3S8LA

Protein-ligand interactions: thermodynamic effects associated with increasing hydrophobic surface area
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
EMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth factor receptor-bound protein 2
publication title Protein-ligand interactions: thermodynamic effects associated with increasing nonpolar surface area.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/antagonist
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3s8lA00
1BFJA 1AOUF 1LKKA 2AOBA 1A07A 4EIHA 1LUMA 4K11A 3PFVA 1SHBA 4JEGA 1BF5A 3PJPA 4OHLA 2H46E 4E68A 2BBUA 3MAZA 1O4JA 4A4BA 3IN8A 2ABLA 1JYQA 3HIZB 2CRHA 2C0IA 2DVJA 1O4BA 5J3XA 3VGOA 1F1WA 5CDWA 1M27A 1A09A 1O4DA 3VRNA 1D4TA 1XA6A 3S9KA 1KC2A 2ETZA 1JYRA 1KA7A 2EO3A 4F59A 3S8OA 2L6KA 4LUEA 5EEQA 1O4PA 1BKMA 2L3TA 2GSBA 2EOBA 4P9ZA 2HUWA 4D8KA 3GXXA 1AYAA 1SPSA 2PLDA 1AYDA 3M7FA 1WQUA 3K2MA 1X6CA 2K7AB 1QG1E 3N84A 1O4LA 1FMKA 4U1PA 1AD5A 1AB2A 5GJHA 1FBVA 3VRPA 3QWXX 2EKXA 3IMDA 1O4RA 2KNOA 1H9OA 1OPLA 2L4KA 3CWGA 1BMBA 1BHHA 4FBNA 1YVLA 3BUNB 1O46A 1CWDL 3ZNIA 3OP0A 2MQIA 2VIFA 1A08A 1A1CA 3BUMB 1P13A 1O44A 1FU6A 5IBSA 2H8HA 1I3ZA 2HDVA 1PICA 2DLZA 5DC0B 2SRCA 5HKWA 3BUWB 1RPYA 1O4KA 1QCFA 1OO3A 3IMJA 1GHUA 4EY0A 1FHSA 2JYQA 2AUGA 3BUOB 3US4A 1LCKA 1CSZA 1Y1UA 1LUKA 3TKZA 3HCKA 4OHDA 5EHPA 1A1EA 1B47A 2OQ1A 4K45A 1BLKA 3N8MA 2KK6A 1BKLA 1F2FA 3EACA 2YSXA 5HKZA 2RVFA 2EU0A 3VS3A 1O4CA 2EYVA 2CS0A 2Y1NA 4DGPA 4F5AA 3IN7A 2CIAA 2LCTA 1GRIA 5DC9A 3UYOA 1Z3KA 3KFJA 4ROJA 4DGXA 2LNXA 1O49A 5IBMA 2RSYA 3BUXB 2QMSA 1RJAA 3N7YA 1RQQC 1D1ZA 1O48A 1FBZA 4X6SA 1O4AA 3PQZA 2C0OA 2PNAA 4K44A 5EG3B 1O4NA 2C0TA 4LUDA 1LUNA 3VS0A 4E93A 1TCEA 1ZFPE 1KSWA 2FO0A 2MRKA 1CJ1A 4NWFA 1K9AA 1IS0A 1TZEE 1OPKA 2SHPA 1CSYA 1UUSA 2GE9A 3CBLA 4H1OA 4L1BB 3VRZA 1O4IA 3PLFB 3VRYA 2IZVA 1JU5A 5HKYA 1AYCA 2IUHA 1A81A 4WWQA 3OB1B 2CI8A 1O43A 1CWEA 1UURA 2DCRA 2DX0A 1O4OA 3VS1A 1SHAA 2EL8A 3QWYA 1X27A 3NHNA 1NRVA 3VS6A 2K79B 1O47A 2LQWA 4XZ1A 1SHDA 2ECDA 2EO6A 4GL9E 1BG1A 5DF6A 2C9WA 5KAZA 2HMHA 3EAZA 2CBLA 4QSYA 1QADA 4FL3A 1NZLA 4FL2A 1MILA 2IUGA 1R1SA 5DC4A 2LQNA 1KA6A 2AOAA 5AXIA 4JE4A 4U17A 3VRRA 3PS5A 5D0JA 4JGHA 3VS2A 4XZ0A 2PLEA 5EELA 5AULA 4P9VA 3VS5A 4H34A 4TZIA 3T04A 1BFIA 2OZOA 1BHHB 2Y3AB 1JYUA 4GPLB 2PTKA 2FCIA 3VROA 3GXWA 3S8NA 2MK2A 3BKBA 1O42A 