA 1HCTB 1RQQC 3VGOA 1X27A 2YU7A 2PTKA 1WQUA 1O47A 1CWEA 1O4OA 1AYCA 1LCKA 3IMDA 1SPRA 2K7AB 3N8MA 2IUGA 2VIFA 3KFJA 1KSWA 4F5BA 2MC1A 5DF6A 5I6VA 1AYDA 2H46E 1D1ZA 2CRHA 1AD5A 1X6CA 3CBLA 2RSYA 2MRKA 2C0TA 1O4BA 1QCFA 5GJIA 1BLJA 2L4KA 1CJ1A 3BUXB 1R1QA 2ECDA 2DVJA 1OO4A 4P9VA 1NZLA 3BUNB 2Y1NA 2CS0A 1LKLA 4XZ1A 3VRNA 1LUKA 4F5AA 3PS5A 1K9AA 1X0NA 5EHPA 3QWXX 4DGXA 3PFVA 4OHIA 1BHHA 3BUWB 1GHUA 4U17A 1O4CA 1F1WA 1O44A 1UUSA 1JU5A 3VRYA 2HDXA 3OV1A 4U1PA 4GWFA 4X6SA 1FU5A 1A07A 2OQ1A 4F59A 1BMBA 2QMSA 1O4PA 2FO0A 2FCIA 1M61A 2Y3AB 5D0JA 2B3OA 3HHMB 1BHHB 3GQIB 1A1AA 1TZEE 2HDVA 5AXIA 1F2FA 5BO4A 4JGHA 2RMXA 2EYZA 4H34A 4QSYA 1O4HA 1NRVA 4NWFA 1PICA 1MW4A 1OPKA 2LQWA 1AYBA 3VS0A 3IN8A 3UF4A 3MXYA 2H5KA 4OHLA 1KA7A 3EAZA 2C0IA 5EEQA 2DCRA 2KK6A 1IJRA 2OZOA 2HUWA 2XP1A 4H1OA 1JYRA 1A1EA 3PSJA 5J3XA 2RORA 2CBLA 1KA6A 3CXLA 1SHBA 1O48A 2SRCA 3MXCA 4OHEA 1NZVA 3HIZB 3PSKA 1HCSB 1LKKA 1TCEA 4E93A 2LNXA 3US4A 4TZIA 3IMJA 1A81A 5EG3B 2H8HA 1YVLA 1BKMA 1YVHA 1G83A 1M27A 3MAZA 1R1SA 3VS7A 1LUNA 2IUIA 2YSXA 5HKWA 1FBZA 3EACA 3BKBA 4P9ZA 5HKZA 2GSBA 3OP0A 1D4TA 2PLEA 5DC9A 1BLKA 3VROA 3CD3A 1BF5A 2DLYA 1O46A 1OPLA 4K2RA 4JE4A 2EU0A 3CWGA 1QG1E 3UYOA 4E68A 3M7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LNW A;  3VRQ A;  5EEL A;  1P13 A;  1CWD L;  2LCT A;  4LUD A;  1O4Q A;  4A4C A;  1O4M A;  3TL0 A;  3S9K A;  5KAZ A;  3S8O A;  1JWO A;  1Y1U A;  2EYY A;  1H9O A;  4K45 A;  1GRI A;  3NHN A;  3VS4 A;  1LUI A;  2EO3 A;  1O49 A;  2KNO A;  3PLF B;  1AYA A;  1A08 A;  4LUE A;  4NWG A;  1BM2 A;  1AB2 A;  1FHS A;  2K79 B;  2SHP A;  2L6K A;  1O43 A;  3S8N A;  1SHA A;  2HCK A;  3GXX A;  2HMH A;  3GXW A;  2CI9 A;  3TKZ A;  5GJH A;  2DM0 A;  3N7Y A;  1UUR A;  1OO3 A;  5DC4 A;  3OB1 B;  1A09 A;  1BG1 A;  1O4D A;  1JYQ A;  2ETZ A;  1O4I A;  3OB2 B;  4A4B A;  3PQZ A;  3S8L A;  3VS2 A;  2PNB A;  3HCK A;  2EO6 A;  1FU6 A;  4OHH A;  1O42 A;  1ZFP E;  3VS5 A;  2AUG A;  2MQI A;  4D8K A;  4EY0 A;  4GPL B;  3VS3 A;  1MIL A;  2CI8 A;  1A1C A;  2EYV