3S8LA

Protein-ligand interactions: thermodynamic effects associated with increasing hydrophobic surface area
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
b'EMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth factor receptor-bound protein 2
publication title Protein-ligand interactions: thermodynamic effects associated with increasing nonpolar surface area.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/antagonist
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3s8lA00
2IUGA 5GJHA 3GQIB 1G83A 2LNWA 1A07A 1FBZA 4XZ1A 1M27A 1A1CA 4U1PA 3HCKA 3OP0A 1O41A 2PNBA 2ECDA 1H9OA 2H8HA 1O4OA 5DC4A 4F5BA 1SHAA 4DGPA 1O4MA 1OPLA 2GE9A 3CWGA 1SHDA 2IZVA 5I6VA 1O4JA 2FCIA 4FL2A 2HCKA 2RSYA 2LQWA 1FMKA 1A08A 2AOBA 3IN8A 2C0IA 1RPYA 3N8MA 2EYZA 1O48A 1JWOA 1CWEA 4XZ0A 4A4BA 1LCJA 3BUNB 3CXLA 4P9ZA 3VRYA 1O4HA 2L6KA 4TZIA 1O4EA 1O4KA 2XP1A 1AYAA 3IMDA 3S8NA 1BKMA 3N84A 4FL3A 3BUXB 3VRPA 2OZOA 5DF6A 2B3OA 3IMJA 4LUDA 1AOTF 3MAZA 2HDVA 3TKZA 2L3TA 1GRIA 2DCRA 4K45A 5HKZA 2HDXA 2VIFA 2RORA 2DX0A 5DC9A 1AYBA 3M7FA 2EKXA 2YU7A 1HCSB 3UF4A 1FU5A 4NWFA 1LKLA 4OHIA 2JYQA 3T04A 5J3XA 1BFJA 3BUOB 2H46E 3TL0A 2MK2A 2EL8A 1FBVA 1M61A 2PLDA 1MILA 2CIAA 1BFIA 1CSYA 2CS0A 5BO4A 4P9VA 1A81A 1BHHA 4JEGA 4X6SA 1O4LA 3EACA 3PSJA 2HMHA 2EYVA 5EG3B 1OO4A 1AYDA 1O4GA 1BHHB 2HUWA 1XA6A 1O45A 3BUWB 1MW4A 3VS1A 1O4CA 4OHLA 4H34A 1UURA 1QG1E 4EY0A 3HHMB 3VRZA 2MC1A 3VS4A 3PSKA 1AYCA 2PTKA 2C9WA 1O42A 1PICA 1O4NA 3NHNA 1I3ZA 4M4ZA 1BMBA 1BM2A 1TCEA 3PFVA 4K11A 2EO3A 1B47A 1NRVA 3MXCA 3OVEA 1ZFPE 4NWGA 1KSWA 4JGHA 1JU5A 1JYQA 3IN7A 1O4FA 3OV1A 3HIZB 3PS5A 1R1QA 5IBMA 1OPKA 4H1OA 1NZLA 1KA7A 5EEQA 2CRHA 2Y1MA 3S8OA 3VS0A 3PJPA 5D0JA 1CSZA 1P13A 3PLFB 2ETZA 3BKBA 4E68A 1R1PA 2YSXA 2KNOA 1A1AA 1K9AA 1X27A 2DVJA 5AULA 3N7YA 2PLEA 1X6CA 2IUHA 2Y1NA 1AD5A 1KA6A 3S8LA 2CBLA 2LCTA 2CI9A 2K7AB 1BLKA 3VRNA 1SPRA 2AOAA 4OHHA 4EIHA 1BF5A 1F2FA 3VS2A 2DLZA 3US4A 2DLYA 3WA4A 2ABLA 2EU0A 2FO0A 1HCTB 1LUMA 1Z3KA 1Y57A 1UUSA 2MQIA 2MRJA 4E93A 3VS5A 1BG1A 1KC2A 3MXYA 4LUEA 5KAZA 3UYOA 1CWDL 3QWYA 1SKJA 2SRCA 4QSYA 2SHPA 1LUNA 5HKWA 1O4IA 4F59A 2MRKA 4K2RA 1GHUA 1LUKA 1LUIA 4K44A 2CI8A 2DM0A 2IUIA 1D1ZA 4FBNA 1BKLA 1O4DA 3C7IA 2RMXA 5DC0B 3VROA 1CJ1A 1X0NA 4ROJA 4OHEA 1D4TA 1RJAA 4L1BB 3K2MA 4F5AA 5IBSA 2EOBA 5AXIA 1R1SA 4DGXA 3KFJA 1SHBA 4OHDA 3CD3A 