1AOTF 1G83A 4F5BA 2EYYA 2MC1A 1D4WA 1YVHA 1FYRA 1O4QA 1R1QA 3HHMB 3S8LA 3OVEA 1HCTB 1BHFA 3OB2B 3CXLA 3MXCA 4K2RA 1LKLA 3VS7A 1M61A 3PSJA 2MRJA 3UF4A 1SPRA 3GQIB 1BM2A 1Y57A 2RORA 1A1AA 1BLJA 2RMXA 2DLYA 2H5KA 4NWGA 1O4GA 1O41A 1LCJA 5EHRA 3OV1A 3MXYA 4A4CA 1NZVA 2LNWA 2Y1MA 1A1BA 4OHEA 4OHHA 2HCKA 1SKJA 2CI9A 2YU7A 2IUIA 2CR4A 2DM0A 4M4ZA 5BO4A 2PNBA 3WA4A 4OHIA 1LUIA 1IJRA 3PSKA 1HCSB 1MW4A 2B3OA 1X0NA 1O4MA 5I6VA 3VS4A 3CD3A 2EYZA 3VRQA 1O45A 1AYBA 3TL0A 3C7IA 2HDXA 2XP1A 1OO4A 5GJIA 1FU5A 1JWOA 1O4FA 1R1PA 1O4HA 1O4EA 4GWFA
chains in the Genus database with same CATH superfamily
1BFJA 1AOUF 1LKKA 2AOBA 1A07A 4EIHA 1LUMA 4K11A 3PFVA 1SHBA 4JEGA 1BF5A 3PJPA 4OHLA 2H46E 4E68A 2BBUA 3MAZA 1O4JA 4A4BA 3IN8A 2ABLA 1JYQA 3HIZB 2CRHA 2C0IA 2DVJA 1O4BA 5J3XA 3VGOA 1F1WA 5CDWA 1M27A 1A09A 1O4DA 3VRNA 1D4TA 1XA6A 3S9KA 1KC2A 2ETZA 1JYRA 1KA7A 2EO3A 4F59A 3S8OA 2L6KA 4LUEA 5EEQA 1O4PA 1BKMA 2L3TA 2GSBA 2EOBA 4P9ZA 2HUWA 4D8KA 3GXXA 1AYAA 1SPSA 2PLDA 1AYDA 3M7FA 1WQUA 3K2MA 1X6CA 2K7AB 1QG1E 3N84A 1O4LA 1FMKA 4U1PA 1AD5A 1AB2A 5GJHA 1FBVA 3VRPA 3QWXX 2EKXA 3IMDA 1O4RA 2KNOA 1H9OA 1OPLA 2L4KA 3CWGA 1BMBA 1BHHA 4FBNA 1YVLA 3BUNB 1O46A 1CWDL 3ZNIA 3OP0A 2MQIA 2VIFA 1A08A 1A1CA 3BUMB 1P13A 1O44A 1FU6A 5IBSA 2H8HA 1I3ZA 2HDVA 1PICA 2DLZA 5DC0B 2SRCA 5HKWA 3BUWB 1RPYA 1O4KA 1QCFA 1OO3A 3IMJA 1GHUA 4EY0A 1FHSA 2JYQA 2AUGA 3BUOB 3US4A 1LCKA 1CSZA 1Y1UA 1LUKA 3TKZA 3HCKA 4OHDA 5EHPA 1A1EA 1B47A 2OQ1A 4K45A 1BLKA 3N8MA 2KK6A 1BKLA 1F2FA 3EACA 2YSXA 5HKZA 2RVFA 2EU0A 3VS3A 1O4CA 2EYVA 2CS0A 2Y1NA 4DGPA 4F5AA 3IN7A 2CIAA 2LCTA 1GRIA 5DC9A 3UYOA 2LRAA 1Z3KA 3KFJA 4ROJA 4DGXA 2LNXA 1O49A 5IBMA 2RSYA 3BUXB 2QMSA 1RJAA 3N7YA 1RQQC 1D1ZA 1O48A 1FBZA 4X6SA 1O4AA 3PQZA 2C0OA 2PNAA 4K44A 5EG3B 1O4NA 2C0TA 4LUDA 1LUNA 3LYVA 3VS0A 4E93A 1TCEA 1ZFPE 2KGYA 1KSWA 2FO0A 2MRKA 1CJ1A 4NWFA 1K9AA 1IS0A 1TZEE 1OPKA 2SHPA 1CSYA 1UUSA 2GE9A 3CBLA 4H1OA 4L1BB 3VRZA 1O4IA 3PLFB 3VRYA 2IZVA 1JU5A 5HKYA 1AYCA 2IUHA 1A81A 4WWQA 3OB1B 2CI8A 1O43A 1CWEA 1UURA 2DCRA 2DX0A 1O4OA 3VS1A 1SHAA 2EL8A 3QWYA 1X27A 3NHNA 1NRVA 3VS6A 2K79B 1O47A 2LQWA 4XZ1A 1SHDA 2ECDA 2EO6A 4GL9E 1BG1A 5DF6A 2C9WA 5KAZA 2HMHA 3EAZA 2CBLA 4QSYA 1QADA 4FL3A 1NZLA 4FL2A 1MILA 2IUGA 1R1SA 5DC4A 2LQNA 1KA6A 2AOAA 5AXIA 4JE4A 4U17A 3VRRA 3PS5A 5D0JA 4JGHA 3VS2A 4XZ0A 2PLEA 5EELA 5AULA 3K2TA 4P9VA 