A;  2DLZ A;  3ZNI A;  2DX0 A;  1KC2 A;  1BFJ A;  3IN7 A;  2EKX A;  2MK2 A;  1Z3K A;  1O4R A;  1RJA A;  4L1B B;  5EHR A;  1O45 A;  2LQN A;  4K11 A;  3VRR A;  2IZV A;  3PJP A;  1A1B A;  3C7I A;  2EOB A;  3VS6 A;  2BBU A;  2L3T A;  1LUM A;  1O4A A;  5AUL A;  1CSY A;  1SKJ A;  4EIH A;  4FBN A;  5HKY A;  1O4J A;  1B47 A;  1FMK A;  1SHD A;  4FL2 A;  2EL8 A;  3VS1 A;  1O4L A;  4JEG A;  1AOU F;  2Y1M A;  1LCJ A;  2AOB A;  3OVE A;  2C9W A;  2MRJ A;  1BHF A;  2C0O A;  3T04 A;  4DGP A;  2CR4 A;  3QWY A;  2AOA A;  1O4E A;  2ABL A;  5CDW A;  1JYU A;  2RVF A;  1FBV A;  3BUM B;  1BKL A;  1O4G A;  2PLD A;  1SPS A;  4OHD A;  5IBS A;  2CIA A;  1QAD A;  4GL9 E;  1O4N A;  3VRZ A;  4WWQ A;  3K2M A;  2IUH A;  1R1P A;  4M4Z A;  4ROJ A;  3BUO B;  4FL3 A;  1O4K A;  1O4F A;  4XZ0 A;  3VRP A;  1RPY A;  1AOT F;  1O41 A;  2GE9 A;  5IBM A;  1Y57 A;  2JYQ A;  2PNA A;  1D4W A;  3N84 A;  1IS0 A;  1I3Z A;  5DC0 B;  4K44 A;  3WA4 A;  1XA6 A;  1BFI A;  1CSZ A;  1FYR A;  1HCT B;  1RQQ C;  3VGO A;  1X27 A;  2YU7 A;  2PTK A;  1WQU A;  1O47 A;  1CWE A;  1O4O A;  1AYC A;  1LCK A;  3IMD A;  1SPR A;  2K7A B;  3N8M A;  2IUG A;  2VIF A;  3KFJ A;  1KSW A;  4F5B A;  2MC1 A;  5DF6 A;  5I6V A;  1AYD A;  2H46 E;  1D1Z A;  2CRH A;  1AD5 A;  1X6C A;  3CBL A;  2RSY A;  2MRK A;  2C0T A;  1O4B A;  1QCF A;  5GJI A;  1BLJ A;  2L4K A;  1CJ1 A;  3BUX B;  1R1Q A;  2ECD A;  2DVJ A;  1OO4 A;  4P9V A;  1NZL A;  3BUN B;  2Y1N A;  2CS0 A;  1LKL A;  4XZ1 A;  3VRN A;  1LUK A;  4F5A A;  3PS5 A;  1K9A A;  1X0N A;  5EHP A;  3QWX X;  4DGX A;  3PFV A;  4OHI A;  1BHH A;  3BUW B;  1GHU A;  4U17 A;  1O4C A;  1F1W A;  1O44 A;  1UUS A;  1JU5 A;  3VRY A;  2HDX A;  3OV1 A;  4U1P A;  4GWF A;  4X6S A;  1FU5 A;  1A07 A;  2OQ1 A;  4F59 A;  1BMB A;  2QMS A;  1O4P A;  2FO0 A;  2FCI A;  1M61 A;  2Y3A B;  5D0J A;  2B3O A;  3HHM B;  1BHH B;  3GQI B;  1A1A A;  1TZE E;  2HDV A;  5AXI A;  1F2F A;  5BO4 A;  4JGH A;  2RMX A;  2EYZ A;  4H34 A;  4QSY A;  1O4H A;  1NRV A;  4NWF A;  1PIC A;  1MW4 A;  1OPK A;  