2CR4A 1IJRA 2RVFA 1O43A 1F1WA 3QWXX 1RQQC 2Y3AB 1LCKA 1O4BA 1FYRA 4A4CA 2QMSA 1O4RA 3CBLA 4GPLB 1OO3A 1O46A 1BLJA 3EAZA 1D4WA 1AB2A 4GL9E 2OQ1A 2EYYA 3VS6A 3OB1B 5CDWA 1O4PA 4D8KA 5EHRA 4WWQA 3VS3A 1FU6A 1O49A 2LNXA 3GXWA 4JE4A 1A1BA 5EELA 1O47A 1A1EA 3GXXA 3BUMB 1NZVA 2EO6A 3VS7A 2C0OA 2LQNA 1QADA 1JYUA 3ZNIA 1SPSA 2C0TA 2PNAA 1FHSA 1TZEE 3VRRA 1YVLA 5EHPA 2AUGA 2K79B 1O44A 1AOUF 1WQUA 2GSBA 2L4KA 1LKKA 1YVHA 4U17A 5HKYA 1O4AA 1JYRA 1A09A 5GJIA 1IS0A 3PQZA 1BHFA 2H5KA 3VGOA 3S9KA 3VRQA 1Y1UA 1QCFA 2BBUA 3OB2B 1O4QA 2KK6A 4GWFA
chains in the Genus database with same CATH superfamily
2IUGA 5GJHA 3GQIB 1G83A 2LNWA 1A07A 1FBZA 4XZ1A 1M27A 1A1CA 4U1PA 3HCKA 3OP0A 1O41A 2PNBA 2ECDA 1H9OA 2H8HA 1O4OA 5DC4A 4F5BA 1SHAA 4DGPA 1O4MA 1OPLA 2GE9A 3CWGA 1SHDA 2IZVA 5I6VA 1O4JA 2FCIA 4FL2A 2HCKA 2RSYA 2LQWA 1FMKA 1A08A 2AOBA 3IN8A 2C0IA 1RPYA 3N8MA 2EYZA 1O48A 1JWOA 1CWEA 4XZ0A 4A4BA 1LCJA 3BUNB 3CXLA 4P9ZA 3VRYA 1O4HA 2L6KA 4TZIA 1O4EA 1O4KA 2XP1A 1AYAA 3IMDA 3S8NA 1BKMA 3N84A 4FL3A 2LRAA 3BUXB 3VRPA 2OZOA 5DF6A 2B3OA 3IMJA 4LUDA 1AOTF 3MAZA 2HDVA 3TKZA 2L3TA 1GRIA 2DCRA 4K45A 5HKZA 2HDXA 2VIFA 2RORA 2DX0A 5DC9A 1AYBA 3M7FA 2EKXA 2YU7A 1HCSB 3UF4A 1FU5A 4NWFA 1LKLA 4OHIA 2JYQA 3T04A 5J3XA 1BFJA 3BUOB 2H46E 3TL0A 2MK2A 2EL8A 1FBVA 1M61A 2PLDA 1MILA 2CIAA 1BFIA 1CSYA 2CS0A 5BO4A 4P9VA 1A81A 1BHHA 4JEGA 4X6SA 1O4LA 3EACA 3PSJA 2HMHA 2EYVA 5EG3B 1OO4A 1AYDA 1O4GA 1BHHB 2HUWA 1XA6A 1O45A 3BUWB 1MW4A 3VS1A 1O4CA 4OHLA 4H34A 1UURA 1QG1E 4EY0A 3HHMB 3VRZA 2MC1A 3VS4A 3PSKA 1AYCA 2PTKA 2C9WA 1O42A 1PICA 1O4NA 3NHNA 1I3ZA 4M4ZA 1BMBA 1BM2A 1TCEA 3PFVA 4K11A 2EO3A 1B47A 1NRVA 3MXCA 3OVEA 1ZFPE 4NWGA 1KSWA 4JGHA 1JU5A 1JYQA 3IN7A 1O4FA 3OV1A 3HIZB 3PS5A 1R1QA 5IBMA 1OPKA 4H1OA 1NZLA 1KA7A 5EEQA 2CRHA 2Y1MA 3S8OA 3VS0A 3PJPA 5D0JA 1CSZA 1P13A 3PLFB 2ETZA 3BKBA 4E68A 1R1PA 2YSXA 2KNOA 1A1AA 1K9AA 1X27A 2DVJA 5AULA 3K2TA 3N7YA 2PLEA 1X6CA 2IUHA 2Y1NA 1AD5A 1KA6A 3S8LA 2CBLA 2LCTA 2CI9A 2K7AB 1BLKA 3VRNA 1SPRA 2AOAA 4OHHA 4EIHA 1BF5A 1F2FA 3VS2A 2DLZA 3US4A 2DLYA 3WA4A 2ABLA 2EU0A 2FO0A 1HCTB 1LUMA 1Z3KA 1Y57A 1UUSA 2MQIA 2MRJA 4E93A 3VS5A 1BG1A 1KC2A 3MXYA 4LUEA 5KAZA 3UYOA 1CWDL 3QWYA 1SKJA 2SRCA 4QSYA 2SHPA 1LUNA 5HKWA 1O4IA 4F59A 2MRKA 4K2RA 1GHUA 1LUKA 1LUIA 3LYVA 4K44A 2CI8A 2DM0A 2IUIA 1D1ZA 4FBNA 1BKLA 1O4DA 3C7IA 2RMXA 5DC0B 3VROA 