3VS5A 4H34A 4TZIA 3T04A 1BFIA 2OZOA 1BHHB 2Y3AB 1JYUA 4GPLB 2PTKA 2FCIA 3VROA 3GXWA 3S8NA 2MK2A 3BKBA 1O42A 1AOTF 1G83A 4F5BA 2EYYA 2MC1A 1D4WA 1YVHA 1FYRA 1O4QA 1R1QA 3HHMB 3S8LA 3OVEA 1HCTB 1BHFA 3OB2B 3CXLA 3MXCA 4K2RA 1LKLA 3VS7A 1M61A 3PSJA 2MRJA 3UF4A 1SPRA 3GQIB 1BM2A 1Y57A 2RORA 1A1AA 1BLJA 2RMXA 2DLYA 2H5KA 4NWGA 1O4GA 1O41A 1LCJA 5EHRA 3OV1A 3MXYA 4A4CA 1NZVA 2LNWA 2Y1MA 1A1BA 4OHEA 4OHHA 2HCKA 1SKJA 2CI9A 2YU7A 2IUIA 2CR4A 2DM0A 4M4ZA 5BO4A 2PNBA 3WA4A 4OHIA 1LUIA 1IJRA 3PSKA 1HCSB 1MW4A 2B3OA 1X0NA 1O4MA 5I6VA 3VS4A 3CD3A 2EYZA 3VRQA 1O45A 1AYBA 3TL0A 3C7IA 2HDXA 2XP1A 1OO4A 5GJIA 1FU5A 1JWOA 1O4FA 1R1PA 1O4HA 1O4EA 4GWFA
chains in the Genus database with same CATH topology
1BFJA 1AOUF 1LKKA 2AOBA 1A07A 4EIHA 1LUMA 4K11A 3PFVA 1SHBA 4JEGA 1BF5A 3PJPA 4OHLA 2H46E 4E68A 2BBUA 3MAZA 1O4JA 4A4BA 3IN8A 2ABLA 1JYQA 3HIZB 2CRHA 2C0IA 2DVJA 1O4BA 5J3XA 3VGOA 1F1WA 5CDWA 1M27A 1A09A 1O4DA 3VRNA 1D4TA 1XA6A 3S9KA 1KC2A 2ETZA 1JYRA 1KA7A 2EO3A 4F59A 3S8OA 2L6KA 4LUEA 5EEQA 1O4PA 1BKMA 2L3TA 2GSBA 2EOBA 4P9ZA 2HUWA 4D8KA 3GXXA 1AYAA 1SPSA 2PLDA 1AYDA 3M7FA 1WQUA 3K2MA 1X6CA 2K7AB 1QG1E 3N84A 1O4LA 1FMKA 4U1PA 1AD5A 1AB2A 5GJHA 1FBVA 3VRPA 3QWXX 2EKXA 3IMDA 1O4RA 2KNOA 1H9OA 1OPLA 2L4KA 3CWGA 1BMBA 1BHHA 4FBNA 1YVLA 3BUNB 1O46A 1CWDL 3ZNIA 3OP0A 2MQIA 2VIFA 1A08A 1A1CA 3BUMB 1P13A 1O44A 1FU6A 5IBSA 2H8HA 1I3ZA 2HDVA 1PICA 2DLZA 5DC0B 2SRCA 5HKWA 3BUWB 1RPYA 1O4KA 1QCFA 1OO3A 3IMJA 1GHUA 4EY0A 1FHSA 2JYQA 2AUGA 3BUOB 3US4A 1LCKA 1CSZA 1Y1UA 1LUKA 3TKZA 3HCKA 4OHDA 5EHPA 1A1EA 1B47A 2OQ1A 4K45A 1BLKA 3N8MA 2KK6A 1BKLA 1F2FA 3EACA 2YSXA 5HKZA 2RVFA 2EU0A 3VS3A 1O4CA 2EYVA 2CS0A 2Y1NA 4DGPA 4F5AA 3IN7A 2CIAA 2LCTA 1GRIA 5DC9A 3UYOA 1Z3KA 3KFJA 4ROJA 4DGXA 2LNXA 1O49A 5IBMA 2RSYA 3BUXB 2QMSA 1RJAA 3N7YA 1RQQC 1D1ZA 1O48A 1FBZA 4X6SA 1O4AA 3PQZA 2C0OA 2PNAA 4K44A 5EG3B 1O4NA 2C0TA 4LUDA 1LUNA 3VS0A 4E93A 1TCEA 1ZFPE 1KSWA 2FO0A 2MRKA 1CJ1A 4NWFA 1K9AA 1IS0A 1TZEE 1OPKA 2SHPA 1CSYA 1UUSA 2GE9A 3CBLA 4H1OA 4L1BB 3VRZA 1O4IA 3PLFB 3VRYA 2IZVA 1JU5A 5HKYA 1AYCA 2IUHA 1A81A 4WWQA 3OB1B 2CI8A 1O43A 1CWEA 1UURA 2DCRA 2DX0A 1O4OA 3VS1A 1SHAA 2EL8A 3QWYA 1X27A 3NHNA 1NRVA 3VS6A 2K79B 1O47A 2LQWA 4XZ1A 1SHDA 2ECDA 2EO6A 4GL9E 1BG1A 5DF6A 2C9WA 5KAZA 2HMHA 3EAZA 2CBLA 4QSYA 1QADA 4FL3A 1NZLA 4FL2A 1MILA 2IUGA 1R1SA 5DC4A 2LQNA 