2LQW A;  1AYB A;  3VS0 A;  3IN8 A;  3UF4 A;  3MXY A;  2H5K A;  4OHL A;  1KA7 A;  3EAZ A;  2C0I A;  5EEQ A;  2DCR A;  2KK6 A;  1IJR A;  2OZO A;  2HUW A;  2XP1 A;  4H1O A;  1JYR A;  1A1E A;  3PSJ A;  5J3X A;  2ROR A;  2CBL A;  1KA6 A;  3CXL A;  1SHB A;  1O48 A;  2SRC A;  3MXC A;  4OHE A;  1NZV A;  3HIZ B;  3PSK A;  1HCS B;  1LKK A;  1TCE A;  4E93 A;  2LNX A;  3US4 A;  4TZI A;  3IMJ A;  1A81 A;  5EG3 B;  2H8H A;  1YVL A;  1BKM A;  1YVH A;  1G83 A;  1M27 A;  3MAZ A;  1R1S A;  3VS7 A;  1LUN A;  2IUI A;  2YSX A;  5HKW A;  1FBZ A;  3EAC A;  3BKB A;  4P9Z A;  5HKZ A;  2GSB A;  3OP0 A;  1D4T A;  2PLE A;  5DC9 A;  1BLK A;  3VRO A;  3CD3 A;  1BF5 A;  2DLY A;  1O46 A;  1OPL A;  4K2R A;  4JE4 A;  2EU0 A;  3CWG A;  1QG1 E;  3UYO A;  4E68 A;  3M7F A; 
#chains in the Genus database with same CATH topology
 2LNW A;  3VRQ A;  5EEL A;  1P13 A;  1CWD L;  2LCT A;  4LUD A;  1O4Q A;  4A4C A;  1O4M A;  3TL0 A;  3S9K A;  5KAZ A;  3S8O A;  2LRA A;  1JWO A;  1Y1U A;  2EYY A;  1H9O A;  4K45 A;  1GRI A;  3NHN A;  3VS4 A;  1LUI A;  2EO3 A;  1O49 A;  2KNO A;  3PLF B;  1AYA A;  1A08 A;  4LUE A;  4NWG A;  1BM2 A;  1AB2 A;  1FHS A;  2K79 B;  2SHP A;  2L6K A;  1O43 A;  3S8N A;  1SHA A;  2HCK A;  3GXX A;  2HMH A;  3GXW A;  2CI9 A;  3TKZ A;  5GJH A;  2DM0 A;  3N7Y A;  1UUR A;  3K2T A;  1OO3 A;  5DC4 A;  3OB1 B;  1A09 A;  1BG1 A;  1O4D A;  1JYQ A;  2ETZ A;  1O4I A;  3OB2 B;  4A4B A;  3PQZ A;  3S8L A;  3VS2 A;  2PNB A;  3HCK A;  2EO6 A;  1FU6 A;  4OHH A;  1O42 A;  1ZFP E;  3VS5 A;  2AUG A;  2MQI A;  4D8K A;  4EY0 A;  4GPL B;  3VS3 A;  1MIL A;  2CI8 A;  1A1C A;  2EYV A;  2DLZ A;  3ZNI A;  2DX0 A;  1KC2 A;  1BFJ A;  3IN7 A;  2EKX A;  2MK2 A;  1Z3K A;  1O4R A;  1RJA A;  4L1B B;  5EHR A;  1O45 A;  2LQN A;  4K11 A;  3VRR A;  2IZV A;  3PJP A;  1A1B A;  3C7I A;  2EOB A;  3VS6 A;  2BBU A;  2L3T A;  1LUM A;  1O4A A;  5AUL A;  1CSY A;  1SKJ A;  4EIH A;  4FBN A;  5HKY A;  1O4J A;  1B47 A;  1FMK A;  1SHD A;  4FL2 A;  2EL8 A;  3VS1 A;  1O4L A;  4JEG A;  1AOU F;  2Y1M