1CJ1A 1X0NA 4ROJA 4OHEA 1D4TA 1RJAA 4L1BB 3K2MA 4F5AA 5IBSA 2EOBA 5AXIA 1R1SA 4DGXA 3KFJA 1SHBA 4OHDA 3CD3A 2CR4A 1IJRA 2RVFA 1O43A 1F1WA 3QWXX 1RQQC 2Y3AB 1LCKA 1O4BA 1FYRA 4A4CA 2QMSA 1O4RA 3CBLA 4GPLB 1OO3A 1O46A 1BLJA 3EAZA 1D4WA 1AB2A 4GL9E 2OQ1A 2EYYA 3VS6A 3OB1B 5CDWA 1O4PA 4D8KA 5EHRA 4WWQA 3VS3A 1FU6A 1O49A 2LNXA 3GXWA 4JE4A 1A1BA 5EELA 1O47A 1A1EA 3GXXA 3BUMB 1NZVA 2EO6A 3VS7A 2C0OA 2LQNA 1QADA 1JYUA 3ZNIA 1SPSA 2C0TA 2PNAA 1FHSA 1TZEE 3VRRA 1YVLA 5EHPA 2AUGA 2K79B 1O44A 1AOUF 1WQUA 2GSBA 2KGYA 2L4KA 1LKKA 1YVHA 4U17A 5HKYA 1O4AA 1JYRA 1A09A 5GJIA 1IS0A 3PQZA 1BHFA 2H5KA 3VGOA 3S9KA 3VRQA 1Y1UA 1QCFA 2BBUA 3OB2B 1O4QA 2KK6A 4GWFA
chains in the Genus database with same CATH topology
2IUGA 5GJHA 3GQIB 1G83A 2LNWA 1A07A 1FBZA 4XZ1A 1M27A 1A1CA 4U1PA 3HCKA 3OP0A 1O41A 2PNBA 2ECDA 1H9OA 2H8HA 1O4OA 5DC4A 4F5BA 1SHAA 4DGPA 1O4MA 1OPLA 2GE9A 3CWGA 1SHDA 2IZVA 5I6VA 1O4JA 2FCIA 4FL2A 2HCKA 2RSYA 2LQWA 1FMKA 1A08A 2AOBA 3IN8A 2C0IA 1RPYA 3N8MA 2EYZA 1O48A 1JWOA 1CWEA 4XZ0A 4A4BA 1LCJA 3BUNB 3CXLA 4P9ZA 3VRYA 1O4HA 2L6KA 4TZIA 1O4EA 1O4KA 2XP1A 1AYAA 3IMDA 3S8NA 1BKMA 3N84A 4FL3A 3BUXB 3VRPA 2OZOA 5DF6A 2B3OA 3IMJA 4LUDA 1AOTF 3MAZA 2HDVA 3TKZA 2L3TA 1GRIA 2DCRA 4K45A 5HKZA 2HDXA 2VIFA 2RORA 2DX0A 5DC9A 1AYBA 3M7FA 2EKXA 2YU7A 1HCSB 3UF4A 1FU5A 4NWFA 1LKLA 4OHIA 2JYQA 3T04A 5J3XA 1BFJA 3BUOB 2H46E 3TL0A 2MK2A 2EL8A 1FBVA 1M61A 2PLDA 1MILA 2CIAA 1BFIA 1CSYA 2CS0A 5BO4A 4P9VA 1A81A 1BHHA 4JEGA 4X6SA 1O4LA 3EACA 3PSJA 2HMHA 2EYVA 5EG3B 1OO4A 1AYDA 1O4GA 1BHHB 2HUWA 1XA6A 1O45A 3BUWB 1MW4A 3VS1A 1O4CA 4OHLA 4H34A 1UURA 1QG1E 4EY0A 3HHMB 3VRZA 2MC1A 3VS4A 3PSKA 1AYCA 2PTKA 2C9WA 1O42A 1PICA 1O4NA 3NHNA 1I3ZA 4M4ZA 1BMBA 1BM2A 1TCEA 3PFVA 4K11A 2EO3A 1B47A 1NRVA 3MXCA 3OVEA 1ZFPE 4NWGA 1KSWA 4JGHA 1JU5A 1JYQA 3IN7A 1O4FA 3OV1A 3HIZB 3PS5A 1R1QA 5IBMA 1OPKA 4H1OA 1NZLA 1KA7A 5EEQA 2CRHA 2Y1MA 3S8OA 3VS0A 3PJPA 5D0JA 1CSZA 1P13A 3PLFB 2ETZA 3BKBA 4E68A 1R1PA 2YSXA 2KNOA 1A1AA 1K9AA 1X27A 2DVJA 5AULA 3N7YA 2PLEA 1X6CA 2IUHA 2Y1NA 1AD5A 1KA6A 3S8LA 2CBLA 2LCTA 2CI9A 2K7AB 1BLKA 3VRNA 1SPRA 2AOAA 4OHHA 4EIHA 1BF5A 1F2FA 3VS2A 2DLZA 3US4A 2DLYA 3WA4A 2ABLA 2EU0A 2FO0A 1HCTB 1LUMA 1Z3KA 1Y57A 1UUSA 2MQIA 2MRJA 4E93A 3VS5A 1BG1A 1KC2A 3MXYA 4LUEA 5KAZA 3UYOA 1CWDL 3QWYA 1SKJA 2SRCA 4QSYA 2SHPA 1LUNA 5HKWA 1O4IA 4F59A 2MRKA 4K2RA 