1KA6A 2AOAA 5AXIA 4JE4A 4U17A 3VRRA 3PS5A 5D0JA 4JGHA 3VS2A 4XZ0A 2PLEA 5EELA 5AULA 4P9VA 3VS5A 4H34A 4TZIA 3T04A 1BFIA 2OZOA 1BHHB 2Y3AB 1JYUA 4GPLB 2PTKA 2FCIA 3VROA 3GXWA 3S8NA 2MK2A 3BKBA 1O42A 1AOTF 1G83A 4F5BA 2EYYA 2MC1A 1D4WA 1YVHA 1FYRA 1O4QA 1R1QA 3HHMB 3S8LA 3OVEA 1HCTB 1BHFA 3OB2B 3CXLA 3MXCA 4K2RA 1LKLA 3VS7A 1M61A 3PSJA 2MRJA 3UF4A 1SPRA 3GQIB 1BM2A 1Y57A 2RORA 1A1AA 1BLJA 2RMXA 2DLYA 2H5KA 4NWGA 1O4GA 1O41A 1LCJA 5EHRA 3OV1A 3MXYA 4A4CA 1NZVA 2LNWA 2Y1MA 1A1BA 4OHEA 4OHHA 2HCKA 1SKJA 2CI9A 2YU7A 2IUIA 2CR4A 2DM0A 4M4ZA 5BO4A 2PNBA 3WA4A 4OHIA 1LUIA 1IJRA 3PSKA 1HCSB 1MW4A 2B3OA 1X0NA 1O4MA 5I6VA 3VS4A 3CD3A 2EYZA 3VRQA 1O45A 1AYBA 3TL0A 3C7IA 2HDXA 2XP1A 1OO4A 5GJIA 1FU5A 1JWOA 1O4FA 1R1PA 1O4HA 1O4EA 4GWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BFJ A;  1AOU F;  1LKK A;  2AOB A;  1A07 A;  4EIH A;  1LUM A;  4K11 A;  3PFV A;  1SHB A;  4JEG A;  1BF5 A;  3PJP A;  4OHL A;  2H46 E;  4E68 A;  2BBU A;  3MAZ A;  1O4J A;  4A4B A;  3IN8 A;  2ABL A;  1JYQ A;  3HIZ B;  2CRH A;  2C0I A;  2DVJ A;  1O4B A;  5J3X A;  3VGO A;  1F1W A;  5CDW A;  1M27 A;  1A09 A;  1O4D A;  3VRN A;  1D4T A;  1XA6 A;  3S9K A;  1KC2 A;  2ETZ A;  1JYR A;  1KA7 A;  2EO3 A;  4F59 A;  3S8O A;  2L6K A;  4LUE A;  5EEQ A;  1O4P A;  1BKM A;  2L3T A;  2GSB A;  2EOB A;  4P9Z A;  2HUW A;  4D8K A;  3GXX A;  1AYA A;  1SPS A;  2PLD A;  1AYD A;  3M7F A;  1WQU A;  3K2M A;  1X6C A;  2K7A B;  1QG1 E;  3N84 A;  1O4L A;  1FMK A;  4U1P A;  1AD5 A;  1AB2 A;  5GJH A;  1FBV A;  3VRP A;  3QWX X;  2EKX A;  3IMD A;  1O4R A;  2KNO A;  1H9O A;  1OPL A;  2L4K A;  3CWG A;  1BMB A;  1BHH A;  4FBN A;  1YVL A;  3BUN B;  1O46 A;  1CWD L;  3ZNI A;  3OP0 A;  2MQI A;  2VIF A;  1A08 A;  1A1C A;  3BUM B;  1P13 A;  1O44 A;  1FU6 A;  5IBS A;  2H8H A;  1I3Z A;  2HDV A;  1PIC A;  2DLZ A;  5DC0 B;  2SRC A;  5HKW A;  3BUW B;  1RPY A;  1O4K A;  1QCF A;  1OO3 A;  3IMJ A;  1GHU A;  4EY0 A;  1FHS A;  2JYQ A;  2AUG A;  3BUO B;  3US4 A;  1LCK A;  1CSZ A;  1Y1U A;  1LUK A;  3TKZ A;  3HCK A;  4OHD A;  5EHP A;  1A1E A;  1B47 A;  2OQ1 A;  4K45 A;  1BLK A;  3N8M A;  2KK6 A;  1BKL A;  1F2F A;  3EAC A;  2YSX A;  5HKZ A;  2RVF A;  2EU0 A;  3VS3 A;  1O4C A;  2EYV A;  2CS0 A;  2Y1N A;  4DGP A;  4F5A A;  3IN7 A;  2CIA A;  2LCT A;  1GRI A;  5DC9 A;  3UYO A;  1Z3K A;  3KFJ A;  4ROJ A;  4DGX