A;  1LCJ A;  2AOB A;  3OVE A;  2C9W A;  2MRJ A;  1BHF A;  2C0O A;  3T04 A;  4DGP A;  2CR4 A;  3QWY A;  2AOA A;  1O4E A;  2ABL A;  5CDW A;  1JYU A;  2RVF A;  1FBV A;  3BUM B;  1BKL A;  1O4G A;  2PLD A;  1SPS A;  4OHD A;  5IBS A;  2CIA A;  1QAD A;  4GL9 E;  1O4N A;  3VRZ A;  4WWQ A;  3K2M A;  2IUH A;  1R1P A;  4M4Z A;  4ROJ A;  3BUO B;  4FL3 A;  1O4K A;  1O4F A;  4XZ0 A;  3VRP A;  1RPY A;  1AOT F;  1O41 A;  2GE9 A;  5IBM A;  1Y57 A;  2JYQ A;  2PNA A;  1D4W A;  3N84 A;  1IS0 A;  1I3Z A;  5DC0 B;  4K44 A;  3WA4 A;  1XA6 A;  1BFI A;  1CSZ A;  1FYR A;  1HCT B;  1RQQ C;  3VGO A;  1X27 A;  2YU7 A;  2PTK A;  1WQU A;  1O47 A;  1CWE A;  1O4O A;  1AYC A;  1LCK A;  3IMD A;  1SPR A;  2K7A B;  3N8M A;  2IUG A;  2VIF A;  3KFJ A;  1KSW A;  4F5B A;  2MC1 A;  5DF6 A;  5I6V A;  1AYD A;  2H46 E;  1D1Z A;  2CRH A;  1AD5 A;  1X6C A;  3CBL A;  2RSY A;  2MRK A;  2C0T A;  1O4B A;  1QCF A;  5GJI A;  1BLJ A;  2L4K A;  1CJ1 A;  3BUX B;  1R1Q A;  2ECD A;  2DVJ A;  1OO4 A;  4P9V A;  1NZL A;  3BUN B;  2Y1N A;  2CS0 A;  1LKL A;  4XZ1 A;  3VRN A;  1LUK A;  4F5A A;  3PS5 A;  1K9A A;  1X0N A;  5EHP A;  3QWX X;  3LYV A;  4DGX A;  3PFV A;  4OHI A;  1BHH A;  3BUW B;  1GHU A;  4U17 A;  1O4C A;  1F1W A;  1O44 A;  1UUS A;  1JU5 A;  3VRY A;  2HDX A;  3OV1 A;  4U1P A;  4GWF A;  4X6S A;  1FU5 A;  1A07 A;  2OQ1 A;  4F59 A;  1BMB A;  2QMS A;  1O4P A;  2FO0 A;  2FCI A;  1M61 A;  2Y3A B;  5D0J A;  2B3O A;  3HHM B;  1BHH B;  3GQI B;  1A1A A;  1TZE E;  2HDV A;  5AXI A;  1F2F A;  5BO4 A;  4JGH A;  2RMX A;  2EYZ A;  4H34 A;  4QSY A;  1O4H A;  1NRV A;  4NWF A;  1PIC A;  1MW4 A;  1OPK A;  2LQW A;  1AYB A;  3VS0 A;  3IN8 A;  3UF4 A;  3MXY A;  2H5K A;  4OHL A;  1KA7 A;  3EAZ A;  2C0I A;  5EEQ A;  2DCR A;  2KK6 A;  1IJR A;  2OZO A;  2HUW A;  2XP1 A;  4H1O A;  1JYR A;  1A1E A;  3PSJ A;  5J3X A;  2ROR A;  2CBL A;  1KA6 A;  3CXL A;  1SHB A;  1O48 A;  2SRC A;  3MXC A;  4OHE A;  1NZV A;  3HIZ B;  3PSK A;  1HCS B;  1LKK A;  1TCE A;  4E93 A;  2LNX A;  3US4 A;  4TZI A;  3IMJ A;  1A81 