1GHUA 1LUKA 1LUIA 4K44A 2CI8A 2DM0A 2IUIA 1D1ZA 4FBNA 1BKLA 1O4DA 3C7IA 2RMXA 5DC0B 3VROA 1CJ1A 1X0NA 4ROJA 4OHEA 1D4TA 1RJAA 4L1BB 3K2MA 4F5AA 5IBSA 2EOBA 5AXIA 1R1SA 4DGXA 3KFJA 1SHBA 4OHDA 3CD3A 2CR4A 1IJRA 2RVFA 1O43A 1F1WA 3QWXX 1RQQC 2Y3AB 1LCKA 1O4BA 1FYRA 4A4CA 2QMSA 1O4RA 3CBLA 4GPLB 1OO3A 1O46A 1BLJA 3EAZA 1D4WA 1AB2A 4GL9E 2OQ1A 2EYYA 3VS6A 3OB1B 5CDWA 1O4PA 4D8KA 5EHRA 4WWQA 3VS3A 1FU6A 1O49A 2LNXA 3GXWA 4JE4A 1A1BA 5EELA 1O47A 1A1EA 3GXXA 3BUMB 1NZVA 2EO6A 3VS7A 2C0OA 2LQNA 1QADA 1JYUA 3ZNIA 1SPSA 2C0TA 2PNAA 1FHSA 1TZEE 3VRRA 1YVLA 5EHPA 2AUGA 2K79B 1O44A 1AOUF 1WQUA 2GSBA 2L4KA 1LKKA 1YVHA 4U17A 5HKYA 1O4AA 1JYRA 1A09A 5GJIA 1IS0A 3PQZA 1BHFA 2H5KA 3VGOA 3S9KA 3VRQA 1Y1UA 1QCFA 2BBUA 3OB2B 1O4QA 2KK6A 4GWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUG A;  5GJH A;  3GQI B;  1G83 A;  2LNW A;  1A07 A;  1FBZ A;  4XZ1 A;  1M27 A;  1A1C A;  4U1P A;  3HCK A;  3OP0 A;  1O41 A;  2PNB A;  2ECD A;  1H9O A;  2H8H A;  1O4O A;  5DC4 A;  4F5B A;  1SHA A;  4DGP A;  1O4M A;  1OPL A;  2GE9 A;  3CWG A;  1SHD A;  2IZV A;  5I6V A;  1O4J A;  2FCI A;  4FL2 A;  2HCK A;  2RSY A;  2LQW A;  1FMK A;  1A08 A;  2AOB A;  3IN8 A;  2C0I A;  1RPY A;  3N8M A;  2EYZ A;  1O48 A;  1JWO A;  1CWE A;  4XZ0 A;  4A4B A;  1LCJ A;  3BUN B;  3CXL A;  4P9Z A;  3VRY A;  1O4H A;  2L6K A;  4TZI A;  1O4E A;  1O4K A;  2XP1 A;  1AYA A;  3IMD A;  3S8N A;  1BKM A;  3N84 A;  4FL3 A;  3BUX B;  3VRP A;  2OZO A;  5DF6 A;  2B3O A;  3IMJ A;  4LUD A;  1AOT F;  3MAZ A;  2HDV A;  3TKZ A;  2L3T A;  1GRI A;  2DCR A;  4K45 A;  5HKZ A;  2HDX A;  2VIF A;  2ROR A;  2DX0 A;  5DC9 A;  1AYB A;  3M7F A;  2EKX A;  2YU7 A;  1HCS B;  3UF4 A;  1FU5 A;  4NWF A;  1LKL A;  4OHI A;  2JYQ A;  3T04 A;  5J3X A;  1BFJ A;  3BUO B;  2H46 E;  3TL0 A;  2MK2 A;  2EL8 A;  1FBV A;  1M61 A;  2PLD A;  1MIL A;  2CIA A;  1BFI A;  1CSY A;  2CS0 A;  5BO4 A;  4P9V A;  1A81 A;  1BHH A;  4JEG A;  4X6S A;  1O4L A;  3EAC A;  3PSJ A;  2HMH A;  2EYV A;  5EG3 B;  1OO4 A;  1AYD A;  1O4G A;  1BHH B;  2HUW A;  1XA6 A;  1O45 A;  3BUW B;  1MW4 A;  3VS1 A;  1O4C A;  4OHL A;  4H34 A;  1UUR A;  1QG1 E;  4EY0 A;  3HHM B;  3VRZ A;  2MC1 A;  3VS4 A;  3PSK A;  1AYC A;  2PTK A;  2C9W A;  1O42 A;  1PIC A;  1O4N A;  3NHN A;  1I3Z A;  4M4Z A;  1BMB A;  1BM2 A;  1TCE A;  3PFV A;  4K11 A;  2EO3 A;  1B47 A;  1NRV