A;  2LNX A;  1O49 A;  5IBM A;  2RSY A;  3BUX B;  2QMS A;  1RJA A;  3N7Y A;  1RQQ C;  1D1Z A;  1O48 A;  1FBZ A;  4X6S A;  1O4A A;  3PQZ A;  2C0O A;  2PNA A;  4K44 A;  5EG3 B;  1O4N A;  2C0T A;  4LUD A;  1LUN A;  3VS0 A;  4E93 A;  1TCE A;  1ZFP E;  1KSW A;  2FO0 A;  2MRK A;  1CJ1 A;  4NWF A;  1K9A A;  1IS0 A;  1TZE E;  1OPK A;  2SHP A;  1CSY A;  1UUS A;  2GE9 A;  3CBL A;  4H1O A;  4L1B B;  3VRZ A;  1O4I A;  3PLF B;  3VRY A;  2IZV A;  1JU5 A;  5HKY A;  1AYC A;  2IUH A;  1A81 A;  4WWQ A;  3OB1 B;  2CI8 A;  1O43 A;  1CWE A;  1UUR A;  2DCR A;  2DX0 A;  1O4O A;  3VS1 A;  1SHA A;  2EL8 A;  3QWY A;  1X27 A;  3NHN A;  1NRV A;  3VS6 A;  2K79 B;  1O47 A;  2LQW A;  4XZ1 A;  1SHD A;  2ECD A;  2EO6 A;  4GL9 E;  1BG1 A;  5DF6 A;  2C9W A;  5KAZ A;  2HMH A;  3EAZ A;  2CBL A;  4QSY A;  1QAD A;  4FL3 A;  1NZL A;  4FL2 A;  1MIL A;  2IUG A;  1R1S A;  5DC4 A;  2LQN A;  1KA6 A;  2AOA A;  5AXI A;  4JE4 A;  4U17 A;  3VRR A;  3PS5 A;  5D0J A;  4JGH A;  3VS2 A;  4XZ0 A;  2PLE A;  5EEL A;  5AUL A;  4P9V A;  3VS5 A;  4H34 A;  4TZI A;  3T04 A;  1BFI A;  2OZO A;  1BHH B;  2Y3A B;  1JYU A;  4GPL B;  2PTK A;  2FCI A;  3VRO A;  3GXW A;  3S8N A;  2MK2 A;  3BKB A;  1O42 A;  1AOT F;  1G83 A;  4F5B A;  2EYY A;  2MC1 A;  1D4W A;  1YVH A;  1FYR A;  1O4Q A;  1R1Q A;  3HHM B;  3S8L A;  3OVE A;  1HCT B;  1BHF A;  3OB2 B;  3CXL A;  3MXC A;  4K2R A;  1LKL A;  3VS7 A;  1M61 A;  3PSJ A;  2MRJ A;  3UF4 A;  1SPR A;  3GQI B;  1BM2 A;  1Y57 A;  2ROR A;  1A1A A;  1BLJ A;  2RMX A;  2DLY A;  2H5K A;  4NWG A;  1O4G A;  1O41 A;  1LCJ A;  5EHR A;  3OV1 A;  3MXY A;  4A4C A;  1NZV A;  2LNW A;  2Y1M A;  1A1B A;  4OHE A;  4OHH A;  2HCK A;  1SKJ A;  2CI9 A;  2YU7 A;  2IUI A;  2CR4 A;  2DM0 A;  4M4Z A;  5BO4 A;  2PNB A;  3WA4 A;  4OHI A;  1LUI A;  1IJR A;  3PSK A;  1HCS B;  1MW4 A;  2B3O A;  1X0N A;  1O4M A;  5I6V A;  3VS4 A;  3CD3 A;  2EYZ A;  3VRQ A;  1O45 A;  1AYB A;  3TL0 A;  3C7I A;  2HDX A;  2XP1 A;  1OO4 A;  5GJI A;  1FU5 A;  1JWO A;  1O4F A;  1R1P A;  1O4H A;  1O4E A;  4GWF A; 
#chains in the Genus database with same CATH topology