A;  5EG3 B;  2H8H A;  1YVL A;  1BKM A;  1YVH A;  1G83 A;  1M27 A;  3MAZ A;  1R1S A;  3VS7 A;  1LUN A;  2IUI A;  2KGY A;  2YSX A;  5HKW A;  1FBZ A;  3EAC A;  3BKB A;  4P9Z A;  5HKZ A;  2GSB A;  3OP0 A;  1D4T A;  2PLE A;  5DC9 A;  1BLK A;  3VRO A;  3CD3 A;  1BF5 A;  2DLY A;  1O46 A;  1OPL A;  4K2R A;  4JE4 A;  2EU0 A;  3CWG A;  1QG1 E;  3UYO A;  4E68 A;  3M7F A; 
#chains in the Genus database with same CATH homology
 2LNW A;  3VRQ A;  5EEL A;  1P13 A;  1CWD L;  2LCT A;  4LUD A;  1O4Q A;  4A4C A;  1O4M A;  3TL0 A;  3S9K A;  5KAZ A;  3S8O A;  1JWO A;  1Y1U A;  2EYY A;  1H9O A;  4K45 A;  1GRI A;  3NHN A;  3VS4 A;  1LUI A;  2EO3 A;  1O49 A;  2KNO A;  3PLF B;  1AYA A;  1A08 A;  4LUE A;  4NWG A;  1BM2 A;  1AB2 A;  1FHS A;  2K79 B;  2SHP A;  2L6K A;  1O43 A;  3S8N A;  1SHA A;  2HCK A;  3GXX A;  2HMH A;  3GXW A;  2CI9 A;  3TKZ A;  5GJH A;  2DM0 A;  3N7Y A;  1UUR A;  1OO3 A;  5DC4 A;  3OB1 B;  1A09 A;  1BG1 A;  1O4D A;  1JYQ A;  2ETZ A;  1O4I A;  3OB2 B;  4A4B A;  3PQZ A;  3S8L A;  3VS2 A;  2PNB A;  3HCK A;  2EO6 A;  1FU6 A;  4OHH A;  1O42 A;  1ZFP E;  3VS5 A;  2AUG A;  2MQI A;  4D8K A;  4EY0 A;  4GPL B;  3VS3 A;  1MIL A;  2CI8 A;  1A1C A;  2EYV A;  2DLZ A;  3ZNI A;  2DX0 A;  1KC2 A;  1BFJ A;  3IN7 A;  2EKX A;  2MK2 A;  1Z3K A;  1O4R A;  1RJA A;  4L1B B;  5EHR A;  1O45 A;  2LQN A;  4K11 A;  3VRR A;  2IZV A;  3PJP A;  1A1B A;  3C7I A;  2EOB A;  3VS6 A;  2BBU A;  2L3T A;  1LUM A;  1O4A A;  5AUL A;  1CSY A;  1SKJ A;  4EIH A;  4FBN A;  5HKY A;  1O4J A;  1B47 A;  1FMK A;  1SHD A;  4FL2 A;  2EL8 A;  3VS1 A;  1O4L A;  4JEG A;  1AOU F;  2Y1M A;  1LCJ A;  2AOB A;  3OVE A;  2C9W A;  2MRJ A;  1BHF A;  2C0O A;  3T04 A;  4DGP A;  2CR4 A;  3QWY A;  2AOA A;  1O4E A;  2ABL A;  5CDW A;  1JYU A;  2RVF A;  1FBV A;  3BUM B;  1BKL A;  1O4G A;  2PLD A;  1SPS A;  4OHD A;  5IBS A;  2CIA A;  1QAD A;  4GL9 E;  1O4N A;  3VRZ A;  4WWQ A;  3K2M A;  2IUH A;  1R1P A;  4M4Z A;  4ROJ A;  3BUO B;  4FL3 A;  1O4K A;  1O4F A;  4XZ0 A;  3VRP A;  1RPY A;  1AOT F;  