A;  3MXC A;  3OVE A;  1ZFP E;  4NWG A;  1KSW A;  4JGH A;  1JU5 A;  1JYQ A;  3IN7 A;  1O4F A;  3OV1 A;  3HIZ B;  3PS5 A;  1R1Q A;  5IBM A;  1OPK A;  4H1O A;  1NZL A;  1KA7 A;  5EEQ A;  2CRH A;  2Y1M A;  3S8O A;  3VS0 A;  3PJP A;  5D0J A;  1CSZ A;  1P13 A;  3PLF B;  2ETZ A;  3BKB A;  4E68 A;  1R1P A;  2YSX A;  2KNO A;  1A1A A;  1K9A A;  1X27 A;  2DVJ A;  5AUL A;  3N7Y A;  2PLE A;  1X6C A;  2IUH A;  2Y1N A;  1AD5 A;  1KA6 A;  3S8L A;  2CBL A;  2LCT A;  2CI9 A;  2K7A B;  1BLK A;  3VRN A;  1SPR A;  2AOA A;  4OHH A;  4EIH A;  1BF5 A;  1F2F A;  3VS2 A;  2DLZ A;  3US4 A;  2DLY A;  3WA4 A;  2ABL A;  2EU0 A;  2FO0 A;  1HCT B;  1LUM A;  1Z3K A;  1Y57 A;  1UUS A;  2MQI A;  2MRJ A;  4E93 A;  3VS5 A;  1BG1 A;  1KC2 A;  3MXY A;  4LUE A;  5KAZ A;  3UYO A;  1CWD L;  3QWY A;  1SKJ A;  2SRC A;  4QSY A;  2SHP A;  1LUN A;  5HKW A;  1O4I A;  4F59 A;  2MRK A;  4K2R A;  1GHU A;  1LUK A;  1LUI A;  4K44 A;  2CI8 A;  2DM0 A;  2IUI A;  1D1Z A;  4FBN A;  1BKL A;  1O4D A;  3C7I A;  2RMX A;  5DC0 B;  3VRO A;  1CJ1 A;  1X0N A;  4ROJ A;  4OHE A;  1D4T A;  1RJA A;  4L1B B;  3K2M A;  4F5A A;  5IBS A;  2EOB A;  5AXI A;  1R1S A;  4DGX A;  3KFJ A;  1SHB A;  4OHD A;  3CD3 A;  2CR4 A;  1IJR A;  2RVF A;  1O43 A;  1F1W A;  3QWX X;  1RQQ C;  2Y3A B;  1LCK A;  1O4B A;  1FYR A;  4A4C A;  2QMS A;  1O4R A;  3CBL A;  4GPL B;  1OO3 A;  1O46 A;  1BLJ A;  3EAZ A;  1D4W A;  1AB2 A;  4GL9 E;  2OQ1 A;  2EYY A;  3VS6 A;  3OB1 B;  5CDW A;  1O4P A;  4D8K A;  5EHR A;  4WWQ A;  3VS3 A;  1FU6 A;  1O49 A;  2LNX A;  3GXW A;  4JE4 A;  1A1B A;  5EEL A;  1O47 A;  1A1E A;  3GXX A;  3BUM B;  1NZV A;  2EO6 A;  3VS7 A;  2C0O A;  2LQN A;  1QAD A;  1JYU A;  3ZNI A;  1SPS A;  2C0T A;  2PNA A;  1FHS A;  1TZE E;  3VRR A;  1YVL A;  5EHP A;  2AUG A;  2K79 B;  1O44 A;  1AOU F;  1WQU A;  2GSB A;  2L4K A;  1LKK A;  1YVH A;  4U17 A;  5HKY A;  1O4A A;  1JYR A;  1A09 A;  5GJI A;  1IS0 A;  3PQZ A;  1BHF A;  2H5K A;  3VGO A;  3S9K A;  3VRQ A;  1Y1U A;  1QCF A;  2BBU A;  3OB2 B;  1O4Q A;  2KK6 A;  4GWF A; 
#chains in the Genus database with same CATH topology