 1BFJ A;  1AOU F;  1LKK A;  2AOB A;  1A07 A;  4EIH A;  1LUM A;  4K11 A;  3PFV A;  1SHB A;  4JEG A;  1BF5 A;  3PJP A;  4OHL A;  2H46 E;  4E68 A;  2BBU A;  3MAZ A;  1O4J A;  4A4B A;  3IN8 A;  2ABL A;  1JYQ A;  3HIZ B;  2CRH A;  2C0I A;  2DVJ A;  1O4B A;  5J3X A;  3VGO A;  1F1W A;  5CDW A;  1M27 A;  1A09 A;  1O4D A;  3VRN A;  1D4T A;  1XA6 A;  3S9K A;  1KC2 A;  2ETZ A;  1JYR A;  1KA7 A;  2EO3 A;  4F59 A;  3S8O A;  2L6K A;  4LUE A;  5EEQ A;  1O4P A;  1BKM A;  2L3T A;  2GSB A;  2EOB A;  4P9Z A;  2HUW A;  4D8K A;  3GXX A;  1AYA A;  1SPS A;  2PLD A;  1AYD A;  3M7F A;  1WQU A;  3K2M A;  1X6C A;  2K7A B;  1QG1 E;  3N84 A;  1O4L A;  1FMK A;  4U1P A;  1AD5 A;  1AB2 A;  5GJH A;  1FBV A;  3VRP A;  3QWX X;  2EKX A;  3IMD A;  1O4R A;  2KNO A;  1H9O A;  1OPL A;  2L4K A;  3CWG A;  1BMB A;  1BHH A;  4FBN A;  1YVL A;  3BUN B;  1O46 A;  1CWD L;  3ZNI A;  3OP0 A;  2MQI A;  2VIF A;  1A08 A;  1A1C A;  3BUM B;  1P13 A;  1O44 A;  1FU6 A;  5IBS A;  2H8H A;  1I3Z A;  2HDV A;  1PIC A;  2DLZ A;  5DC0 B;  2SRC A;  5HKW A;  3BUW B;  1RPY A;  1O4K A;  1QCF A;  1OO3 A;  3IMJ A;  1GHU A;  4EY0 A;  1FHS A;  2JYQ A;  2AUG A;  3BUO B;  3US4 A;  1LCK A;  1CSZ A;  1Y1U A;  1LUK A;  3TKZ A;  3HCK A;  4OHD A;  5EHP A;  1A1E A;  1B47 A;  2OQ1 A;  4K45 A;  1BLK A;  3N8M A;  2KK6 A;  1BKL A;  1F2F A;  3EAC A;  2YSX A;  5HKZ A;  2RVF A;  2EU0 A;  3VS3 A;  1O4C A;  2EYV A;  2CS0 A;  2Y1N A;  4DGP A;  4F5A A;  3IN7 A;  2CIA A;  2LCT A;  1GRI A;  5DC9 A;  3UYO A;  2LRA A;  1Z3K A;  3KFJ A;  4ROJ A;  4DGX A;  2LNX A;  1O49 A;  5IBM A;  2RSY A;  3BUX B;  2QMS A;  1RJA A;  3N7Y A;  1RQQ C;  1D1Z A;  1O48 A;  1FBZ A;  4X6S A;  1O4A A;  3PQZ A;  2C0O A;  2PNA A;  4K44 A;  5EG3 B;  1O4N A;  2C0T A;  4LUD A;  1LUN A;  3LYV A;  3VS0 A;  4E93 A;  1TCE A;  1ZFP E;  2KGY A;  1KSW A;  2FO0 A;  2MRK A;  1CJ1 A;  4NWF A;  1K9A A;  1IS0 A;  1TZE E;  1OPK A;  2SHP A;  1CSY A;  1UUS A;  2GE9 A;  3CBL A;  4H1O A;  4L1B B;  3VRZ A;  1O4I A;  3PLF B;  3VRY A;  2IZV A;  1JU5 A;  5HKY A;  1AYC A;  2IUH A;  1A81 A;  4WWQ A;  3OB1 B;  2CI8 A;  1O43 A;  1CWE A;  1UUR A;  2DCR A;  2DX0 A;  1O4O A;  3VS1 A;  1SHA A;  2EL8 A;  3QWY A;  1X27 A;  3NHN A;  1NRV A;  3VS6 A;  2K79 B;  1O47 A;  2LQW A;  4XZ1 A;  1SHD A;  2ECD A;  2EO6 A;  4GL9 E;  1BG1 A;  5DF6 A;  2C9W A;  5KAZ A;  2HMH A;  3EAZ A;  2CBL A;  4QSY A;  1QAD A;  4FL3 A;  1NZL A;  4FL2 A;  1MIL A;  2IUG A;  1R1S A;  5DC4 A;  2LQN A;  1KA6 A;  2AOA A;  5AXI A;  4JE4 A;  4U17 A;  3VRR A;  3PS5 A;  5D0J A;  4JGH A;  3VS2 A;  4XZ0 A;  2PLE A;  5EEL A;  5AUL A;  3K2T A;  