1O41 A;  2GE9 A;  5IBM A;  1Y57 A;  2JYQ A;  2PNA A;  1D4W A;  3N84 A;  1IS0 A;  1I3Z A;  5DC0 B;  4K44 A;  3WA4 A;  1XA6 A;  1BFI A;  1CSZ A;  1FYR A;  1HCT B;  1RQQ C;  3VGO A;  1X27 A;  2YU7 A;  2PTK A;  1WQU A;  1O47 A;  1CWE A;  1O4O A;  1AYC A;  1LCK A;  3IMD A;  1SPR A;  2K7A B;  3N8M A;  2IUG A;  2VIF A;  3KFJ A;  1KSW A;  4F5B A;  2MC1 A;  5DF6 A;  5I6V A;  1AYD A;  2H46 E;  1D1Z A;  2CRH A;  1AD5 A;  1X6C A;  3CBL A;  2RSY A;  2MRK A;  2C0T A;  1O4B A;  1QCF A;  5GJI A;  1BLJ A;  2L4K A;  1CJ1 A;  3BUX B;  1R1Q A;  2ECD A;  2DVJ A;  1OO4 A;  4P9V A;  1NZL A;  3BUN B;  2Y1N A;  2CS0 A;  1LKL A;  4XZ1 A;  3VRN A;  1LUK A;  4F5A A;  3PS5 A;  1K9A A;  1X0N A;  5EHP A;  3QWX X;  4DGX A;  3PFV A;  4OHI A;  1BHH A;  3BUW B;  1GHU A;  4U17 A;  1O4C A;  1F1W A;  1O44 A;  1UUS A;  1JU5 A;  3VRY A;  2HDX A;  3OV1 A;  4U1P A;  4GWF A;  4X6S A;  1FU5 A;  1A07 A;  2OQ1 A;  4F59 A;  1BMB A;  2QMS A;  1O4P A;  2FO0 A;  2FCI A;  1M61 A;  2Y3A B;  5D0J A;  2B3O A;  3HHM B;  1BHH B;  3GQI B;  1A1A A;  1TZE E;  2HDV A;  5AXI A;  1F2F A;  5BO4 A;  4JGH A;  2RMX A;  2EYZ A;  4H34 A;  4QSY A;  1O4H A;  1NRV A;  4NWF A;  1PIC A;  1MW4 A;  1OPK A;  2LQW A;  1AYB A;  3VS0 A;  3IN8 A;  3UF4 A;  3MXY A;  2H5K A;  4OHL A;  1KA7 A;  3EAZ A;  2C0I A;  5EEQ A;  2DCR A;  2KK6 A;  1IJR A;  2OZO A;  2HUW A;  2XP1 A;  4H1O A;  1JYR A;  1A1E A;  3PSJ A;  5J3X A;  2ROR A;  2CBL A;  1KA6 A;  3CXL A;  1SHB A;  1O48 A;  2SRC A;  3MXC A;  4OHE A;  1NZV A;  3HIZ B;  3PSK A;  1HCS B;  1LKK A;  1TCE A;  4E93 A;  2LNX A;  3US4 A;  4TZI A;  3IMJ A;  1A81 A;  5EG3 B;  2H8H A;  1YVL A;  1BKM A;  1YVH A;  1G83 A;  1M27 A;  3MAZ A;  1R1S A;  3VS7 A;  1LUN A;  2IUI A;  2YSX A;  5HKW A;  1FBZ A;  3EAC A;  3BKB A;  4P9Z A;  5HKZ A;  2GSB A;  3OP0 A;  1D4T A;  2PLE A;  5DC9 A;  1BLK A;  3VRO A;  3CD3 A;  1BF5 A;  2DLY A;  1O46 A;  1OPL A;  4K2R A;  4JE4 A;  2EU0 A;  3CWG A;  1QG1 E;  3UYO A;  4E68 A;  3M7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...