 2IUG A;  5GJH A;  3GQI B;  1G83 A;  2LNW A;  1A07 A;  1FBZ A;  4XZ1 A;  1M27 A;  1A1C A;  4U1P A;  3HCK A;  3OP0 A;  1O41 A;  2PNB A;  2ECD A;  1H9O A;  2H8H A;  1O4O A;  5DC4 A;  4F5B A;  1SHA A;  4DGP A;  1O4M A;  1OPL A;  2GE9 A;  3CWG A;  1SHD A;  2IZV A;  5I6V A;  1O4J A;  2FCI A;  4FL2 A;  2HCK A;  2RSY A;  2LQW A;  1FMK A;  1A08 A;  2AOB A;  3IN8 A;  2C0I A;  1RPY A;  3N8M A;  2EYZ A;  1O48 A;  1JWO A;  1CWE A;  4XZ0 A;  4A4B A;  1LCJ A;  3BUN B;  3CXL A;  4P9Z A;  3VRY A;  1O4H A;  2L6K A;  4TZI A;  1O4E A;  1O4K A;  2XP1 A;  1AYA A;  3IMD A;  3S8N A;  1BKM A;  3N84 A;  4FL3 A;  2LRA A;  3BUX B;  3VRP A;  2OZO A;  5DF6 A;  2B3O A;  3IMJ A;  4LUD A;  1AOT F;  3MAZ A;  2HDV A;  3TKZ A;  2L3T A;  1GRI A;  2DCR A;  4K45 A;  5HKZ A;  2HDX A;  2VIF A;  2ROR A;  2DX0 A;  5DC9 A;  1AYB A;  3M7F A;  2EKX A;  2YU7 A;  1HCS B;  3UF4 A;  1FU5 A;  4NWF A;  1LKL A;  4OHI A;  2JYQ A;  3T04 A;  5J3X A;  1BFJ A;  3BUO B;  2H46 E;  3TL0 A;  2MK2 A;  2EL8 A;  1FBV A;  1M61 A;  2PLD A;  1MIL A;  2CIA A;  1BFI A;  1CSY A;  2CS0 A;  5BO4 A;  4P9V A;  1A81 A;  1BHH A;  4JEG A;  4X6S A;  1O4L A;  3EAC A;  3PSJ A;  2HMH A;  2EYV A;  5EG3 B;  1OO4 A;  1AYD A;  1O4G A;  1BHH B;  2HUW A;  1XA6 A;  1O45 A;  3BUW B;  1MW4 A;  3VS1 A;  1O4C A;  4OHL A;  4H34 A;  1UUR A;  1QG1 E;  4EY0 A;  3HHM B;  3VRZ A;  2MC1 A;  3VS4 A;  3PSK A;  1AYC A;  2PTK A;  2C9W A;  1O42 A;  1PIC A;  1O4N A;  3NHN A;  1I3Z A;  4M4Z A;  1BMB A;  1BM2 A;  1TCE A;  3PFV A;  4K11 A;  2EO3 A;  1B47 A;  1NRV A;  3MXC A;  3OVE A;  1ZFP E;  4NWG A;  1KSW A;  4JGH A;  1JU5 A;  1JYQ A;  3IN7 A;  1O4F A;  3OV1 A;  3HIZ B;  3PS5 A;  1R1Q A;  5IBM A;  1OPK A;  4H1O A;  1NZL A;  1KA7 A;  5EEQ A;  2CRH A;  2Y1M A;  3S8O A;  3VS0 A;  3PJP A;  5D0J A;  1CSZ A;  1P13 A;  3PLF B;  2ETZ A;  3BKB A;  4E68 A;  1R1P A;  2YSX A;  2KNO A;  1A1A A;  1K9A A;  1X27 A;  2DVJ A;  5AUL A;  3K2T A;  3N7Y A;  2PLE A;  1X6C A;  2IUH A;  2Y1N A;  1AD5 A;  1KA6 A;  3S8L A;  2CBL A;  2LCT A;  2CI9 A;  2K7A B;  1BLK A;  3VRN A;  1SPR A;  2AOA A;  4OHH A;  4EIH A;  1BF5 A;  1F2F A;  3VS2 A;  2DLZ A;  3US4 A;  2DLY A;  3WA4 A;  2ABL A;  2EU0 A;  2FO0 A;  1HCT B;  1LUM A;  1Z3K A;  1Y57 A;  1UUS A;  2MQI A;  2MRJ A;  4E93 A;  3VS5 A;  1BG1 A;  1KC2 A;  3MXY A;  4LUE A;  5KAZ A;  3UYO A;  1CWD L;  3QWY A;  1SKJ A;  2SRC A;  4QSY A;  2SHP A;  1LUN A;  5HKW A;  1O4I A;  4F59 A;  2MRK A;  4K2R A;  1GHU A;  1LUK A;  1LUI A;  3LYV A;  4K44 A;  2CI8 A;  2DM0 A;  2IUI A;  1D1Z A;  4FBN A;  1BKL A;  1O4D A;  3C7I A;  2RMX A;  5DC0 B;  3VRO A;  