4P9V A;  3VS5 A;  4H34 A;  4TZI A;  3T04 A;  1BFI A;  2OZO A;  1BHH B;  2Y3A B;  1JYU A;  4GPL B;  2PTK A;  2FCI A;  3VRO A;  3GXW A;  3S8N A;  2MK2 A;  3BKB A;  1O42 A;  1AOT F;  1G83 A;  4F5B A;  2EYY A;  2MC1 A;  1D4W A;  1YVH A;  1FYR A;  1O4Q A;  1R1Q A;  3HHM B;  3S8L A;  3OVE A;  1HCT B;  1BHF A;  3OB2 B;  3CXL A;  3MXC A;  4K2R A;  1LKL A;  3VS7 A;  1M61 A;  3PSJ A;  2MRJ A;  3UF4 A;  1SPR A;  3GQI B;  1BM2 A;  1Y57 A;  2ROR A;  1A1A A;  1BLJ A;  2RMX A;  2DLY A;  2H5K A;  4NWG A;  1O4G A;  1O41 A;  1LCJ A;  5EHR A;  3OV1 A;  3MXY A;  4A4C A;  1NZV A;  2LNW A;  2Y1M A;  1A1B A;  4OHE A;  4OHH A;  2HCK A;  1SKJ A;  2CI9 A;  2YU7 A;  2IUI A;  2CR4 A;  2DM0 A;  4M4Z A;  5BO4 A;  2PNB A;  3WA4 A;  4OHI A;  1LUI A;  1IJR A;  3PSK A;  1HCS B;  1MW4 A;  2B3O A;  1X0N A;  1O4M A;  5I6V A;  3VS4 A;  3CD3 A;  2EYZ A;  3VRQ A;  1O45 A;  1AYB A;  3TL0 A;  3C7I A;  2HDX A;  2XP1 A;  1OO4 A;  5GJI A;  1FU5 A;  1JWO A;  1O4F A;  1R1P A;  1O4H A;  1O4E A;  4GWF A; 
#chains in the Genus database with same CATH homology
 1BFJ A;  1AOU F;  1LKK A;  2AOB A;  1A07 A;  4EIH A;  1LUM A;  4K11 A;  3PFV A;  1SHB A;  4JEG A;  1BF5 A;  3PJP A;  4OHL A;  2H46 E;  4E68 A;  2BBU A;  3MAZ A;  1O4J A;  4A4B A;  3IN8 A;  2ABL A;  1JYQ A;  3HIZ B;  2CRH A;  2C0I A;  2DVJ A;  1O4B A;  5J3X A;  3VGO A;  1F1W A;  5CDW A;  1M27 A;  1A09 A;  1O4D A;  3VRN A;  1D4T A;  1XA6 A;  3S9K A;  1KC2 A;  2ETZ A;  1JYR A;  1KA7 A;  2EO3 A;  4F59 A;  3S8O A;  2L6K A;  4LUE A;  5EEQ A;  1O4P A;  1BKM A;  2L3T A;  2GSB A;  2EOB A;  4P9Z A;  2HUW A;  4D8K A;  3GXX A;  1AYA A;  1SPS A;  2PLD A;  1AYD A;  3M7F A;  1WQU A;  3K2M A;  1X6C A;  2K7A B;  1QG1 E;  3N84 A;  1O4L A;  1FMK A;  4U1P A;  1AD5 A;  1AB2 A;  5GJH A;  1FBV A;  3VRP A;  3QWX X;  2EKX A;  3IMD A;  1O4R A;  2KNO A;  1H9O A;  1OPL A;  2L4K A;  3CWG A;  1BMB A;  1BHH A;  4FBN A;  1YVL A;  3BUN B;  1O46 A;  1CWD L;  3ZNI A;  3OP0 A;  2MQI A;  2VIF A;  1A08 A;  1A1C A;  3BUM B;  1P13 A;  1O44 A;  1FU6 A;  5IBS A;  2H8H A;  1I3Z A;  2HDV A;  1PIC A;  2DLZ A;  5DC0 B;  2SRC A;  5HKW A;  3BUW B;  1RPY A;  1O4K A;  1QCF A;  1OO3 A;  3IMJ A;  1GHU A;  4EY0 A;  1FHS A;  2JYQ A;  2AUG A;  3BUO B;  3US4 A;  1LCK A;  1CSZ A;  1Y1U A;  1LUK A;  3TKZ A;  3HCK A;  4OHD A;  5EHP A;  1A1E A;  1B47 A;  2OQ1 A;  