1CJ1 A;  1X0N A;  4ROJ A;  4OHE A;  1D4T A;  1RJA A;  4L1B B;  3K2M A;  4F5A A;  5IBS A;  2EOB A;  5AXI A;  1R1S A;  4DGX A;  3KFJ A;  1SHB A;  4OHD A;  3CD3 A;  2CR4 A;  1IJR A;  2RVF A;  1O43 A;  1F1W A;  3QWX X;  1RQQ C;  2Y3A B;  1LCK A;  1O4B A;  1FYR A;  4A4C A;  2QMS A;  1O4R A;  3CBL A;  4GPL B;  1OO3 A;  1O46 A;  1BLJ A;  3EAZ A;  1D4W A;  1AB2 A;  4GL9 E;  2OQ1 A;  2EYY A;  3VS6 A;  3OB1 B;  5CDW A;  1O4P A;  4D8K A;  5EHR A;  4WWQ A;  3VS3 A;  1FU6 A;  1O49 A;  2LNX A;  3GXW A;  4JE4 A;  1A1B A;  5EEL A;  1O47 A;  1A1E A;  3GXX A;  3BUM B;  1NZV A;  2EO6 A;  3VS7 A;  2C0O A;  2LQN A;  1QAD A;  1JYU A;  3ZNI A;  1SPS A;  2C0T A;  2PNA A;  1FHS A;  1TZE E;  3VRR A;  1YVL A;  5EHP A;  2AUG A;  2K79 B;  1O44 A;  1AOU F;  1WQU A;  2GSB A;  2KGY A;  2L4K A;  1LKK A;  1YVH A;  4U17 A;  5HKY A;  1O4A A;  1JYR A;  1A09 A;  5GJI A;  1IS0 A;  3PQZ A;  1BHF A;  2H5K A;  3VGO A;  3S9K A;  3VRQ A;  1Y1U A;  1QCF A;  2BBU A;  3OB2 B;  1O4Q A;  2KK6 A;  4GWF A; 
#chains in the Genus database with same CATH homology
 2IUG A;  5GJH A;  3GQI B;  1G83 A;  2LNW A;  1A07 A;  1FBZ A;  4XZ1 A;  1M27 A;  1A1C A;  4U1P A;  3HCK A;  3OP0 A;  1O41 A;  2PNB A;  2ECD A;  1H9O A;  2H8H A;  1O4O A;  5DC4 A;  4F5B A;  1SHA A;  4DGP A;  1O4M A;  1OPL A;  2GE9 A;  3CWG A;  1SHD A;  2IZV A;  5I6V A;  1O4J A;  2FCI A;  4FL2 A;  2HCK A;  2RSY A;  2LQW A;  1FMK A;  1A08 A;  2AOB A;  3IN8 A;  2C0I A;  1RPY A;  3N8M A;  2EYZ A;  1O48 A;  1JWO A;  1CWE A;  4XZ0 A;  4A4B A;  1LCJ A;  3BUN B;  3CXL A;  4P9Z A;  3VRY A;  1O4H A;  2L6K A;  4TZI A;  1O4E A;  1O4K A;  2XP1 A;  1AYA A;  3IMD A;  3S8N A;  1BKM A;  3N84 A;  4FL3 A;  3BUX B;  3VRP A;  2OZO A;  5DF6 A;  2B3O A;  3IMJ A;  4LUD A;  1AOT F;  3MAZ A;  2HDV A;  3TKZ A;  2L3T A;  1GRI A;  2DCR A;  4K45 A;  5HKZ A;  2HDX A;  2VIF A;  2ROR A;  2DX0 A;  5DC9 A;  1AYB A;  3M7F A;  2EKX A;  2YU7 A;  1HCS B;  3UF4 A;  1FU5 A;  4NWF A;  1LKL A;  4OHI A;  2JYQ A;  3T04 A;  5J3X A;  1BFJ A;  3BUO B;  2H46 E;  3TL0 A;  2MK2 A;  2EL8 A;  1FBV A;  1M61 A;  2PLD A;  1MIL A;  2CIA A;  1BFI A;  1CSY A;  2CS0 A;  5BO4 A;  4P9V A;  1A81 A;  1BHH A;  4JEG A;  4X6S A;  1O4L A;  3EAC A;  3PSJ A;  2HMH A;  2EYV A;  5EG3 B;  1OO4 A;  1AYD A;  1O4G A;  1BHH B;  2HUW A;  1XA6 A;  1O45 A;  3BUW B;  1MW4 A;  3VS1 A;  