4K45 A;  1BLK A;  3N8M A;  2KK6 A;  1BKL A;  1F2F A;  3EAC A;  2YSX A;  5HKZ A;  2RVF A;  2EU0 A;  3VS3 A;  1O4C A;  2EYV A;  2CS0 A;  2Y1N A;  4DGP A;  4F5A A;  3IN7 A;  2CIA A;  2LCT A;  1GRI A;  5DC9 A;  3UYO A;  1Z3K A;  3KFJ A;  4ROJ A;  4DGX A;  2LNX A;  1O49 A;  5IBM A;  2RSY A;  3BUX B;  2QMS A;  1RJA A;  3N7Y A;  1RQQ C;  1D1Z A;  1O48 A;  1FBZ A;  4X6S A;  1O4A A;  3PQZ A;  2C0O A;  2PNA A;  4K44 A;  5EG3 B;  1O4N A;  2C0T A;  4LUD A;  1LUN A;  3VS0 A;  4E93 A;  1TCE A;  1ZFP E;  1KSW A;  2FO0 A;  2MRK A;  1CJ1 A;  4NWF A;  1K9A A;  1IS0 A;  1TZE E;  1OPK A;  2SHP A;  1CSY A;  1UUS A;  2GE9 A;  3CBL A;  4H1O A;  4L1B B;  3VRZ A;  1O4I A;  3PLF B;  3VRY A;  2IZV A;  1JU5 A;  5HKY A;  1AYC A;  2IUH A;  1A81 A;  4WWQ A;  3OB1 B;  2CI8 A;  1O43 A;  1CWE A;  1UUR A;  2DCR A;  2DX0 A;  1O4O A;  3VS1 A;  1SHA A;  2EL8 A;  3QWY A;  1X27 A;  3NHN A;  1NRV A;  3VS6 A;  2K79 B;  1O47 A;  2LQW A;  4XZ1 A;  1SHD A;  2ECD A;  2EO6 A;  4GL9 E;  1BG1 A;  5DF6 A;  2C9W A;  5KAZ A;  2HMH A;  3EAZ A;  2CBL A;  4QSY A;  1QAD A;  4FL3 A;  1NZL A;  4FL2 A;  1MIL A;  2IUG A;  1R1S A;  5DC4 A;  2LQN A;  1KA6 A;  2AOA A;  5AXI A;  4JE4 A;  4U17 A;  3VRR A;  3PS5 A;  5D0J A;  4JGH A;  3VS2 A;  4XZ0 A;  2PLE A;  5EEL A;  5AUL A;  4P9V A;  3VS5 A;  4H34 A;  4TZI A;  3T04 A;  1BFI A;  2OZO A;  1BHH B;  2Y3A B;  1JYU A;  4GPL B;  2PTK A;  2FCI A;  3VRO A;  3GXW A;  3S8N A;  2MK2 A;  3BKB A;  1O42 A;  1AOT F;  1G83 A;  4F5B A;  2EYY A;  2MC1 A;  1D4W A;  1YVH A;  1FYR A;  1O4Q A;  1R1Q A;  3HHM B;  3S8L A;  3OVE A;  1HCT B;  1BHF A;  3OB2 B;  3CXL A;  3MXC A;  4K2R A;  1LKL A;  3VS7 A;  1M61 A;  3PSJ A;  2MRJ A;  3UF4 A;  1SPR A;  3GQI B;  1BM2 A;  1Y57 A;  2ROR A;  1A1A A;  1BLJ A;  2RMX A;  2DLY A;  2H5K A;  4NWG A;  1O4G A;  1O41 A;  1LCJ A;  5EHR A;  3OV1 A;  3MXY A;  4A4C A;  1NZV A;  2LNW A;  2Y1M A;  1A1B A;  4OHE A;  4OHH A;  2HCK A;  1SKJ A;  2CI9 A;  2YU7 A;  2IUI A;  2CR4 A;  2DM0 A;  4M4Z A;  5BO4 A;  2PNB A;  3WA4 A;  4OHI A;  1LUI A;  1IJR A;  3PSK A;  1HCS B;  1MW4 A;  2B3O A;  1X0N A;  1O4M A;  5I6V A;  3VS4 A;  3CD3 A;  2EYZ A;  3VRQ A;  1O45 A;  1AYB A;  3TL0 A;  3C7I A;  2HDX A;  2XP1 A;  1OO4 A;  5GJI A;  1FU5 A;  1JWO A;  1O4F A;  1R1P A;  1O4H A;  1O4E A;  4GWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...