1O4C A;  4OHL A;  4H34 A;  1UUR A;  1QG1 E;  4EY0 A;  3HHM B;  3VRZ A;  2MC1 A;  3VS4 A;  3PSK A;  1AYC A;  2PTK A;  2C9W A;  1O42 A;  1PIC A;  1O4N A;  3NHN A;  1I3Z A;  4M4Z A;  1BMB A;  1BM2 A;  1TCE A;  3PFV A;  4K11 A;  2EO3 A;  1B47 A;  1NRV A;  3MXC A;  3OVE A;  1ZFP E;  4NWG A;  1KSW A;  4JGH A;  1JU5 A;  1JYQ A;  3IN7 A;  1O4F A;  3OV1 A;  3HIZ B;  3PS5 A;  1R1Q A;  5IBM A;  1OPK A;  4H1O A;  1NZL A;  1KA7 A;  5EEQ A;  2CRH A;  2Y1M A;  3S8O A;  3VS0 A;  3PJP A;  5D0J A;  1CSZ A;  1P13 A;  3PLF B;  2ETZ A;  3BKB A;  4E68 A;  1R1P A;  2YSX A;  2KNO A;  1A1A A;  1K9A A;  1X27 A;  2DVJ A;  5AUL A;  3N7Y A;  2PLE A;  1X6C A;  2IUH A;  2Y1N A;  1AD5 A;  1KA6 A;  3S8L A;  2CBL A;  2LCT A;  2CI9 A;  2K7A B;  1BLK A;  3VRN A;  1SPR A;  2AOA A;  4OHH A;  4EIH A;  1BF5 A;  1F2F A;  3VS2 A;  2DLZ A;  3US4 A;  2DLY A;  3WA4 A;  2ABL A;  2EU0 A;  2FO0 A;  1HCT B;  1LUM A;  1Z3K A;  1Y57 A;  1UUS A;  2MQI A;  2MRJ A;  4E93 A;  3VS5 A;  1BG1 A;  1KC2 A;  3MXY A;  4LUE A;  5KAZ A;  3UYO A;  1CWD L;  3QWY A;  1SKJ A;  2SRC A;  4QSY A;  2SHP A;  1LUN A;  5HKW A;  1O4I A;  4F59 A;  2MRK A;  4K2R A;  1GHU A;  1LUK A;  1LUI A;  4K44 A;  2CI8 A;  2DM0 A;  2IUI A;  1D1Z A;  4FBN A;  1BKL A;  1O4D A;  3C7I A;  2RMX A;  5DC0 B;  3VRO A;  1CJ1 A;  1X0N A;  4ROJ A;  4OHE A;  1D4T A;  1RJA A;  4L1B B;  3K2M A;  4F5A A;  5IBS A;  2EOB A;  5AXI A;  1R1S A;  4DGX A;  3KFJ A;  1SHB A;  4OHD A;  3CD3 A;  2CR4 A;  1IJR A;  2RVF A;  1O43 A;  1F1W A;  3QWX X;  1RQQ C;  2Y3A B;  1LCK A;  1O4B A;  1FYR A;  4A4C A;  2QMS A;  1O4R A;  3CBL A;  4GPL B;  1OO3 A;  1O46 A;  1BLJ A;  3EAZ A;  1D4W A;  1AB2 A;  4GL9 E;  2OQ1 A;  2EYY A;  3VS6 A;  3OB1 B;  5CDW A;  1O4P A;  4D8K A;  5EHR A;  4WWQ A;  3VS3 A;  1FU6 A;  1O49 A;  2LNX A;  3GXW A;  4JE4 A;  1A1B A;  5EEL A;  1O47 A;  1A1E A;  3GXX A;  3BUM B;  1NZV A;  2EO6 A;  3VS7 A;  2C0O A;  2LQN A;  1QAD A;  1JYU A;  3ZNI A;  1SPS A;  2C0T A;  2PNA A;  1FHS A;  1TZE E;  3VRR A;  1YVL A;  5EHP A;  2AUG A;  2K79 B;  1O44 A;  1AOU F;  1WQU A;  2GSB A;  2L4K A;  1LKK A;  1YVH A;  4U17 A;  5HKY A;  1O4A A;  1JYR A;  1A09 A;  5GJI A;  1IS0 A;  3PQZ A;  1BHF A;  2H5K A;  3VGO A;  3S9K A;  3VRQ A;  1Y1U A;  1QCF A;  2BBU A;  3OB2 B;  1O4Q A;  2KK6 A;  4GWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...